F341402

General Info

Members Datasets Scaffolds Average Seq Length
228 190 223 166

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0081036|Ga0501033_0081036_1449_1985
Length 178
Sequence MRYCKRFFEDAMSDDQRSGCPINLTLEVVGDRWSLLIIRDMIFGNRRYFRELLTKSEEGISSNILADRLKTLLEQGIVTRADDPSHKQKGVYSLTEKGIELLPILARMAGWGRKYLPVTEEFGIRAELLRDGGPKMWDALMDELREVHLGQRKRRRTGPSVSETLQAAYEAVVAKKRR

Samples

Sample ID Description Type Environment
1 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
2 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
3 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
183 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
189 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
190 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.91
Nodule 0
Rhizoplane 7.46
Rhizosphere 65.35
Stem 0
Stem Tuber 0
Unclassified 12.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10043181 3300001979 Bacteria 1346
2 JGI24739J22299_10065687 3300001989 Bacteria 1137
3 JGI24742J22300_10006546 3300002244 Bacteria 1922
4 JGI25151J46595_10000064 3300003187 Bacteria 145243
5 rootH1_10126479 3300003323 Bacteria 8338
6 JGI25160J50197_1013300 3300003354 Bacteria 2813
7 Ga0055531_10032956 3300003794 Bacteria 1680
8 Ga0065707_10339038 3300005295 Bacteria 936
9 Ga0070676_10191020 3300005328 Bacteria 1337
10 Ga0070683_100323888 3300005329 Bacteria 1467
11 Ga0070670_100056990 3300005331 Bacteria 3354
12 Ga0070677_10099983 3300005333 Bacteria 1277
13 Ga0068869_100376672 3300005334 Bacteria 1162
14 Ga0070674_100003272 3300005356 Bacteria 9056
15 Ga0070673_100176454 3300005364 Bacteria 1827
16 Ga0070659_100153872 3300005366 Bacteria 1877
17 Ga0070667_100023583 3300005367 Bacteria 5107
18 Ga0070711_100973868 3300005439 Bacteria 727
19 Ga0070708_101032167 3300005445 Bacteria 771
20 Ga0070663_100314653 3300005455 Bacteria 1257
21 Ga0070663_101204388 3300005455 Bacteria 665
22 Ga0070678_100000149 3300005456 Bacteria 29059
23 Ga0070662_100027377 3300005457 Bacteria 3956
24 Ga0070662_100094394 3300005457 Bacteria 2252
25 Ga0070679_100100647 3300005530 Bacteria 2876
26 Ga0068853_100127247 3300005539 Bacteria 2277
27 Ga0070672_100004690 3300005543 Bacteria 8964
28 Ga0070672_100358053 3300005543 Bacteria 1245
29 Ga0070672_100474195 3300005543 Bacteria 1080
30 Ga0070672_101104760 3300005543 Bacteria 705
31 Ga0070665_100014410 3300005548 Bacteria 7934
32 Ga0070665_100201448 3300005548 Bacteria 1991
33 Ga0068855_100366916 3300005563 Bacteria 1583
34 Ga0068855_100398325 3300005563 Bacteria 1509
35 Ga0068857_101055214 3300005577 Bacteria 783
36 Ga0068854_100081274 3300005578 Bacteria 2393
37 Ga0068854_100237583 3300005578 Bacteria 1449
38 Ga0068851_10024290 3300005834 Bacteria 2967
39 Ga0081540_1157668 3300005983 Bacteria 885
40 Ga0081539_10022566 3300005985 Bacteria 4159
41 Ga0070717_10795061 3300006028 Bacteria 860
42 Ga0075365_10006539 3300006038 Bacteria 6421
43 Ga0075362_10214681 3300006177 Bacteria 939
44 Ga0097621_100170236 3300006237 Bacteria 1877
45 Ga0075370_10027403 3300006353 Bacteria 3161
46 Ga0075430_100772903 3300006846 Bacteria 791
47 Ga0105240_10149489 3300009093 Bacteria 2784
48 Ga0105243_10000512 3300009148 Bacteria 39573
49 Ga0105241_10001450 3300009174 Bacteria 18171
50 Ga0105237_10631679 3300009545 Bacteria 1078
51 Ga0105237_10749852 3300009545 Bacteria 983
52 Ga0105033_101714 3300009986 Bacteria 1805
