F340371

General Info

Members Datasets Scaffolds Average Seq Length
227 143 454 289

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0210559|Ga0501047_0210559_155_1036
Length 285
Sequence VIERDVPLARLTTLGTGGPAVAFARPATVAELEEALRWAAAEGLPAHVVGLGSNLLVADGGVDALVLRLDGELAAVAVADEELVAGGGAANAVCLHRARDAGLGGFEFASAIPGTVGGGVRMNAGAYGGDFAQVLVDALVVDEQGARTLTPAQLGLAYRHSDLVPGEVVARVPEEIRAAVKELAERRKSTQPTNKRTFGSVFKNPEHELGAGAMLEACGLKGFRIGGAVISPRHANFIENAGGATTADALALMVEARRRAFERFGVRLEHEVQLLGPIELPSLAG

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 12.33
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 15.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0210559 3300049581 Bacteria 1803
2 Ga0070683_100356651 3300005329 Bacteria 1393
3 Ga0070660_100057239 3300005339 Bacteria 3019
4 Ga0070692_10085867 3300005345 Unclassified 1703
5 Ga0070671_100158130 3300005355 Bacteria 1915
6 Ga0070709_10106841 3300005434 Bacteria 1875
7 Ga0070714_100353449 3300005435 Bacteria 1380
8 Ga0070711_100056265 3300005439 Bacteria 2719
9 Ga0070708_100017297 3300005445 Bacteria 6010
10 Ga0070681_10396009 3300005458 Bacteria 1292
11 Ga0070706_100026127 3300005467 Bacteria 5373
12 Ga0070707_100004891 3300005468 Bacteria 12557
13 Ga0070707_100056688 3300005468 Unclassified 3758
14 Ga0070707_100446098 3300005468 Bacteria 1254
15 Ga0070698_100001381 3300005471 Bacteria 26903
16 Ga0070698_100166012 3300005471 Bacteria 2151
17 Ga0070699_100029736 3300005518 Bacteria 4711
18 Ga0070679_100110082 3300005530 Bacteria 2740
19 Ga0070684_100267887 3300005535 Unclassified 1563
20 Ga0070684_100474209 3300005535 Bacteria 1158
21 Ga0070697_100084445 3300005536 Unclassified 2618
22 Ga0070695_100000081 3300005545 Bacteria 39746
23 Ga0070696_100231363 3300005546 Bacteria 1391
24 Ga0068855_100216666 3300005563 Bacteria 2149
25 Ga0068855_100222557 3300005563 Unclassified 2115
26 Ga0070664_100078410 3300005564 Unclassified 2842
27 Ga0070702_100245392 3300005615 Bacteria 1211
28 Ga0068864_100338487 3300005618 Bacteria 1417
29 Ga0075365_10003374 3300006038 Bacteria 8212
30 Ga0075364_10003908 3300006051 Bacteria 8542
31 Ga0070716_100255209 3300006173 Bacteria 1197
32 Ga0075428_100007984 3300006844 Bacteria 11740
33 Ga0075428_100118394 3300006844 Bacteria 2884
34 Ga0075430_100011941 3300006846 Bacteria 7395
35 Ga0075431_100080685 3300006847 Bacteria 3359
36 Ga0075431_100248143 3300006847 Bacteria 1809
37 Ga0075429_100029141 3300006880 Bacteria 4794
38 Ga0068865_100273034 3300006881 Bacteria 1343
39 Ga0105240_10005137 3300009093 Bacteria 19588
40 Ga0111539_10079535 3300009094 Bacteria 3856
41 Ga0111539_10092515 3300009094 Bacteria 3554
42 Ga0105245_10071879 3300009098 Bacteria 3142
43 Ga0114129_10000727 3300009147 Bacteria 41768
44 Ga0114129_10022487 3300009147 Bacteria 8949
45 Ga0114129_10031696 3300009147 Bacteria 7473
46 Ga0157369_10008247 3300013105 Bacteria 11942
47 Ga0157369_10031848 3300013105 Bacteria 5803
48 Ga0157369_10563561 3300013105 Unclassified 1177
49 Ga0157372_10009736 3300013307 Bacteria 10221
50 Ga0157372_10663357 3300013307 Unclassified 1214
