F341478

General Info

Members Datasets Scaffolds Average Seq Length
228 190 456 130

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0538620|Ga0501084_0538620_285_770
Length 161
Sequence MVANGSALREPQDQKPELPARGSERRKGSTEMIEGSCHCGVVRWRFDGVPDSATACNCTVCRRYGVFWAYGHENEAIRVSGPTHAYAWGNRAIGFHFCPDCGCVAYWRASAPGKDGRRRIAVNLRLAPPEMVGAIVVDHFDGLNTWQDLPRDGRCIADMWF

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
105 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
106 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
107 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
108 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
109 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
110 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
111 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
112 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
113 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
131 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
147 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
150 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
151 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
152 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
153 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
154 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
155 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
156 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
157 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
158 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
159 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
160 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
161 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
162 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
163 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
164 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
165 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
182 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
188 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
189 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
190 2738541337 Pelomonas sp. BT06 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.28
Nodule 0.44
Rhizoplane 0.44
Rhizosphere 80.26
Stem 0
Stem Tuber 0
Unclassified 17.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0538620 3300054114 Unclassified 987
2 rootH1_10015527 3300003316 Bacteria 2668
3 rootL2_10013724 3300003322 Bacteria 10447
4 rootL2_10031539 3300003322 Bacteria 5259
5 rootL2_10045876 3300003322 Bacteria 3532
6 rootH1_10063627 3300003323 Bacteria 2285
7 rootH1_10343186 3300003323 Bacteria 3368
8 Ga0055540_1106369 3300003792 Bacteria 520
9 Ga0055531_10000001 3300003794 Bacteria 543586
10 Ga0055531_10045677 3300003794 Bacteria 1213
11 Ga0070670_100363338 3300005331 Bacteria 1273
12 Ga0070670_101642243 3300005331 Bacteria 591
13 Ga0070680_100671395 3300005336 Unclassified 891
14 Ga0070682_100213492 3300005337 Bacteria 1369
15 Ga0070691_10023268 3300005341 Bacteria 2877
16 Ga0070692_10073506 3300005345 Bacteria 1827
17 Ga0070692_11402953 3300005345 Bacteria 504
18 Ga0070668_100046321 3300005347 Bacteria 3339
19 Ga0070668_100338022 3300005347 Bacteria 1271
20 Ga0070668_100384677 3300005347 Bacteria 1195
