F340216

General Info

Members Datasets Scaffolds Average Seq Length
227 104 444 137

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0245793|Ga0451577_0245793_972_1409
Length 145
Sequence MGITMTMTVHVDVVSAEEQIFSGLAEVVVVPGEMGELGIYPRHTALMTRIKPGAVRIKSPDQEEEVLIYVSGGMLEVQPNVVTVLADTAIRGHDLDEARALEAKQAAEEALKNRTADLDLAQAXXXXAEAIAQLRAIQQLRKTTH

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
21 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
30 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
33 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
34 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
35 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
44 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
45 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
46 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
47 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
52 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
53 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
61 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
62 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
63 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
64 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
74 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
75 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
76 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.07
Metatranscriptomes 7.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 4.41
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0245793 3300042876 Bacteria 1619
2 Ga0070682_100669944 3300005337 Bacteria 828
3 Ga0070689_101020448 3300005340 Bacteria 737
4 Ga0070671_100397905 3300005355 Bacteria 1178
5 Ga0070659_100096833 3300005366 Bacteria 2371
6 Ga0070663_100173261 3300005455 Bacteria 1669
7 Ga0070662_100100210 3300005457 Bacteria 2191
8 Ga0070662_101308133 3300005457 Bacteria 624
9 Ga0070679_101821242 3300005530 Unclassified 557
10 Ga0068853_100255892 3300005539 Bacteria 1608
11 Ga0068853_101060176 3300005539 Bacteria 781
12 Ga0068854_101682117 3300005578 Bacteria 580
13 Ga0068856_100202063 3300005614 Bacteria 2002
14 Ga0075366_10000391 3300006195 Bacteria 20363
15 Ga0075366_10140105 3300006195 Bacteria 1462
16 Ga0111539_10079682 3300009094 Bacteria 3853
17 Ga0111539_10881478 3300009094 Bacteria 1041
18 Ga0105242_10042536 3300009176 Bacteria 3669
19 Ga0105237_11349829 3300009545 Bacteria 719
20 Ga0105239_10343109 3300010375 Bacteria 1686
21 Ga0157373_10675082 3300013100 Unclassified 756
22 Ga0157374_10009986 3300013296 Bacteria 8151
23 Ga0157375_10107011 3300013308 Bacteria 2889
24 Ga0157377_10591102 3300014745 Bacteria 790
25 Ga0207707_11531454 3300025912 Bacteria 527
26 Ga0207662_10018444 3300025918 Bacteria 3960
27 Ga0207646_10727893 3300025922 Bacteria 886
28 Ga0207690_10476170 3300025932 Bacteria 1007
29 Ga0207706_10085395 3300025933 Bacteria 2775
30 Ga0207706_10406524 3300025933 Bacteria 1180
31 Ga0207706_10664370 3300025933 Bacteria 892
32 Ga0207702_10956233 3300026078 Bacteria 849
33 Ga0207683_10322838 3300026121 Bacteria 1414