51 Ga0157375_10031098 3300013308 Bacteria 5040
52 Ga0157375_10040176 3300013308 Bacteria 4508
53 Ga0182008_10046342 3300014497 Bacteria 2161
54 Ga0182006_1022470 3300015261 Bacteria 2622
55 Ga0182007_10014263 3300015262 Bacteria 3003
56 Ga0207705_10203694 3300025909 Bacteria 1500
57 Ga0207684_10060489 3300025910 Bacteria 3217
58 Ga0207684_10385357 3300025910 Bacteria 1205
59 Ga0207707_10106779 3300025912 Unclassified 2447
60 Ga0207707_10247140 3300025912 Bacteria 1550
61 Ga0207695_10025260 3300025913 Bacteria 6656
62 Ga0207671_10015967 3300025914 Bacteria 5853
63 Ga0207693_10001178 3300025915 Bacteria 23346
64 Ga0207660_10022198 3300025917 Bacteria 4275
65 Ga0207657_10007859 3300025919 Bacteria 10887
66 Ga0207657_10047014 3300025919 Bacteria 3777
67 Ga0207652_10482268 3300025921 Unclassified 1117
68 Ga0207646_10001949 3300025922 Bacteria 24766
69 Ga0207646_10210808 3300025922 Bacteria 1754
70 Ga0207646_10277347 3300025922 Unclassified 1515
71 Ga0207687_10049287 3300025927 Bacteria 2928
72 Ga0207690_10157347 3300025932 Unclassified 1690
73 Ga0207669_10084032 3300025937 Unclassified 2050
74 Ga0207665_10034623 3300025939 Unclassified 3351
75 Ga0207665_10066897 3300025939 Bacteria 2446
76 Ga0207661_10457148 3300025944 Unclassified 1163
77 Ga0207679_10196955 3300025945 Unclassified 1680
78 Ga0207667_10165884 3300025949 Bacteria 2271
79 Ga0207667_10551205 3300025949 Unclassified 1166
80 Ga0207428_10008283 3300027907 Bacteria 9399
81 Ga0265318_10015482 3300028577 Bacteria 3171
82 Ga0265336_10019005 3300028666 Bacteria 2220
83 Ga0307416_100047162 3300032002 Bacteria 3408
84 Ga0373936_0004902 3300035113 Bacteria 5043
85 Ga0373943_0090814 3300035170 Bacteria 1581
86 Ga0373947_0005315 3300035725 Bacteria 7529
87 Ga0373925_0023885 3300037068 Bacteria 4459
88 Ga0395899_0046704 3300037312 Bacteria 3225
89 Ga0395900_0013763 3300037418 Bacteria 8257
90 Ga0395900_0032602 3300037418 Bacteria 5358
91 Ga0395900_0198574 3300037418 Bacteria 2031
92 Ga0395900_0295930 3300037418 Bacteria 1606
93 Ga0395898_0024734 3300037466 Bacteria 6054
94 Ga0395898_0135561 3300037466 Bacteria 2357
95 Ga0395898_0167297 3300037466 Bacteria 2102
96 Ga0395898_0272807 3300037466 Bacteria 1613
97 Ga0395898_0652250 3300037466 Bacteria 995
98 Ga0395905_0034939 3300037471 Bacteria 4719
99 Ga0395905_0060982 3300037471 Bacteria 3527
100 Ga0395905_0488137 3300037471 Bacteria 1131
101 Ga0395901_0017763 3300038443 Bacteria 7261
102 Ga0395901_0032318 3300038443 Bacteria 5400
103 Ga0395901_0042620 3300038443 Bacteria 4706
104 Ga0395901_0142746 3300038443 Bacteria 2517
105 Ga0395901_0351743 3300038443 Bacteria 1520
106 Ga0439459_0013268 3300042438 Bacteria 1481
107 Ga0466969_0013198 3300044656 Bacteria 4352
108 Ga0466961_0080473 3300044693 Unclassified 2062
109 Ga0466961_0135225 3300044693 Unclassified 1545
110 Ga0466963_0014296 3300044694 Bacteria 4891
111 Ga0466963_0018169 3300044694 Bacteria 4393
112 Ga0466963_0211935 3300044694 Bacteria 1356
113 Ga0466964_0005847 3300044706 Bacteria 4577
114 Ga0466964_0015959 3300044706 Bacteria 2860
115 Ga0466964_0024673 3300044706 Bacteria 2344