21 Ga0070669_100139578 3300005353 Bacteria 1867
22 Ga0070674_100922325 3300005356 Bacteria 762
23 Ga0070700_100022251 3300005441 Bacteria 3694
24 Ga0070700_100234738 3300005441 Unclassified 1307
25 Ga0070678_100247394 3300005456 Bacteria 1494
26 Ga0068853_100008298 3300005539 Bacteria 8339
27 Ga0068853_100544555 3300005539 Bacteria 1099
28 Ga0070672_100246915 3300005543 Bacteria 1503
29 Ga0070695_100019103 3300005545 Unclassified 4168
30 Ga0070665_100288653 3300005548 Bacteria 1643
31 Ga0068855_100058216 3300005563 Bacteria 4526
32 Ga0068855_100163533 3300005563 Bacteria 2524
33 Ga0068857_100039159 3300005577 Bacteria 4199
34 Ga0068857_100100835 3300005577 Bacteria 2590
35 Ga0068856_100536121 3300005614 Bacteria 1192
36 Ga0068852_100326928 3300005616 Bacteria 1491
37 Ga0068861_100049070 3300005719 Unclassified 3194
38 Ga0068858_101494034 3300005842 Unclassified 666
39 Ga0068862_100503123 3300005844 Bacteria 1150
40 Ga0081455_10527775 3300005937 Bacteria 786
41 Ga0081540_1016239 3300005983 Bacteria 4670
42 Ga0075365_10005876 3300006038 Bacteria 6676
43 Ga0070716_100323653 3300006173 Bacteria 1081
44 Ga0075367_10199833 3300006178 Bacteria 1249
45 Ga0075367_10230345 3300006178 Bacteria 1160
46 Ga0075366_10188059 3300006195 Unclassified 1255
47 Ga0075366_10562036 3300006195 Bacteria 707
48 Ga0075370_10226830 3300006353 Bacteria 1105
49 Ga0075428_100029835 3300006844 Bacteria 6033
50 Ga0075431_100071426 3300006847 Bacteria 3581
51 Ga0075431_100291499 3300006847 Bacteria 1651
52 Ga0075433_10312840 3300006852 Bacteria 1390
53 Ga0075433_10726294 3300006852 Unclassified 869
54 Ga0075434_100100752 3300006871 Bacteria 2895
55 Ga0075434_100603864 3300006871 Unclassified 1116
56 Ga0068865_101783945 3300006881 Unclassified 556
57 Ga0105240_10037986 3300009093 Bacteria 6183
58 Ga0111539_10092057 3300009094 Bacteria 3563
59 Ga0111539_10199442 3300009094 Unclassified 2334
60 Ga0111539_10694569 3300009094 Bacteria 1184
61 Ga0114129_10090427 3300009147 Bacteria 4244
62 Ga0105237_10100183 3300009545 Bacteria 2888
63 Ga0105238_10365138 3300009551 Unclassified 1433
64 Ga0105239_10141137 3300010375 Bacteria 2684
65 Ga0105239_10617182 3300010375 Unclassified 1237
66 Ga0105239_10781801 3300010375 Bacteria 1093
67 Ga0157371_10968616 3300013102 Bacteria 648
68 Ga0157370_11601519 3300013104 Bacteria 585
69 Ga0157378_11643125 3300013297 Bacteria 689
70 Ga0163162_10362916 3300013306 Bacteria 1581
71 Ga0163162_10875354 3300013306 Unclassified 1012
72 Ga0157372_11657855 3300013307 Unclassified 736
73 Ga0157375_10578237 3300013308 Bacteria 1284
74 Ga0157380_10204352 3300014326 Bacteria 1755
75 Ga0157380_10993845 3300014326 Bacteria 872
76 Ga0157379_10137212 3300014968 Bacteria 2204
77 Ga0157376_10136047 3300014969 Bacteria 2199
78 Ga0163161_10979509 3300017792 Unclassified 721
79 Ga0209050_1003064 3300025298 Bacteria 12869
80 Ga0209256_1024862 3300025299 Bacteria 1756
81 Ga0209051_1021174 3300025303 Bacteria 2777
82 Ga0209051_1031420 3300025303 Bacteria 2043
83 Ga0209257_1000033 3300025304 Bacteria 671006
84 Ga0209257_1019672 3300025304 Bacteria 2530
85 Ga0207705_10184741 3300025909 Bacteria 1575
86 Ga0207654_10106451 3300025911 Unclassified 1737
87 Ga0207695_10359793 3300025913 Bacteria 1342
88 Ga0207671_10259722 3300025914 Bacteria 1367