53 Ga0105239_10895881 3300010375 Bacteria 1018
54 Ga0105246_10097232 3300011119 Bacteria 2136
55 Ga0157371_10000032 3300013102 Bacteria 230252
56 Ga0157378_10129883 3300013297 Bacteria 2331
57 Ga0157378_10729609 3300013297 Bacteria 1012
58 Ga0157376_10306466 3300014969 Bacteria 1505
59 Ga0213876_10043860 3300021384 Bacteria 2364
60 Ga0209130_1002707 3300025284 Bacteria 8429
61 Ga0209025_1000182 3300025294 Bacteria 156443
62 Ga0209758_1002074 3300025297 Bacteria 21331
63 Ga0209758_1036807 3300025297 Bacteria 1903
64 Ga0209256_1063023 3300025299 Bacteria 857
65 Ga0207426_1000102 3300025302 Bacteria 255303
66 Ga0209257_1001734 3300025304 Bacteria 24258
67 Ga0207656_10011904 3300025321 Bacteria 3296
68 Ga0207656_10279838 3300025321 Bacteria 822
69 Ga0207647_10006550 3300025904 Bacteria 8462
70 Ga0207647_10121481 3300025904 Bacteria 1540
71 Ga0207645_10109627 3300025907 Bacteria 1786
72 Ga0207695_10075668 3300025913 Bacteria 3425
73 Ga0207671_10005662 3300025914 Bacteria 11430
74 Ga0207694_10110359 3300025924 Bacteria 2188
75 Ga0207690_10108019 3300025932 Bacteria 1999
76 Ga0207706_10041495 3300025933 Bacteria 4079
77 Ga0207709_10000145 3300025935 Bacteria 98629
78 Ga0207709_10088599 3300025935 Bacteria 2015
79 Ga0207669_10000118 3300025937 Bacteria 39673
80 Ga0207665_10521415 3300025939 Bacteria 920
81 Ga0207691_10001455 3300025940 Bacteria 23575
82 Ga0207711_10118009 3300025941 Bacteria 2367
83 Ga0207689_10370310 3300025942 Bacteria 1192
84 Ga0207667_10228195 3300025949 Bacteria 1907
85 Ga0207640_10002033 3300025981 Bacteria 10932
86 Ga0207678_10425368 3300026067 Bacteria 1152
87 Ga0207641_10154960 3300026088 Bacteria 2078
88 Ga0207674_11161543 3300026116 Bacteria 741
89 Ga0207674_11161544 3300026116 Bacteria 741
90 Ga0207683_10000881 3300026121 Bacteria 27549
91 Ga0268266_10195190 3300028379 Bacteria 1850
92 Ga0268266_10600157 3300028379 Bacteria 1057
93 Ga0307517_10033378 3300028786 Bacteria 5913
94 Ga0307515_10024763 3300028794 Bacteria 10431
95 Ga0307515_10396164 3300028794 Bacteria 1008
96 Ga0265327_10016605 3300031251 Bacteria 4664
97 Ga0307513_10020263 3300031456 Bacteria 7888
98 Ga0307513_10043374 3300031456 Bacteria 4941
99 Ga0307509_10413811 3300031507 Bacteria 1051
100 Ga0307509_10542236 3300031507 Bacteria 842
101 Ga0307405_10181158 3300031731 Bacteria 1513
102 Ga0307413_10002644 3300031824 Bacteria 7335
103 Ga0373935_0554434 3300035692 Bacteria 838
104 Ga0395899_0058474 3300037312 Bacteria 2843
105 Ga0436364_0199290 3300037853 Bacteria 1203
106 Ga0436364_1244935 3300037853 Bacteria 818
107 Ga0436365_1173803 3300039437 Bacteria 4344
108 Ga0436360_0541394 3300039438 Bacteria 1598
109 Ga0436363_1124736 3300039450 Bacteria 1169
110 Ga0436362_0234637 3300039453 Bacteria 1560
111 Ga0451797_1445407 3300041453 Bacteria 924
112 Ga0451807_2337554 3300041486 Bacteria 613
113 Ga0439431_0063208 3300041997 Bacteria 977
114 Ga0439445_0069320 3300042004 Bacteria 974
115 Ga0439445_0223528 3300042004 Bacteria 559
116 Ga0439448_0003004 3300042005 Bacteria 4630
117 Ga0439451_036712 3300042009 Bacteria 985
118 Ga0439455_0000424 3300042012 Bacteria 5681
119 Ga0439455_0007859 3300042012 Bacteria 2271
120 Ga0439458_0002719 3300042157 Bacteria 4270
121 Ga0439460_0127251 3300042461 Bacteria 837
122 Ga0466972_0058732 3300044658 Bacteria 1846
123 Ga0466965_0217547 3300044683 Bacteria 1017
124 Ga0466963_0281077 3300044694 Bacteria 1170