116 Ga0466964_0029288 3300044706 Bacteria 2173
117 Ga0466968_0042173 3300044735 Bacteria 1928
118 Ga0466970_0008066 3300044765 Bacteria 5288
119 Ga0466957_0014906 3300044842 Bacteria 4534
120 Ga0466957_0020149 3300044842 Bacteria 3925
121 Ga0466957_0066771 3300044842 Bacteria 2218
122 Ga0466959_0019820 3300045049 Bacteria 4949
123 Ga0466959_0222024 3300045049 Bacteria 1310
124 Ga0466958_0001049 3300045836 Bacteria 12651
125 Ga0466958_0002308 3300045836 Bacteria 9512
126 Ga0466958_0005159 3300045836 Bacteria 6987
127 Ga0466958_0016398 3300045836 Bacteria 4265
128 Ga0466967_0002461 3300045976 Bacteria 11534
129 Ga0466967_0005230 3300045976 Bacteria 8941
130 Ga0466967_0009770 3300045976 Bacteria 7151
131 Ga0466967_0039780 3300045976 Bacteria 4045
132 Ga0466967_0103183 3300045976 Bacteria 2609
133 Ga0466967_0158270 3300045976 Bacteria 2124
134 Ga0466967_0205760 3300045976 Bacteria 1865
135 Ga0466967_0297234 3300045976 Bacteria 1553
136 Ga0466967_0304227 3300045976 Bacteria 1535
137 Ga0495641_0021650 3300046461 Bacteria 3231
138 Ga0495653_0123659 3300046463 Unclassified 1840
139 Ga0495582_0065147 3300046473 Bacteria 2013
140 Ga0495584_0008183 3300046491 Bacteria 5430
141 Ga0495585_0098222 3300046492 Unclassified 1569
142 Ga0495607_0010011 3300046501 Bacteria 6388
143 Ga0495608_0086215 3300046511 Bacteria 2035
144 Ga0495630_0051460 3300046517 Bacteria 3083
145 Ga0495630_0074120 3300046517 Bacteria 2563
146 Ga0495630_0135224 3300046517 Bacteria 1873
147 Ga0495663_0005717 3300046525 Bacteria 3445
148 Ga0495663_0017947 3300046525 Bacteria 2012
149 Ga0495642_0013290 3300046528 Bacteria 3182
150 Ga0495642_0139826 3300046528 Bacteria 1045
151 Ga0495586_0009375 3300046535 Bacteria 5208
152 Ga0495609_0110061 3300046538 Unclassified 1189
153 Ga0495667_0047874 3300046559 Unclassified 2823
154 Ga0495656_0003504 3300046615 Bacteria 5308
155 Ga0495656_0016275 3300046615 Bacteria 2820
156 Ga0495611_0034499 3300046648 Bacteria 2237
157 Ga0495635_0172110 3300046663 Bacteria 1472
158 Ga0495657_0277278 3300046675 Bacteria 1004
159 Ga0495658_0006092 3300046683 Bacteria 5921
160 Ga0495658_0041461 3300046683 Bacteria 2564
161 Ga0495670_0126661 3300046691 Unclassified 1330
162 Ga0495589_0052045 3300046794 Bacteria 2023
163 Ga0495589_0113097 3300046794 Bacteria 1310
164 Ga0495676_0244902 3300047321 Bacteria 1226
165 Ga0495680_0123485 3300047322 Bacteria 1910
166 Ga0495677_0020739 3300047445 Bacteria 2382
167 Ga0495677_0045584 3300047445 Bacteria 1609
168 Ga0495685_017030 3300047447 Bacteria 2486
169 Ga0495684_0040161 3300047471 Bacteria 3587
170 Ga0495684_0097455 3300047471 Bacteria 2225
171 Ga0495614_0017509 3300048089 Bacteria 3113
172 Ga0496101_0016769 3300048904 Bacteria 4958
173 Ga0496102_0126712 3300048905 Bacteria 2387
174 Ga0496103_0063617 3300048906 Bacteria 2298
175 Ga0496104_0037763 3300048907 Bacteria 4515
176 Ga0496104_0103056 3300048907 Bacteria 2734
177 Ga0496104_0116702 3300048907 Bacteria 2561
178 Ga0496105_0002747 3300048908 Bacteria 12843
179 Ga0496105_0170114 3300048908 Unclassified 1786