89 Ga0207671_10675819 3300025914 Bacteria 822
90 Ga0207649_10229448 3300025920 Bacteria 1327
91 Ga0207681_10103913 3300025923 Bacteria 2054
92 Ga0207694_10155137 3300025924 Bacteria 1846
93 Ga0207650_10496102 3300025925 Bacteria 1020
94 Ga0207700_11810141 3300025928 Bacteria 537
95 Ga0207706_10572108 3300025933 Bacteria 972
96 Ga0207670_11514849 3300025936 Unclassified 570
97 Ga0207669_10766020 3300025937 Bacteria 798
98 Ga0207691_10065971 3300025940 Bacteria 3275
99 Ga0207667_10052875 3300025949 Bacteria 4276
100 Ga0207667_10098327 3300025949 Bacteria 3020
101 Ga0207668_10472377 3300025972 Bacteria 1074
102 Ga0207668_10746231 3300025972 Bacteria 863
103 Ga0207703_12022676 3300026035 Unclassified 552
104 Ga0207639_10004022 3300026041 Bacteria 9925
105 Ga0207708_10020198 3300026075 Bacteria 5023
106 Ga0207708_10320986 3300026075 Unclassified 1264
107 Ga0207702_12403429 3300026078 Bacteria 514
108 Ga0207674_10033535 3300026116 Bacteria 5375
109 Ga0207674_10085525 3300026116 Bacteria 3149
110 Ga0207674_11007144 3300026116 Bacteria 802
111 Ga0207675_100262103 3300026118 Bacteria 1675
112 Ga0207698_11625647 3300026142 Bacteria 661
113 Ga0209996_1057481 3300027395 Unclassified 595
114 Ga0209282_1168274 3300027666 Unclassified 1040
115 Ga0207428_10732136 3300027907 Unclassified 706
116 Ga0268266_10454265 3300028379 Bacteria 1218
117 Ga0268265_10097567 3300028380 Bacteria 2365
118 Ga0268265_10568222 3300028380 Bacteria 1079
119 Ga0307515_10068275 3300028794 Bacteria 4886
120 Ga0307513_10071944 3300031456 Bacteria 3606
121 Ga0307509_10065367 3300031507 Bacteria 3820
122 Ga0307408_100029425 3300031548 Bacteria 3806
123 Ga0307508_10803790 3300031616 Bacteria 558
124 Ga0307516_10858655 3300031730 Bacteria 572
125 Ga0307409_100023108 3300031995 Bacteria 4301
126 Ga0307414_10014215 3300032004 Bacteria 4763
127 Ga0307411_10005690 3300032005 Bacteria 6154
128 Ga0373935_0831217 3300035692 Unclassified 683
129 Ga0373937_0011781 3300036401 Bacteria 7673
130 Ga0395899_0316359 3300037312 Bacteria 1053
131 Ga0395900_0411832 3300037418 Bacteria 1314
132 Ga0395901_0968110 3300038443 Bacteria 829
133 Ga0451802_0790175 3300041460 Bacteria 1244
134 Ga0439437_002239 3300042000 Bacteria 2059
135 Ga0439445_0206729 3300042004 Bacteria 581
136 Ga0450917_000172 3300042120 Bacteria 4431
137 Ga0450888_000582 3300042126 Bacteria 3460
138 Ga0450890_012980 3300042127 Unclassified 1084
139 Ga0450891_000840 3300042129 Bacteria 3214
140 Ga0450892_001994 3300042130 Unclassified 1809
141 Ga0450903_012034 3300042138 Bacteria 1387
142 Ga0450889_000535 3300042144 Bacteria 4235
143 Ga0450916_041376 3300042530 Bacteria 701
144 Ga0450893_0016157 3300042532 Bacteria 1262
145 Ga0450901_036652 3300042533 Bacteria 548
146 Ga0466972_0058137 3300044658 Bacteria 1857
147 Ga0453684_0173524 3300044712 Bacteria 2538
148 Ga0453684_0243736 3300044712 Bacteria 2068
149 Ga0451576_0174403 3300045051 Bacteria 2245
150 Ga0451576_0350610 3300045051 Bacteria 1545
151 Ga0495603_0298682 3300046455 Bacteria 925
152 Ga0495638_0324172 3300046460 Unclassified 822
153 Ga0495584_0199043 3300046491 Unclassified 1018
154 Ga0495608_0699781 3300046511 Bacteria 603
155 Ga0495610_0321323 3300046512 Unclassified 591
156 Ga0495630_0084069 3300046517 Bacteria 2403