125 Ga0466970_0125489 3300044765 Bacteria 1407
126 Ga0466970_0128453 3300044765 Bacteria 1391
127 Ga0466960_0029058 3300044901 Bacteria 2534
128 Ga0495629_0186012 3300046459 Bacteria 1439
129 Ga0495638_0006380 3300046460 Bacteria 8589
130 Ga0495638_0107310 3300046460 Bacteria 1663
131 Ga0495650_0000302 3300046471 Bacteria 89516
132 Ga0495585_0016434 3300046492 Bacteria 4287
133 Ga0495596_0042306 3300046500 Bacteria 1795
134 Ga0495583_0001345 3300046506 Bacteria 25472
135 Ga0495648_0112045 3300046524 Bacteria 1483
136 Ga0495648_0182659 3300046524 Bacteria 1065
137 Ga0495642_0052976 3300046528 Bacteria 1671
138 Ga0495652_0658837 3300046529 Bacteria 708
139 Ga0495622_0110970 3300046557 Bacteria 1256
140 Ga0495633_0000770 3300046558 Bacteria 28708
141 Ga0495667_0593727 3300046559 Bacteria 690
142 Ga0495668_0000016 3300046616 Bacteria 438197
143 Ga0495625_0002974 3300046660 Bacteria 17589
144 Ga0495661_0069533 3300046665 Bacteria 2063
145 Ga0495670_0696075 3300046691 Bacteria 554
146 Ga0495649_0104607 3300046694 Bacteria 1503
147 Ga0495660_0140865 3300046810 Bacteria 1200
148 Ga0495604_0869141 3300047317 Bacteria 565
149 Ga0495683_0022664 3300047323 Bacteria 3229
150 Ga0495687_001300 3300047443 Bacteria 23447
151 Ga0495677_0001495 3300047445 Bacteria 9405
152 Ga0495686_0000025 3300047472 Bacteria 388098
153 Ga0495686_0001345 3300047472 Bacteria 27514
154 Ga0496102_0002646 3300048905 Bacteria 15218
155 Ga0496103_0000131 3300048906 Bacteria 79787
156 Ga0496104_0037026 3300048907 Bacteria 4563
157 Ga0496104_0950216 3300048907 Bacteria 764
158 Ga0496105_0001020 3300048908 Bacteria 19340
159 Ga0496107_0272942 3300048910 Bacteria 1259
160 Ga0496108_0410530 3300048911 Bacteria 1183
161 Ga0496109_0295130 3300048912 Bacteria 1528
162 Ga0496110_0018372 3300048913 Bacteria 5863
163 Ga0496111_0926486 3300048914 Bacteria 627
164 Ga0496113_0180622 3300048916 Bacteria 1673
165 Ga0496114_0054285 3300048917 Bacteria 3342
166 Ga0496114_0843947 3300048917 Bacteria 796
167 Ga0496115_0000133 3300048918 Bacteria 67951
168 Ga0496115_0082158 3300048918 Bacteria 2625
169 Ga0496116_0005419 3300048919 Bacteria 11859
170 Ga0496117_0002127 3300048920 Bacteria 25909
171 Ga0496118_0000092 3300048921 Bacteria 169106
172 Ga0496119_0005121 3300048922 Bacteria 12704
173 Ga0496120_0052063 3300048923 Bacteria 2334
174 Ga0496121_0005979 3300048924 Bacteria 15374
175 Ga0496122_0022791 3300048925 Bacteria 5553
176 Ga0496123_0002753 3300048926 Bacteria 21034
177 Ga0496124_0000081 3300048927 Bacteria 208413
178 Ga0496125_0002309 3300048928 Bacteria 25170
179 Ga0496126_0000283 3300048929 Bacteria 107129
180 Ga0501032_0091583 3300049569 Bacteria 2017
181 Ga0501033_0081036 3300049570 Bacteria 2381
182 Ga0501033_0234868 3300049570 Bacteria 1302
183 Ga0501033_0462631 3300049570 Bacteria 880
184 Ga0501034_0216161 3300049571 Bacteria 1871
185 Ga0501036_0382220 3300049572 Bacteria 1175
186 Ga0501038_0157643 3300049574 Bacteria 1847
187 Ga0501047_0183419 3300049581 Bacteria 1959
188 Ga0501047_0584658 3300049581 Bacteria 939
189 Ga0501069_0254485 3300049585 Bacteria 1025
190 Ga0501070_0127961 3300049586 Bacteria 2099
191 Ga0501070_0254329 3300049586 Bacteria 1437
192 Ga0501070_0396842 3300049586 Bacteria 1116
193 Ga0501072_0482326 3300049588 Bacteria 981
194 Ga0501080_0483552 3300049742 Bacteria 1108
195 Ga0501035_0106862 3300049822 Bacteria 2453