180 Ga0496105_0371136 3300048908 Bacteria 1140
181 Ga0496108_0047306 3300048911 Unclassified 3596
182 Ga0496108_0062389 3300048911 Bacteria 3138
183 Ga0496108_0074564 3300048911 Bacteria 2865
184 Ga0496108_0219768 3300048911 Bacteria 1651
185 Ga0496109_0011408 3300048912 Bacteria 7638
186 Ga0496109_0074244 3300048912 Bacteria 3125
187 Ga0496109_0318939 3300048912 Unclassified 1466
188 Ga0496109_0523630 3300048912 Archaea 1119
189 Ga0496110_0017489 3300048913 Bacteria 5998
190 Ga0496110_0119942 3300048913 Unclassified 2369
191 Ga0496110_0178489 3300048913 Bacteria 1928
192 Ga0496111_0116134 3300048914 Unclassified 1974
193 Ga0496112_0076855 3300048915 Bacteria 3302
194 Ga0496112_0088873 3300048915 Bacteria 3058
195 Ga0496113_0222721 3300048916 Unclassified 1503
196 Ga0496114_0029152 3300048917 Bacteria 4534
197 Ga0496114_0058885 3300048917 Bacteria 3208
198 Ga0496115_0002001 3300048918 Bacteria 14568
199 Ga0496115_0162635 3300048918 Unclassified 1845
200 Ga0501031_0130795 3300049568 Bacteria 1640
201 Ga0501038_0163943 3300049574 Bacteria 1804
202 Ga0501042_0188684 3300049578 Bacteria 1487
203 Ga0501069_0104055 3300049585 Unclassified 1613
204 Ga0501070_0149259 3300049586 Bacteria 1929
205 Ga0501070_0275001 3300049586 Unclassified 1375
206 Ga0501071_0043273 3300049587 Bacteria 3228
207 Ga0501072_0026553 3300049588 Bacteria 4515
208 Ga0501075_0035877 3300049591 Bacteria 3699
209 Ga0501079_0026346 3300049741 Bacteria 4458
210 Ga0501083_0242446 3300049744 Bacteria 1173
211 Ga0501045_0044544 3300049824 Bacteria 3232
212 nmdc:mga00v17_39515_c1 3300050491 Bacteria 2826
213 nmdc:mga05p37_191322_c1 3300050507 Bacteria 2484
214 nmdc:mga05p37_235027_c1 3300050507 Bacteria 2207
215 nmdc:mga05p37_277695_c1 3300050507 Bacteria 1999
216 nmdc:mga05p37_4211_c1 3300050507 Bacteria 16807
217 nmdc:mga09592_67538_c1 3300050508 Bacteria 3033
218 nmdc:mga0qj67_20803_c1 3300050509 Bacteria 5025
219 nmdc:mga06r32_234896_c1 3300050510 Bacteria 1821
220 nmdc:mga06r32_42852_c1 3300050510 Bacteria 4306
221 nmdc:mga08y16_14435_c1 3300050511 Bacteria 8309
222 Ga0495601_0145445 3300053077 Unclassified 1547
223 Ga0495595_0052222 3300053084 Bacteria 1896
224 Ga0495619_0082456 3300053085 Bacteria 2167
225 Ga0466962_0009789 3300061719 Bacteria 4599
226 Ga0466962_0117803 3300061719 Unclassified 1280
227 Ga0530510_0012662 3300061734 Bacteria 5929
228 Ga0501047_0210559
229 Ga0070683_100356651
230 Ga0070660_100057239
231 Ga0070692_10085867
232 Ga0070671_100158130
233 Ga0070709_10106841
234 Ga0070714_100353449
235 Ga0070711_100056265
236 Ga0070708_100017297
237 Ga0070681_10396009
238 Ga0070706_100026127
239 Ga0070707_100004891
240 Ga0070707_100056688
241 Ga0070707_100446098
242 Ga0070698_100001381
243 Ga0070698_100166012
244 Ga0070699_100029736
245 Ga0070679_100110082
246 Ga0070684_100267887
247 Ga0070684_100474209
248 Ga0070697_100084445
249 Ga0070695_100000081
250 Ga0070696_100231363
251 Ga0068855_100216666
252 Ga0068855_100222557
253 Ga0070664_100078410
254 Ga0070702_100245392
255 Ga0068864_100338487
256 Ga0075365_10003374
257 Ga0075364_10003908