34 Ga0209974_10228908 3300027876 Bacteria 694
35 Ga0207428_10059073 3300027907 Bacteria 3041
36 Ga0265336_10000584 3300028666 Bacteria 20549
37 Ga0265338_10454640 3300028800 Bacteria 906
38 Ga0265324_10000018 3300029957 Bacteria 184238
39 Ga0265324_10001353 3300029957 Bacteria 14301
40 Ga0265324_10039556 3300029957 Bacteria 1635
41 Ga0265324_10048081 3300029957 Bacteria 1467
42 Ga0265332_10049861 3300031238 Bacteria 1799
43 Ga0265328_10036706 3300031239 Bacteria 1811
44 Ga0265328_10076476 3300031239 Bacteria 1232
45 Ga0265325_10000035 3300031241 Bacteria 99051
46 Ga0265325_10041218 3300031241 Bacteria 2420
47 Ga0265331_10000259 3300031250 Bacteria 60879
48 Ga0265331_10001923 3300031250 Bacteria 14557
49 Ga0265331_10003137 3300031250 Bacteria 10796
50 Ga0265331_10013855 3300031250 Bacteria 4316
51 Ga0265331_10022556 3300031250 Bacteria 3211
52 Ga0265331_10042424 3300031250 Bacteria 2206
53 Ga0265331_10260600 3300031250 Bacteria 777
54 Ga0265327_10000250 3300031251 Bacteria 107090
55 Ga0265327_10000502 3300031251 Bacteria 67878
56 Ga0265327_10000595 3300031251 Bacteria 60289
57 Ga0265327_10003486 3300031251 Bacteria 14963
58 Ga0265327_10006387 3300031251 Bacteria 9441
59 Ga0265327_10011810 3300031251 Bacteria 5969
60 Ga0265327_10149414 3300031251 Bacteria 1086
61 Ga0265316_10149799 3300031344 Bacteria 1748
62 Ga0265316_10821113 3300031344 Bacteria 651
63 Ga0316575_10000484 3300031665 Bacteria 11516
64 Ga0316575_10171292 3300031665 Bacteria 900
65 Ga0316579_10052653 3300031691 Bacteria 1906
66 Ga0316579_10070293 3300031691 Bacteria 1658
67 Ga0265314_10005275 3300031711 Bacteria 11697
68 Ga0265314_10042586 3300031711 Bacteria 3237
69 Ga0316576_10005316 3300031727 Bacteria 7847
70 Ga0316576_10005400 3300031727 Bacteria 7804
71 Ga0316576_10026802 3300031727 Bacteria 4048
72 Ga0316576_10065614 3300031727 Bacteria 2668
73 Ga0316576_10118542 3300031727 Bacteria 1987
74 Ga0316578_10025148 3300031728 Bacteria 3345
75 Ga0316578_10030334 3300031728 Bacteria 3073
76 Ga0316578_10359780 3300031728 Bacteria 866
77 Ga0316578_10835581 3300031728 Bacteria 533
78 Ga0316577_10006165 3300031733 Bacteria 6323
79 Ga0316577_10626684 3300031733 Unclassified 612
80 Ga0316585_10007973 3300032137 Bacteria 3063
81 Ga0316580_10197213 3300032139 Bacteria 620
82 Ga0316580_10280145 3300032139 Bacteria 517
83 Ga0316593_10015316 3300032168 Bacteria 2304
84 Ga0316593_10026342 3300032168 Bacteria 1858
85 Ga0316593_10034181 3300032168 Bacteria 1667
86 Ga0316593_10061875 3300032168 Bacteria 1281
87 Ga0316593_10166290 3300032168 Bacteria 807
88 Ga0316593_10244064 3300032168 Bacteria 671
89 Ga0316593_10257346 3300032168 Bacteria 654
90 Ga0316593_10377805 3300032168 Bacteria 545
91 Ga0316592_1003822 3300033524 Bacteria 2759
92 Ga0316592_1042819 3300033524 Bacteria 1004
93 Ga0316592_1082723 3300033524 Bacteria 731
94 Ga0316587_1052193 3300033529 Bacteria 750
95 Ga0316596_1000409 3300033541 Bacteria 7143
96 Ga0316596_1022701 3300033541 Bacteria 1605
97 Ga0316596_1028263 3300033541 Bacteria 1449
98 Ga0373952_0000274 3300035092 Bacteria 8479