157 Ga0495632_0060099 3300046519 Unclassified 1848
158 Ga0495656_0511916 3300046615 Unclassified 637
159 Ga0495658_0133701 3300046683 Bacteria 1512
160 Ga0495624_0207314 3300046690 Bacteria 1189
161 Ga0495674_0868293 3300047319 Bacteria 698
162 Ga0495676_0027632 3300047321 Bacteria 4862
163 Ga0495593_0063993 3300047673 Bacteria 1920
164 Ga0501294_020238 3300049517 Bacteria 717
165 Ga0501300_008342 3300049523 Bacteria 1518
166 Ga0501034_1622145 3300049571 Unclassified 520
167 Ga0501036_0518821 3300049572 Bacteria 991
168 Ga0501038_0167566 3300049574 Bacteria 1781
169 Ga0501040_0104959 3300049576 Bacteria 1974
170 Ga0501040_0922533 3300049576 Unclassified 633
171 Ga0501043_1114350 3300049579 Unclassified 557
172 Ga0501046_1199213 3300049580 Unclassified 522
173 Ga0501047_0488983 3300049581 Bacteria 1058
174 Ga0501047_0546695 3300049581 Bacteria 983
175 Ga0501067_0077406 3300049583 Bacteria 1843
176 Ga0501070_0266775 3300049586 Unclassified 1399
177 Ga0501071_0355622 3300049587 Bacteria 1115
178 Ga0501072_1563704 3300049588 Bacteria 509
179 Ga0501073_1139741 3300049589 Bacteria 536
180 Ga0501075_0350062 3300049591 Bacteria 1126
181 Ga0501076_0536562 3300049592 Bacteria 965
182 Ga0501202_110947 3300049652 Bacteria 679
183 Ga0501211_003843 3300049658 Bacteria 1544
184 Ga0501217_012015 3300049661 Bacteria 1923
185 Ga0501223_057220 3300049663 Bacteria 759
186 Ga0501227_035925 3300049665 Bacteria 1208
187 Ga0501233_041477 3300049668 Bacteria 1083
188 Ga0501235_009308 3300049669 Bacteria 2147
189 Ga0501236_020873 3300049670 Bacteria 967
190 Ga0501249_060796 3300049679 Bacteria 875
191 Ga0501253_105843 3300049683 Bacteria 665
192 Ga0501255_011547 3300049684 Bacteria 1020
193 Ga0501259_014292 3300049688 Bacteria 1344
194 Ga0501221_000601 3300049704 Bacteria 5746
195 Ga0501229_008709 3300049706 Bacteria 1270
196 Ga0501232_030475 3300049757 Bacteria 747
197 Ga0501262_027159 3300049759 Bacteria 811
198 Ga0501262_048269 3300049759 Bacteria 653
199 Ga0501267_004039 3300049764 Bacteria 1353
200 Ga0501270_052150 3300049767 Bacteria 744
201 Ga0501272_004054 3300049769 Bacteria 1513
202 Ga0501279_028117 3300049775 Bacteria 825
203 Ga0501044_0038486 3300049823 Bacteria 4994
204 nmdc:mga03683_173755_c1 3300050489 Bacteria 980
205 nmdc:mga0yw44_15132_c1 3300050492 Bacteria 4122
206 nmdc:mga0yw44_323782_c1 3300050492 Bacteria 1035
207 nmdc:mga0k408_233474_c1 3300050493 Bacteria 1098
208 nmdc:mga06z11_160385_c1 3300050494 Bacteria 1285
209 nmdc:mga07m45_153619_c1 3300050496 Bacteria 1335
210 nmdc:mga05p37_79398_c2 3300050507 Bacteria 2800
211 nmdc:mga0qj67_824663_c1 3300050509 Bacteria 733
212 nmdc:mga06r32_87377_c1 3300050510 Bacteria 3042
213 nmdc:mga08y16_244861_c1 3300050511 Bacteria 1853
214 nmdc:mga0n895_888039_c1 3300050512 Unclassified 877
215 nmdc:mga0a205_59456_c1 3300050515 Bacteria 3691
216 Ga0500644_0121848 3300053088 Unclassified 1017
217 Ga0500641_0159671 3300053096 Unclassified 972
218 Ga0500556_0000612 3300053104 Bacteria 22795
219 Ga0500562_012089 3300053108 Bacteria 2193
220 Ga0500561_0041388 3300053137 Bacteria 1218
221 Ga0500616_0001356 3300053153 Bacteria 23862
222 Ga0500570_113377 3300053724 Bacteria 1092
223 Ga0501082_1633229 3300060353 Unclassified 563
224 Ga0530510_1353099 3300061734 Bacteria 546
225 2643743217 2643221544 Bacteria 5886209