196 Ga0501035_0936536 3300049822 Bacteria 684
197 Ga0501044_0082622 3300049823 Bacteria 3250
198 Ga0501044_0120000 3300049823 Bacteria 2631
199 nmdc:mga03683_43264_c2 3300050489 Bacteria 1184
200 nmdc:mga0yw44_64864_c1 3300050492 Bacteria 2249
201 nmdc:mga0k408_13217_c1 3300050493 Bacteria 4524
202 nmdc:mga06z11_332161_c1 3300050494 Bacteria 908
203 nmdc:mga04h51_323825_c1 3300050495 Bacteria 632
204 nmdc:mga07m45_433783_c1 3300050496 Bacteria 762
205 nmdc:mga0sz30_59505_c1 3300050516 Bacteria 1630
206 Ga0495601_0422533 3300053077 Bacteria 863
207 Ga0495595_0093560 3300053084 Bacteria 1444
208 Ga0495619_0128992 3300053085 Bacteria 1737
209 Ga0495619_0266440 3300053085 Bacteria 1187
210 Ga0500646_0142347 3300053090 Bacteria 788
211 Ga0500647_0053152 3300053091 Bacteria 1949
212 Ga0500651_0228457 3300053093 Bacteria 1089
213 Ga0500566_0186029 3300053094 Bacteria 1061
214 Ga0500595_006322 3300053119 Bacteria 5040
215 Ga0500595_034368 3300053119 Bacteria 1677
216 Ga0500597_001722 3300053120 Bacteria 5725
217 Ga0500614_004174 3300053123 Bacteria 3067
218 Ga0500568_0022866 3300053139 Bacteria 2666
219 Ga0500604_0294825 3300053151 Bacteria 563
220 Ga0500627_0085631 3300053158 Bacteria 1408
221 Ga0500636_0007959 3300053177 Bacteria 6131
222 Ga0500611_130912 3300053727 Bacteria 676
223 Ga0500661_019904 3300055283 Bacteria 1194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0584658 Ga0501047_0584658_475_927 146
2 3300003323 rootH1_10126479 rootH1_101264793 147
3 3300006038 Ga0075365_10006539 Ga0075365_100065392 152
4 3300006177 Ga0075362_10214681 Ga0075362_102146811 152
5 3300050489 nmdc:mga03683_43264_c2 nmdc:mga03683_43264_c2_271_783 152
6 3300050492 nmdc:mga0yw44_64864_c1 nmdc:mga0yw44_64864_c1_771_1283 152
7 3300050494 nmdc:mga06z11_332161_c1 nmdc:mga06z11_332161_c1_106_618 152
8 3300050495 nmdc:mga04h51_323825_c1 nmdc:mga04h51_323825_c1_17_529 152
9 3300005543 Ga0070672_100004690 Ga0070672_1000046906 155
10 3300025939 Ga0207665_10521415 Ga0207665_105214152 155
11 3300025940 Ga0207691_10001455 Ga0207691_100014552 155
12 3300041453 Ga0451797_1445407 Ga0451797_1445407_134_625 155
13 3300041486 Ga0451807_2337554 Ga0451807_2337554_47_541 155
14 3300046460 Ga0495638_0107310 Ga0495638_0107310_672_1166 155
15 3300053094 Ga0500566_0186029 Ga0500566_0186029_62_580 155
16 3300053120 Ga0500597_001722 Ga0500597_001722_1038_1556 155
17 3300053123 Ga0500614_004174 Ga0500614_004174_1632_2150 155
18 3300055283 Ga0500661_019904 Ga0500661_019904_533_1051 155
19 3300031456 Ga0307513_10020263 Ga0307513_100202637 156
20 3300053151 Ga0500604_0294825 Ga0500604_0294825_43_531 156
21 iso_pu_bacteria 8054160619 8054164462 156
22 3300025297 Ga0209758_1036807 Ga0209758_10368072 157
23 3300044658 Ga0466972_0058732 Ga0466972_0058732_1023_1520 157
24 3300044683 Ga0466965_0217547 Ga0466965_0217547_474_971 157
25 3300044765 Ga0466970_0125489 Ga0466970_0125489_388_885 157
26 3300044901 Ga0466960_0029058 Ga0466960_0029058_1712_2209 157
27 iso_pu_bacteria 2643221545 2643750466 157
28 iso_pu_bacteria 2643221691 2644507356 157
29 3300003794 Ga0055531_10032956 Ga0055531_100329562 158
30 3300005295 Ga0065707_10339038 Ga0065707_103390381 158
31 3300005439 Ga0070711_100973868 Ga0070711_1009738681 158
32 3300005445 Ga0070708_101032167 Ga0070708_1010321671 158
33 3300005530 Ga0070679_100100647 Ga0070679_1001006473 158
34 3300005543 Ga0070672_101104760 Ga0070672_1011047602 158