99 Ga0373960_0227251 3300035121 Bacteria 670
100 Ga0373942_0261603 3300035207 Bacteria 591
101 Ga0316574_0072412 3300035398 Unclassified 2178
102 Ga0316574_0109189 3300035398 Bacteria 1773
103 Ga0316574_0711454 3300035398 Bacteria 615
104 Ga0373927_0112682 3300035695 Bacteria 1773
105 Ga0373927_0207260 3300035695 Bacteria 1288
106 Ga0373927_0444510 3300035695 Bacteria 856
107 Ga0316582_0003219 3300036647 Bacteria 7943
108 Ga0316582_0117910 3300036647 Bacteria 1774
109 Ga0316582_0152065 3300036647 Bacteria 1565
110 Ga0316582_0276386 3300036647 Bacteria 1152
111 Ga0316582_0626150 3300036647 Bacteria 740
112 Ga0316584_0064058 3300036712 Bacteria 2752
113 Ga0316584_0209627 3300036712 Bacteria 1435
114 Ga0373925_1615264 3300037068 Bacteria 530
115 Ga0395901_0757076 3300038443 Bacteria 964
116 Ga0395901_0951425 3300038443 Bacteria 838
117 Ga0400484_02771 3300038725 Bacteria 1590
118 Ga0400490_10504 3300038726 Bacteria 6403
119 Ga0439453_0057894 3300041408 Bacteria 797
120 Ga0439465_0182925 3300041413 Bacteria 759
121 Ga0451804_1039336 3300041463 Bacteria 583
122 Ga0451577_0000002 3300042876 Bacteria 1731375
123 Ga0451577_0000375 3300042876 Bacteria 83271
124 Ga0451577_0002837 3300042876 Bacteria 19935
125 Ga0451577_0025893 3300042876 Bacteria 5318
126 Ga0451577_0030220 3300042876 Bacteria 4895
127 Ga0451577_0278410 3300042876 Bacteria 1515
128 Ga0451577_0324443 3300042876 Bacteria 1396
129 Ga0451577_0499630 3300042876 Bacteria 1104
130 Ga0451577_1367477 3300042876 Bacteria 628
131 Ga0453683_0000013 3300044673 Bacteria 371932
132 Ga0453683_0011398 3300044673 Bacteria 5856
133 Ga0453683_0023718 3300044673 Bacteria 3909
134 Ga0453683_0222939 3300044673 Bacteria 1199
135 Ga0453683_0785643 3300044673 Bacteria 626
136 Ga0453684_0000002 3300044712 Bacteria 1731375
137 Ga0453684_0000040 3300044712 Bacteria 690210
138 Ga0453684_0000158 3300044712 Bacteria 302033
139 Ga0453684_0007687 3300044712 Bacteria 19716
140 Ga0453684_0009190 3300044712 Bacteria 17372
141 Ga0453684_0036321 3300044712 Bacteria 6792
142 Ga0453684_0184280 3300044712 Bacteria 2448
143 Ga0453684_0518330 3300044712 Bacteria 1317
144 Ga0453684_0718248 3300044712 Bacteria 1084
145 Ga0453684_1011737 3300044712 Bacteria 883
146 Ga0451576_0000006 3300045051 Bacteria 949698
147 Ga0451576_0000037 3300045051 Bacteria 372173
148 Ga0451576_0002657 3300045051 Bacteria 26048
149 Ga0451576_0006384 3300045051 Bacteria 14478
150 Ga0451576_0007349 3300045051 Bacteria 13205
151 Ga0451576_0037531 3300045051 Bacteria 5131
152 Ga0451576_0052478 3300045051 Bacteria 4272
153 Ga0451576_0124797 3300045051 Bacteria 2682
154 Ga0451576_0141239 3300045051 Bacteria 2511
155 Ga0451576_0161014 3300045051 Bacteria 2342
156 Ga0451576_0214779 3300045051 Bacteria 2009
157 Ga0451576_0303491 3300045051 Bacteria 1670
158 Ga0451576_0413350 3300045051 Bacteria 1415
159 Ga0451576_0484333 3300045051 Bacteria 1299
160 Ga0451576_0736488 3300045051 Bacteria 1035
161 Ga0451576_1034290 3300045051 Bacteria 860
162 Ga0451576_1829258 3300045051 Bacteria 627
163 Ga0496100_1146533 3300048903 Bacteria 613
164 Ga0496106_0650988 3300048909 Bacteria 842