258 Ga0070716_100255209
259 Ga0075428_100007984
260 Ga0075428_100118394
261 Ga0075430_100011941
262 Ga0075431_100080685
263 Ga0075431_100248143
264 Ga0075429_100029141
265 Ga0068865_100273034
266 Ga0105240_10005137
267 Ga0111539_10079535
268 Ga0111539_10092515
269 Ga0105245_10071879
270 Ga0114129_10000727
271 Ga0114129_10022487
272 Ga0114129_10031696
273 Ga0157369_10008247
274 Ga0157369_10031848
275 Ga0157369_10563561
276 Ga0157372_10009736
277 Ga0157372_10663357
278 Ga0157375_10031098
279 Ga0157375_10040176
280 Ga0182008_10046342
281 Ga0182006_1022470
282 Ga0182007_10014263
283 Ga0207705_10203694
284 Ga0207684_10060489
285 Ga0207684_10385357
286 Ga0207707_10106779
287 Ga0207707_10247140
288 Ga0207695_10025260
289 Ga0207671_10015967
290 Ga0207693_10001178
291 Ga0207660_10022198
292 Ga0207657_10007859
293 Ga0207657_10047014
294 Ga0207652_10482268
295 Ga0207646_10001949
296 Ga0207646_10210808
297 Ga0207646_10277347
298 Ga0207687_10049287
299 Ga0207690_10157347
300 Ga0207669_10084032
301 Ga0207665_10034623
302 Ga0207665_10066897
303 Ga0207661_10457148
304 Ga0207679_10196955
305 Ga0207667_10165884
306 Ga0207667_10551205
307 Ga0207428_10008283
308 Ga0265318_10015482
309 Ga0265336_10019005
310 Ga0307416_100047162
311 Ga0373936_0004902
312 Ga0373943_0090814
313 Ga0373947_0005315
314 Ga0373925_0023885
315 Ga0395899_0046704
316 Ga0395900_0013763
317 Ga0395900_0032602
318 Ga0395900_0198574
319 Ga0395900_0295930
320 Ga0395898_0024734
321 Ga0395898_0135561
322 Ga0395898_0167297
323 Ga0395898_0272807
324 Ga0395898_0652250
325 Ga0395905_0034939
326 Ga0395905_0060982
327 Ga0395905_0488137
328 Ga0395901_0017763
329 Ga0395901_0032318
330 Ga0395901_0042620
331 Ga0395901_0142746
332 Ga0395901_0351743
333 Ga0439459_0013268
334 Ga0466969_0013198
335 Ga0466961_0080473
336 Ga0466961_0135225
337 Ga0466963_0014296
338 Ga0466963_0018169
339 Ga0466963_0211935
340 Ga0466964_0005847
341 Ga0466964_0015959
342 Ga0466964_0024673
343 Ga0466964_0029288
344 Ga0466968_0042173
345 Ga0466970_0008066
346 Ga0466957_0014906
347 Ga0466957_0020149
348 Ga0466957_0066771
349 Ga0466959_0019820
350 Ga0466959_0222024
351 Ga0466958_0001049
352 Ga0466958_0002308
353 Ga0466958_0005159
354 Ga0466958_0016398
355 Ga0466967_0002461
356 Ga0466967_0005230
357 Ga0466967_0009770
358 Ga0466967_0039780
359 Ga0466967_0103183
360 Ga0466967_0158270
361 Ga0466967_0205760
362 Ga0466967_0297234
363 Ga0466967_0304227
364 Ga0495641_0021650
365 Ga0495653_0123659
366 Ga0495582_0065147
367 Ga0495584_0008183
368 Ga0495585_0098222
369 Ga0495607_0010011
370 Ga0495608_0086215
371 Ga0495630_0051460
372 Ga0495630_0074120
373 Ga0495630_0135224
374 Ga0495663_0005717
375 Ga0495663_0017947
376 Ga0495642_0013290
377 Ga0495642_0139826
378 Ga0495586_0009375
379 Ga0495609_0110061
380 Ga0495667_0047874
381 Ga0495656_0003504
382 Ga0495656_0016275
383 Ga0495611_0034499
384 Ga0495635_0172110
385 Ga0495657_0277278
386 Ga0495658_0006092
387 Ga0495658_0041461
388 Ga0495670_0126661
389 Ga0495589_0052045
390 Ga0495589_0113097
391 Ga0495676_0244902
392 Ga0495680_0123485
393 Ga0495677_0020739