35 3300005548 Ga0070665_100014410 Ga0070665_10001441013 158
36 3300005563 Ga0068855_100398325 Ga0068855_1003983252 158
37 3300006846 Ga0075430_100772903 Ga0075430_1007729031 158
38 3300009093 Ga0105240_10149489 Ga0105240_101494892 158
39 3300021384 Ga0213876_10043860 Ga0213876_100438604 158
40 3300025304 Ga0209257_1001734 Ga0209257_10017342 158
41 3300026088 Ga0207641_10154960 Ga0207641_101549602 158
42 3300028379 Ga0268266_10600157 Ga0268266_106001571 158
43 3300028794 Ga0307515_10024763 Ga0307515_1002476311 158
44 3300031507 Ga0307509_10413811 Ga0307509_104138112 158
45 3300035692 Ga0373935_0554434 Ga0373935_0554434_49_570 158
46 3300037312 Ga0395899_0058474 Ga0395899_0058474_889_1503 158
47 3300037853 Ga0436364_0199290 Ga0436364_0199290_40_537 158
48 3300037853 Ga0436364_1244935 Ga0436364_1244935_43_540 158
49 3300039437 Ga0436365_1173803 Ga0436365_1173803_3635_4132 158
50 3300039438 Ga0436360_0541394 Ga0436360_0541394_367_864 158
51 3300039453 Ga0436362_0234637 Ga0436362_0234637_245_829 158
52 3300042004 Ga0439445_0069320 Ga0439445_0069320_132_623 158
53 3300042009 Ga0439451_036712 Ga0439451_036712_142_633 158
54 3300042461 Ga0439460_0127251 Ga0439460_0127251_121_612 158
55 3300046460 Ga0495638_0006380 Ga0495638_0006380_5742_6233 158
56 3300046492 Ga0495585_0016434 Ga0495585_0016434_3216_3713 158
57 3300046524 Ga0495648_0182659 Ga0495648_0182659_10_528 158
58 3300046529 Ga0495652_0658837 Ga0495652_0658837_117_629 158
59 3300046557 Ga0495622_0110970 Ga0495622_0110970_302_814 158
60 3300046559 Ga0495667_0593727 Ga0495667_0593727_13_510 158
61 3300046660 Ga0495625_0002974 Ga0495625_0002974_9343_9840 158
62 3300047317 Ga0495604_0869141 Ga0495604_0869141_34_531 158
63 3300048910 Ga0496107_0272942 Ga0496107_0272942_311_808 158
64 3300048911 Ga0496108_0410530 Ga0496108_0410530_133_621 158
65 3300049585 Ga0501069_0254485 Ga0501069_0254485_79_579 158
66 3300049586 Ga0501070_0254329 Ga0501070_0254329_294_794 158
67 3300053077 Ga0495601_0422533 Ga0495601_0422533_26_523 158
68 3300053084 Ga0495595_0093560 Ga0495595_0093560_64_561 158
69 3300053085 Ga0495619_0128992 Ga0495619_0128992_1105_1602 158
70 3300053085 Ga0495619_0266440 Ga0495619_0266440_371_880 158
71 3300053091 Ga0500647_0053152 Ga0500647_0053152_575_1066 158
72 3300053119 Ga0500595_034368 Ga0500595_034368_377_889 158
73 3300053139 Ga0500568_0022866 Ga0500568_0022866_1144_1641 158
74 3300006028 Ga0070717_10795061 Ga0070717_107950611 159
75 3300025924 Ga0207694_10110359 Ga0207694_101103592 159
76 3300025935 Ga0207709_10088599 Ga0207709_100885992 159
77 3300031731 Ga0307405_10181158 Ga0307405_101811582 159
78 3300031824 Ga0307413_10002644 Ga0307413_100026447 159
79 3300046694 Ga0495649_0104607 Ga0495649_0104607_656_1147 159
80 3300047472 Ga0495686_0000025 Ga0495686_0000025_78098_78598 159
81 3300049570 Ga0501033_0081036 Ga0501033_0081036_1449_1985 159
82 3300049570 Ga0501033_0234868 Ga0501033_0234868_543_1073 159
83 3300049571 Ga0501034_0216161 Ga0501034_0216161_270_776 159
84 3300049572 Ga0501036_0382220 Ga0501036_0382220_65_601 159
85 3300049586 Ga0501070_0127961 Ga0501070_0127961_1006_1509 159
86 3300049586 Ga0501070_0396842 Ga0501070_0396842_298_834 159
87 3300049822 Ga0501035_0936536 Ga0501035_0936536_111_647 159
88 3300049823 Ga0501044_0082622 Ga0501044_0082622_793_1329 159
89 3300053119 Ga0500595_006322 Ga0500595_006322_3308_3808 159