165 Ga0496108_0193269 3300048911 Bacteria 1764
166 Ga0496108_0324257 3300048911 Bacteria 1343
167 Ga0496109_0029545 3300048912 Bacteria 4910
168 Ga0496109_0496972 3300048912 Bacteria 1151
169 Ga0496111_0818105 3300048914 Bacteria 674
170 Ga0496113_0215359 3300048916 Bacteria 1530
171 Ga0496114_0010376 3300048917 Bacteria 7411
172 Ga0501290_102084 3300049513 Bacteria 511
173 Ga0501322_017092 3300049538 Bacteria 612
174 Ga0501031_0003706 3300049568 Bacteria 9829
175 Ga0501031_0015187 3300049568 Bacteria 4999
176 Ga0501032_0001904 3300049569 Bacteria 16472
177 Ga0501032_0008410 3300049569 Bacteria 7526
178 Ga0501032_0363768 3300049569 Bacteria 931
179 Ga0501033_0001759 3300049570 Bacteria 18939
180 Ga0501033_0009375 3300049570 Bacteria 7535
181 Ga0501033_0011812 3300049570 Bacteria 6675
182 Ga0501034_0058586 3300049571 Bacteria 3870
183 Ga0501034_0478164 3300049571 Bacteria 1161
184 Ga0501036_0000762 3300049572 Bacteria 23865
185 Ga0501036_0005160 3300049572 Bacteria 10559
186 Ga0501036_0228138 3300049572 Bacteria 1563
187 Ga0501037_0007273 3300049573 Bacteria 8091
188 Ga0501037_0109507 3300049573 Bacteria 1990
189 Ga0501038_0003826 3300049574 Bacteria 13996
190 Ga0501038_0032977 3300049574 Bacteria 4562
191 Ga0501038_0045424 3300049574 Bacteria 3813
192 Ga0501038_0079558 3300049574 Bacteria 2763
193 Ga0501039_0213970 3300049575 Bacteria 1515
194 Ga0501040_0006337 3300049576 Bacteria 7684
195 Ga0501042_0027433 3300049578 Bacteria 4004
196 Ga0501043_0009404 3300049579 Bacteria 7672
197 Ga0501043_0041136 3300049579 Bacteria 3631
198 Ga0501043_0221775 3300049579 Bacteria 1462
199 Ga0501043_0825057 3300049579 Bacteria 669
200 Ga0501046_0005770 3300049580 Bacteria 11050
201 Ga0501046_0024626 3300049580 Bacteria 4935
202 Ga0501047_0069125 3300049581 Bacteria 3401
203 Ga0501048_0015971 3300049582 Bacteria 5538
204 Ga0501068_0003033 3300049584 Bacteria 8965
205 Ga0501070_0223726 3300049586 Bacteria 1543
206 Ga0501072_0204410 3300049588 Bacteria 1575
207 Ga0501080_1547126 3300049742 Bacteria 563
208 Ga0501280_007302 3300049776 Bacteria 1547
209 Ga0501035_0000444 3300049822 Bacteria 46207
210 Ga0501035_0013784 3300049822 Bacteria 7461
211 Ga0501035_0100765 3300049822 Bacteria 2535
212 Ga0501035_0112149 3300049822 Bacteria 2389
213 Ga0501044_0002682 3300049823 Bacteria 20239
214 Ga0501044_0004474 3300049823 Bacteria 15629
215 Ga0501044_0044560 3300049823 Bacteria 4603
216 Ga0501045_0017199 3300049824 Bacteria 5133
217 nmdc:mga0k408_5496_c1 3300050493 Bacteria 6747
218 nmdc:mga0qj67_292372_c1 3300050509 Bacteria 1320
219 nmdc:mga08y16_282868_c1 3300050511 Bacteria 1711
220 nmdc:mga0n895_338810_c1 3300050512 Bacteria 1523
221 Ga0500622_0000019 3300053156 Bacteria 275028
222 Ga0501082_0393169 3300060353 Bacteria 1210
223 Ga0451577_0245793
224 Ga0070682_100669944
225 Ga0070689_101020448
226 Ga0070671_100397905
227 Ga0070659_100096833
228 Ga0070663_100173261
229 Ga0070662_100100210
230 Ga0070662_101308133
231 Ga0070679_101821242
232 Ga0068853_100255892
233 Ga0068853_101060176
234 Ga0068854_101682117
235 Ga0068856_100202063