394 Ga0495677_0045584
395 Ga0495685_017030
396 Ga0495684_0040161
397 Ga0495684_0097455
398 Ga0495614_0017509
399 Ga0496101_0016769
400 Ga0496102_0126712
401 Ga0496103_0063617
402 Ga0496104_0037763
403 Ga0496104_0103056
404 Ga0496104_0116702
405 Ga0496105_0002747
406 Ga0496105_0170114
407 Ga0496105_0371136
408 Ga0496108_0047306
409 Ga0496108_0062389
410 Ga0496108_0074564
411 Ga0496108_0219768
412 Ga0496109_0011408
413 Ga0496109_0074244
414 Ga0496109_0318939
415 Ga0496109_0523630
416 Ga0496110_0017489
417 Ga0496110_0119942
418 Ga0496110_0178489
419 Ga0496111_0116134
420 Ga0496112_0076855
421 Ga0496112_0088873
422 Ga0496113_0222721
423 Ga0496114_0029152
424 Ga0496114_0058885
425 Ga0496115_0002001
426 Ga0496115_0162635
427 Ga0501031_0130795
428 Ga0501038_0163943
429 Ga0501042_0188684
430 Ga0501069_0104055
431 Ga0501070_0149259
432 Ga0501070_0275001
433 Ga0501071_0043273
434 Ga0501072_0026553
435 Ga0501075_0035877
436 Ga0501079_0026346
437 Ga0501083_0242446
438 Ga0501045_0044544
439 nmdc:mga00v17_39515_c1
440 nmdc:mga05p37_191322_c1
441 nmdc:mga05p37_235027_c1
442 nmdc:mga05p37_277695_c1
443 nmdc:mga05p37_4211_c1
444 nmdc:mga09592_67538_c1
445 nmdc:mga0qj67_20803_c1
446 nmdc:mga06r32_234896_c1
447 nmdc:mga06r32_42852_c1
448 nmdc:mga08y16_14435_c1
449 Ga0495601_0145445
450 Ga0495595_0052222
451 Ga0495619_0082456
452 Ga0466962_0009789
453 Ga0466962_0117803
454 Ga0530510_0012662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

175

275

0.96

PF01565

FAD_binding_4

FAD binding domain

20

149

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.8698 1 279
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.8602 3 278
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.8553 2 280
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.8527 1 279
2gqu-assembly1.cif.gz_A crystal structure of udp-n-acetylenolpyruvylglucosamine reductase (murb) from thermus caldophilus 0.8442 1 276
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9447 193 280 3.90.78.10
af_C0PHW4_38_147_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9359 21 49 3.30.43.10
2bvfA01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9356 21 49 3.30.43.10
af_I1NID0_30_136_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9352 21 49 3.30.43.10
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9343 193 280 3.90.78.10
ID Description Score Start End GO Terms
AF-A0A661BBK9-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9793 200 271 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A3D0M3X9-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9566 188 277 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555
AF-A0A2T4S5F8-F1-model_v4 UDP-N-acetylmuramate dehydrogenase (EC 1.3.1.98) 0.9525 189 279 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A399ZE49-F1-model_v4 UDP-N-acetylmuramate dehydrogenase (EC 1.3.1.98) 0.9493 191 280 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A2D3VWZ5-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9371 185 278 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555

Map