90 iso_pu_bacteria 2821443989 2821445429 159
91 iso_pu_bacteria 2844533157 2844537652 159
92 3300001979 JGI24740J21852_10043181 JGI24740J21852_100431812 160
93 3300001989 JGI24739J22299_10065687 JGI24739J22299_100656872 160
94 3300002244 JGI24742J22300_10006546 JGI24742J22300_100065462 160
95 3300003187 JGI25151J46595_10000064 JGI25151J46595_1000006467 160
96 3300003354 JGI25160J50197_1013300 JGI25160J50197_10133003 160
97 3300005328 Ga0070676_10191020 Ga0070676_101910201 160
98 3300005329 Ga0070683_100323888 Ga0070683_1003238882 160
99 3300005331 Ga0070670_100056990 Ga0070670_1000569903 160
100 3300005333 Ga0070677_10099983 Ga0070677_100999833 160
101 3300005334 Ga0068869_100376672 Ga0068869_1003766721 160
102 3300005356 Ga0070674_100003272 Ga0070674_10000327210 160
103 3300005364 Ga0070673_100176454 Ga0070673_1001764542 160
104 3300005366 Ga0070659_100153872 Ga0070659_1001538723 160
105 3300005367 Ga0070667_100023583 Ga0070667_1000235837 160
106 3300005455 Ga0070663_100314653 Ga0070663_1003146532 160
107 3300005455 Ga0070663_101204388 Ga0070663_1012043881 160
108 3300005456 Ga0070678_100000149 Ga0070678_1000001498 160
109 3300005457 Ga0070662_100027377 Ga0070662_1000273773 160
110 3300005457 Ga0070662_100094394 Ga0070662_1000943943 160
111 3300005539 Ga0068853_100127247 Ga0068853_1001272473 160
112 3300005543 Ga0070672_100358053 Ga0070672_1003580532 160
113 3300005543 Ga0070672_100474195 Ga0070672_1004741951 160
114 3300005548 Ga0070665_100201448 Ga0070665_1002014483 160
115 3300005563 Ga0068855_100366916 Ga0068855_1003669162 160
116 3300005577 Ga0068857_101055214 Ga0068857_1010552141 160
117 3300005578 Ga0068854_100081274 Ga0068854_1000812742 160
118 3300005578 Ga0068854_100237583 Ga0068854_1002375832 160
119 3300005834 Ga0068851_10024290 Ga0068851_100242902 160
120 3300005983 Ga0081540_1157668 Ga0081540_11576682 160
121 3300005985 Ga0081539_10022566 Ga0081539_100225665 160
122 3300006237 Ga0097621_100170236 Ga0097621_1001702362 160
123 3300006353 Ga0075370_10027403 Ga0075370_100274032 160
124 3300009148 Ga0105243_10000512 Ga0105243_1000051228 160
125 3300009174 Ga0105241_10001450 Ga0105241_1000145018 160
126 3300009545 Ga0105237_10631679 Ga0105237_106316791 160
127 3300009545 Ga0105237_10749852 Ga0105237_107498522 160
128 3300009986 Ga0105033_101714 Ga0105033_1017142 160
129 3300010375 Ga0105239_10895881 Ga0105239_108958812 160
130 3300011119 Ga0105246_10097232 Ga0105246_100972322 160
131 3300013102 Ga0157371_10000032 Ga0157371_10000032148 160
132 3300013297 Ga0157378_10129883 Ga0157378_101298832 160
133 3300013297 Ga0157378_10729609 Ga0157378_107296092 160
134 3300014969 Ga0157376_10306466 Ga0157376_103064662 160
135 3300025284 Ga0209130_1002707 Ga0209130_10027076 160
136 3300025294 Ga0209025_1000182 Ga0209025_1000182119 160
137 3300025297 Ga0209758_1002074 Ga0209758_100207421 160
138 3300025299 Ga0209256_1063023 Ga0209256_10630231 160
139 3300025302 Ga0207426_1000102 Ga0207426_1000102139 160
140 3300025321 Ga0207656_10011904 Ga0207656_100119046 160
141 3300025321 Ga0207656_10279838 Ga0207656_102798381 160
142 3300025904 Ga0207647_10006550 Ga0207647_100065503 160
143 3300025904 Ga0207647_10121481 Ga0207647_101214812 160
144 3300025907 Ga0207645_10109627 Ga0207645_101096272 160
145 3300025913 Ga0207695_10075668 Ga0207695_100756686 160
146 3300025914 Ga0207671_10005662 Ga0207671_100056622 160