236 Ga0075366_10000391
237 Ga0075366_10140105
238 Ga0111539_10079682
239 Ga0111539_10881478
240 Ga0105242_10042536
241 Ga0105237_11349829
242 Ga0105239_10343109
243 Ga0157373_10675082
244 Ga0157374_10009986
245 Ga0157375_10107011
246 Ga0157377_10591102
247 Ga0207707_11531454
248 Ga0207662_10018444
249 Ga0207646_10727893
250 Ga0207690_10476170
251 Ga0207706_10085395
252 Ga0207706_10406524
253 Ga0207706_10664370
254 Ga0207702_10956233
255 Ga0207683_10322838
256 Ga0209974_10228908
257 Ga0207428_10059073
258 Ga0265336_10000584
259 Ga0265338_10454640
260 Ga0265324_10000018
261 Ga0265324_10001353
262 Ga0265324_10039556
263 Ga0265324_10048081
264 Ga0265332_10049861
265 Ga0265328_10036706
266 Ga0265328_10076476
267 Ga0265325_10000035
268 Ga0265325_10041218
269 Ga0265331_10000259
270 Ga0265331_10001923
271 Ga0265331_10003137
272 Ga0265331_10013855
273 Ga0265331_10022556
274 Ga0265331_10042424
275 Ga0265331_10260600
276 Ga0265327_10000250
277 Ga0265327_10000502
278 Ga0265327_10000595
279 Ga0265327_10003486
280 Ga0265327_10006387
281 Ga0265327_10011810
282 Ga0265327_10149414
283 Ga0265316_10149799
284 Ga0265316_10821113
285 Ga0316575_10000484
286 Ga0316575_10171292
287 Ga0316579_10052653
288 Ga0316579_10070293
289 Ga0265314_10005275
290 Ga0265314_10042586
291 Ga0316576_10005316
292 Ga0316576_10005400
293 Ga0316576_10026802
294 Ga0316576_10065614
295 Ga0316576_10118542
296 Ga0316578_10025148
297 Ga0316578_10030334
298 Ga0316578_10359780
299 Ga0316578_10835581
300 Ga0316577_10006165
301 Ga0316577_10626684
302 Ga0316585_10007973
303 Ga0316580_10197213
304 Ga0316580_10280145
305 Ga0316593_10015316
306 Ga0316593_10026342
307 Ga0316593_10034181
308 Ga0316593_10061875
309 Ga0316593_10166290
310 Ga0316593_10244064
311 Ga0316593_10257346
312 Ga0316593_10377805
313 Ga0316592_1003822
314 Ga0316592_1042819
315 Ga0316592_1082723
316 Ga0316587_1052193
317 Ga0316596_1000409
318 Ga0316596_1022701
319 Ga0316596_1028263
320 Ga0373952_0000274
321 Ga0373960_0227251
322 Ga0373942_0261603
323 Ga0316574_0072412
324 Ga0316574_0109189
325 Ga0316574_0711454
326 Ga0373927_0112682
327 Ga0373927_0207260
328 Ga0373927_0444510
329 Ga0316582_0003219
330 Ga0316582_0117910
331 Ga0316582_0152065
332 Ga0316582_0276386
333 Ga0316582_0626150
334 Ga0316584_0064058
335 Ga0316584_0209627
336 Ga0373925_1615264
337 Ga0395901_0757076
338 Ga0395901_0951425
339 Ga0400484_02771
340 Ga0400490_10504
341 Ga0439453_0057894
342 Ga0439465_0182925
343 Ga0451804_1039336
344 Ga0451577_0000002
345 Ga0451577_0000375
346 Ga0451577_0002837
347 Ga0451577_0025893
348 Ga0451577_0030220
349 Ga0451577_0278410
350 Ga0451577_0324443
351 Ga0451577_0499630
352 Ga0451577_1367477
353 Ga0453683_0000013
354 Ga0453683_0011398
355 Ga0453683_0023718
356 Ga0453683_0222939
357 Ga0453683_0785643
358 Ga0453684_0000002
359 Ga0453684_0000040
360 Ga0453684_0000158
361 Ga0453684_0007687
362 Ga0453684_0009190
363 Ga0453684_0036321
364 Ga0453684_0184280
365 Ga0453684_0518330
366 Ga0453684_0718248
367 Ga0453684_1011737
368 Ga0451576_0000006
369 Ga0451576_0000037
370 Ga0451576_0002657
371 Ga0451576_0006384
372 Ga0451576_0007349