226 2644218366 2643221639 Bacteria 6649903
227 2644260257 2643221646 Bacteria 6433402
228 2739056084 2738541337 Bacteria 6183410
229 Ga0501084_0538620
230 rootH1_10015527
231 rootL2_10013724
232 rootL2_10031539
233 rootL2_10045876
234 rootH1_10063627
235 rootH1_10343186
236 Ga0055540_1106369
237 Ga0055531_10000001
238 Ga0055531_10045677
239 Ga0070670_100363338
240 Ga0070670_101642243
241 Ga0070680_100671395
242 Ga0070682_100213492
243 Ga0070691_10023268
244 Ga0070692_10073506
245 Ga0070692_11402953
246 Ga0070668_100046321
247 Ga0070668_100338022
248 Ga0070668_100384677
249 Ga0070669_100139578
250 Ga0070674_100922325
251 Ga0070700_100022251
252 Ga0070700_100234738
253 Ga0070678_100247394
254 Ga0068853_100008298
255 Ga0068853_100544555
256 Ga0070672_100246915
257 Ga0070695_100019103
258 Ga0070665_100288653
259 Ga0068855_100058216
260 Ga0068855_100163533
261 Ga0068857_100039159
262 Ga0068857_100100835
263 Ga0068856_100536121
264 Ga0068852_100326928
265 Ga0068861_100049070
266 Ga0068858_101494034
267 Ga0068862_100503123
268 Ga0081455_10527775
269 Ga0081540_1016239
270 Ga0075365_10005876
271 Ga0070716_100323653
272 Ga0075367_10199833
273 Ga0075367_10230345
274 Ga0075366_10188059
275 Ga0075366_10562036
276 Ga0075370_10226830
277 Ga0075428_100029835
278 Ga0075431_100071426
279 Ga0075431_100291499
280 Ga0075433_10312840
281 Ga0075433_10726294
282 Ga0075434_100100752
283 Ga0075434_100603864
284 Ga0068865_101783945
285 Ga0105240_10037986
286 Ga0111539_10092057
287 Ga0111539_10199442
288 Ga0111539_10694569
289 Ga0114129_10090427
290 Ga0105237_10100183
291 Ga0105238_10365138
292 Ga0105239_10141137
293 Ga0105239_10617182
294 Ga0105239_10781801
295 Ga0157371_10968616
296 Ga0157370_11601519
297 Ga0157378_11643125
298 Ga0163162_10362916
299 Ga0163162_10875354
300 Ga0157372_11657855
301 Ga0157375_10578237
302 Ga0157380_10204352
303 Ga0157380_10993845
304 Ga0157379_10137212
305 Ga0157376_10136047
306 Ga0163161_10979509
307 Ga0209050_1003064
308 Ga0209256_1024862
309 Ga0209051_1021174
310 Ga0209051_1031420
311 Ga0209257_1000033
312 Ga0209257_1019672
313 Ga0207705_10184741
314 Ga0207654_10106451
315 Ga0207695_10359793
316 Ga0207671_10259722
317 Ga0207671_10675819
318 Ga0207649_10229448
319 Ga0207681_10103913
320 Ga0207694_10155137
321 Ga0207650_10496102
322 Ga0207700_11810141
323 Ga0207706_10572108
324 Ga0207670_11514849
325 Ga0207669_10766020
326 Ga0207691_10065971
327 Ga0207667_10052875
328 Ga0207667_10098327
329 Ga0207668_10472377
330 Ga0207668_10746231
331 Ga0207703_12022676
332 Ga0207639_10004022
333 Ga0207708_10020198
334 Ga0207708_10320986
335 Ga0207702_12403429
336 Ga0207674_10033535
337 Ga0207674_10085525
338 Ga0207674_11007144
339 Ga0207675_100262103
340 Ga0207698_11625647
341 Ga0209996_1057481
342 Ga0209282_1168274
343 Ga0207428_10732136
344 Ga0268266_10454265
345 Ga0268265_10097567
346 Ga0268265_10568222
347 Ga0307515_10068275
348 Ga0307513_10071944
349 Ga0307509_10065367
350 Ga0307408_100029425
351 Ga0307508_10803790
352 Ga0307516_10858655
353 Ga0307409_100023108
354 Ga0307414_10014215
355 Ga0307411_10005690
356 Ga0373935_0831217
357 Ga0373937_0011781
358 Ga0395899_0316359
359 Ga0395900_0411832
360 Ga0395901_0968110
361 Ga0451802_0790175
362 Ga0439437_002239
363 Ga0439445_0206729
364 Ga0450917_000172