147 3300025932 Ga0207690_10108019 Ga0207690_101080193 160
148 3300025933 Ga0207706_10041495 Ga0207706_100414953 160
149 3300025935 Ga0207709_10000145 Ga0207709_1000014571 160
150 3300025937 Ga0207669_10000118 Ga0207669_1000011831 160
151 3300025941 Ga0207711_10118009 Ga0207711_101180092 160
152 3300025942 Ga0207689_10370310 Ga0207689_103703101 160
153 3300025949 Ga0207667_10228195 Ga0207667_102281952 160
154 3300025981 Ga0207640_10002033 Ga0207640_100020332 160
155 3300026067 Ga0207678_10425368 Ga0207678_104253682 160
156 3300026116 Ga0207674_11161543 Ga0207674_111615432 160
157 3300026116 Ga0207674_11161544 Ga0207674_111615442 160
158 3300026121 Ga0207683_10000881 Ga0207683_1000088122 160
159 3300028379 Ga0268266_10195190 Ga0268266_101951902 160
160 3300028786 Ga0307517_10033378 Ga0307517_100333787 160
161 3300028794 Ga0307515_10396164 Ga0307515_103961642 160
162 3300031251 Ga0265327_10016605 Ga0265327_100166054 160
163 3300031456 Ga0307513_10043374 Ga0307513_100433745 160
164 3300031507 Ga0307509_10542236 Ga0307509_105422362 160
165 3300039450 Ga0436363_1124736 Ga0436363_1124736_536_1153 160
166 3300041997 Ga0439431_0063208 Ga0439431_0063208_255_749 160
167 3300042004 Ga0439445_0223528 Ga0439445_0223528_37_531 160
168 3300042005 Ga0439448_0003004 Ga0439448_0003004_3456_3965 160
169 3300042012 Ga0439455_0000424 Ga0439455_0000424_2466_2975 160
170 3300042012 Ga0439455_0007859 Ga0439455_0007859_1169_1678 160
171 3300042157 Ga0439458_0002719 Ga0439458_0002719_114_623 160
172 3300044694 Ga0466963_0281077 Ga0466963_0281077_391_915 160
173 3300044765 Ga0466970_0128453 Ga0466970_0128453_776_1270 160
174 3300046459 Ga0495629_0186012 Ga0495629_0186012_548_1042 160
175 3300046471 Ga0495650_0000302 Ga0495650_0000302_75222_75716 160
176 3300046500 Ga0495596_0042306 Ga0495596_0042306_539_1033 160
177 3300046506 Ga0495583_0001345 Ga0495583_0001345_8858_9352 160
178 3300046524 Ga0495648_0112045 Ga0495648_0112045_581_1075 160
179 3300046528 Ga0495642_0052976 Ga0495642_0052976_806_1300 160
180 3300046558 Ga0495633_0000770 Ga0495633_0000770_21749_22243 160
181 3300046616 Ga0495668_0000016 Ga0495668_0000016_358062_358556 160
182 3300046665 Ga0495661_0069533 Ga0495661_0069533_43_537 160
183 3300046691 Ga0495670_0696075 Ga0495670_0696075_37_531 160
184 3300046810 Ga0495660_0140865 Ga0495660_0140865_176_670 160
185 3300047323 Ga0495683_0022664 Ga0495683_0022664_155_649 160
186 3300047443 Ga0495687_001300 Ga0495687_001300_14825_15319 160
187 3300047445 Ga0495677_0001495 Ga0495677_0001495_7887_8381 160
188 3300047472 Ga0495686_0001345 Ga0495686_0001345_11918_12421 160
189 3300048905 Ga0496102_0002646 Ga0496102_0002646_10818_11312 160
190 3300048906 Ga0496103_0000131 Ga0496103_0000131_10688_11182 160
191 3300048907 Ga0496104_0037026 Ga0496104_0037026_2865_3359 160
192 3300048907 Ga0496104_0950216 Ga0496104_0950216_155_694 160
193 3300048908 Ga0496105_0001020 Ga0496105_0001020_12864_13358 160
194 3300048912 Ga0496109_0295130 Ga0496109_0295130_320_814 160
195 3300048913 Ga0496110_0018372 Ga0496110_0018372_4688_5182 160
196 3300048914 Ga0496111_0926486 Ga0496111_0926486_79_606 160
197 3300048916 Ga0496113_0180622 Ga0496113_0180622_864_1358 160
198 3300048917 Ga0496114_0054285 Ga0496114_0054285_1988_2482 160
199 3300048917 Ga0496114_0843947 Ga0496114_0843947_243_740 160
200 3300048918 Ga0496115_0000133 Ga0496115_0000133_56847_57341 160