373 Ga0451576_0037531
374 Ga0451576_0052478
375 Ga0451576_0124797
376 Ga0451576_0141239
377 Ga0451576_0161014
378 Ga0451576_0214779
379 Ga0451576_0303491
380 Ga0451576_0413350
381 Ga0451576_0484333
382 Ga0451576_0736488
383 Ga0451576_1034290
384 Ga0451576_1829258
385 Ga0496100_1146533
386 Ga0496106_0650988
387 Ga0496108_0193269
388 Ga0496108_0324257
389 Ga0496109_0029545
390 Ga0496109_0496972
391 Ga0496111_0818105
392 Ga0496113_0215359
393 Ga0496114_0010376
394 Ga0501290_102084
395 Ga0501322_017092
396 Ga0501031_0003706
397 Ga0501031_0015187
398 Ga0501032_0001904
399 Ga0501032_0008410
400 Ga0501032_0363768
401 Ga0501033_0001759
402 Ga0501033_0009375
403 Ga0501033_0011812
404 Ga0501034_0058586
405 Ga0501034_0478164
406 Ga0501036_0000762
407 Ga0501036_0005160
408 Ga0501036_0228138
409 Ga0501037_0007273
410 Ga0501037_0109507
411 Ga0501038_0003826
412 Ga0501038_0032977
413 Ga0501038_0045424
414 Ga0501038_0079558
415 Ga0501039_0213970
416 Ga0501040_0006337
417 Ga0501042_0027433
418 Ga0501043_0009404
419 Ga0501043_0041136
420 Ga0501043_0221775
421 Ga0501043_0825057
422 Ga0501046_0005770
423 Ga0501046_0024626
424 Ga0501047_0069125
425 Ga0501048_0015971
426 Ga0501068_0003033
427 Ga0501070_0223726
428 Ga0501072_0204410
429 Ga0501080_1547126
430 Ga0501280_007302
431 Ga0501035_0000444
432 Ga0501035_0013784
433 Ga0501035_0100765
434 Ga0501035_0112149
435 Ga0501044_0002682
436 Ga0501044_0004474
437 Ga0501044_0044560
438 Ga0501045_0017199
439 nmdc:mga0k408_5496_c1
440 nmdc:mga0qj67_292372_c1
441 nmdc:mga08y16_282868_c1
442 nmdc:mga0n895_338810_c1
443 Ga0500622_0000019
444 Ga0501082_0393169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

93

138

0.96

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

9

89

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nl9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo state 3 0.9495 4 78
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9439 9 80
7nk9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo domain state 1 0.9373 20 78
6ree-assembly1.cif.gz_R cryo-em structure of polytomella f-atp synthase, rotary substate 3b, composite map 0.9262 3 85
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9227 4 87
ID Description Score Start End Superfamily
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9763 2 87 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9707 2 88 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9678 25 87 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9656 1 88 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9544 1 87 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A2N3PL22-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9864 1 85 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-C5EXD6-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.986 1 85 GO:0005524
GO:0005886
GO:0012505
GO:0016787
GO:0045261
GO:0046933
AF-A0A7Y6A622-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9847 2 87 GO:0005886
GO:0045261
GO:0046933
AF-A0A843Y9S7-F1-model_v4 deleted 0.9847 3 85
AF-A0A3C0LYM2-F1-model_v4 deleted 0.9846 3 88

Map