365 Ga0450888_000582
366 Ga0450890_012980
367 Ga0450891_000840
368 Ga0450892_001994
369 Ga0450903_012034
370 Ga0450889_000535
371 Ga0450916_041376
372 Ga0450893_0016157
373 Ga0450901_036652
374 Ga0466972_0058137
375 Ga0453684_0173524
376 Ga0453684_0243736
377 Ga0451576_0174403
378 Ga0451576_0350610
379 Ga0495603_0298682
380 Ga0495638_0324172
381 Ga0495584_0199043
382 Ga0495608_0699781
383 Ga0495610_0321323
384 Ga0495630_0084069
385 Ga0495632_0060099
386 Ga0495656_0511916
387 Ga0495658_0133701
388 Ga0495624_0207314
389 Ga0495674_0868293
390 Ga0495676_0027632
391 Ga0495593_0063993
392 Ga0501294_020238
393 Ga0501300_008342
394 Ga0501034_1622145
395 Ga0501036_0518821
396 Ga0501038_0167566
397 Ga0501040_0104959
398 Ga0501040_0922533
399 Ga0501043_1114350
400 Ga0501046_1199213
401 Ga0501047_0488983
402 Ga0501047_0546695
403 Ga0501067_0077406
404 Ga0501070_0266775
405 Ga0501071_0355622
406 Ga0501072_1563704
407 Ga0501073_1139741
408 Ga0501075_0350062
409 Ga0501076_0536562
410 Ga0501202_110947
411 Ga0501211_003843
412 Ga0501217_012015
413 Ga0501223_057220
414 Ga0501227_035925
415 Ga0501233_041477
416 Ga0501235_009308
417 Ga0501236_020873
418 Ga0501249_060796
419 Ga0501253_105843
420 Ga0501255_011547
421 Ga0501259_014292
422 Ga0501221_000601
423 Ga0501229_008709
424 Ga0501232_030475
425 Ga0501262_027159
426 Ga0501262_048269
427 Ga0501267_004039
428 Ga0501270_052150
429 Ga0501272_004054
430 Ga0501279_028117
431 Ga0501044_0038486
432 nmdc:mga03683_173755_c1
433 nmdc:mga0yw44_15132_c1
434 nmdc:mga0yw44_323782_c1
435 nmdc:mga0k408_233474_c1
436 nmdc:mga06z11_160385_c1
437 nmdc:mga07m45_153619_c1
438 nmdc:mga05p37_79398_c2
439 nmdc:mga0qj67_824663_c1
440 nmdc:mga06r32_87377_c1
441 nmdc:mga08y16_244861_c1
442 nmdc:mga0n895_888039_c1
443 nmdc:mga0a205_59456_c1
444 Ga0500644_0121848
445 Ga0500641_0159671
446 Ga0500556_0000612
447 Ga0500562_012089
448 Ga0500561_0041388
449 Ga0500616_0001356
450 Ga0500570_113377
451 Ga0501082_1633229
452 Ga0530510_1353099
453 2643743217
454 2644218366
455 2644260257
456 2739056084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x16-assembly1.cif.gz_A crystal structure of the catalase-peroxidase katg w78f mutant from synechococcus elongatus pcc7942 0.8445 52 78
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7832 2 96
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7153 2 96
3juw-assembly2.cif.gz_C-2 putative gnat-family acetyltransferase from bordetella pertussis. 0.6787 61 93
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.6191 52 91
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7957 4 117 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7776 4 112 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7485 2 112 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7375 4 117 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7292 2 105 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A7X2LTL4-F1-model_v4 GFA family protein 0.9855 1 129 GO:0016846
GO:0046872
AF-A0A7W8NCE4-F1-model_v4 CENP-V/GFA domain-containing protein 0.9837 2 129 GO:0016846
GO:0046872
AF-A0A1E4PN95-F1-model_v4 Aldehyde-activating protein 0.982 1 129 GO:0016846
GO:0046872
AF-A0A7D7ZJD2-F1-model_v4 GFA family protein 0.9818 1 129 GO:0016846
GO:0046872
AF-A0A2S4EH63-F1-model_v4 deleted 0.9747 2 129

Map