201 3300048918 Ga0496115_0082158 Ga0496115_0082158_20_547 160
202 3300048919 Ga0496116_0005419 Ga0496116_0005419_2144_2638 160
203 3300048920 Ga0496117_0002127 Ga0496117_0002127_14332_14826 160
204 3300048921 Ga0496118_0000092 Ga0496118_0000092_73005_73499 160
205 3300048922 Ga0496119_0005121 Ga0496119_0005121_9330_9824 160
206 3300048923 Ga0496120_0052063 Ga0496120_0052063_309_803 160
207 3300048924 Ga0496121_0005979 Ga0496121_0005979_4366_4860 160
208 3300048925 Ga0496122_0022791 Ga0496122_0022791_619_1113 160
209 3300048926 Ga0496123_0002753 Ga0496123_0002753_7763_8257 160
210 3300048927 Ga0496124_0000081 Ga0496124_0000081_134843_135337 160
211 3300048928 Ga0496125_0002309 Ga0496125_0002309_14030_14524 160
212 3300048929 Ga0496126_0000283 Ga0496126_0000283_95616_96110 160
213 3300049569 Ga0501032_0091583 Ga0501032_0091583_907_1428 160
214 3300049570 Ga0501033_0462631 Ga0501033_0462631_310_831 160
215 3300049574 Ga0501038_0157643 Ga0501038_0157643_1220_1741 160
216 3300049581 Ga0501047_0183419 Ga0501047_0183419_13_534 160
217 3300049588 Ga0501072_0482326 Ga0501072_0482326_354_884 160
218 3300049742 Ga0501080_0483552 Ga0501080_0483552_70_591 160
219 3300049822 Ga0501035_0106862 Ga0501035_0106862_1240_1761 160
220 3300049823 Ga0501044_0120000 Ga0501044_0120000_252_773 160
221 3300050493 nmdc:mga0k408_13217_c1 nmdc:mga0k408_13217_c1_2926_3408 160
222 3300050496 nmdc:mga07m45_433783_c1 nmdc:mga07m45_433783_c1_82_591 160
223 3300050516 nmdc:mga0sz30_59505_c1 nmdc:mga0sz30_59505_c1_70_564 160
224 3300053090 Ga0500646_0142347 Ga0500646_0142347_272_766 160
225 3300053093 Ga0500651_0228457 Ga0500651_0228457_482_976 160
226 3300053158 Ga0500627_0085631 Ga0500627_0085631_307_801 160
227 3300053177 Ga0500636_0007959 Ga0500636_0007959_5516_6010 160
228 3300053727 Ga0500611_130912 Ga0500611_130912_118_612 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

28

120

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f2e-assembly1.cif.gz_A crystal structure of pa1607, a putative transcription factor 0.9071 2 105
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.8754 2 101
7bzd-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, wild type 0.8734 2 101
2fsw-assembly1.cif.gz_A crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 0.8694 1 101
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.8612 5 99
ID Description Score Start End Superfamily
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9105 3 106 1.10.10.10
af_P71983_1_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8739 2 104 1.10.10.10
2fswA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8599 1 98 1.10.10.10
af_I1L271_42_109_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.845 16 81 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8403 16 79 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A380WHM2-F1-model_v4 Uncharacterized HTH-type transcriptional regulator yybR 0.9787 2 159 GO:0003677
AF-A0A6G6W429-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9779 2 159 GO:0003677
AF-A0A527H7P0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9759 2 139 GO:0003677
AF-A0A239PZS4-F1-model_v4 Transcriptional regulator, HxlR family 0.9756 2 159 GO:0003677
AF-A0A3N6WKR1-F1-model_v4 Transcriptional regulator 0.9748 2 159 GO:0003677

Feature Viewer

pLDDT pTM Quality
94.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map