F340156

General Info

Members Datasets Scaffolds Average Seq Length
227 175 454 179

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0023496|Ga0395899_0023496_1419_1964
Length 181
Sequence MAGIVTAVSRSAGHTFTKPNESLIRLVAGLGVEGDAHHGTLDQHCSHIRKNPAGQPNLRQVHLIGAELHEELQAAGYAVSAGTIGENVTTRGIDLLTLPSGTRLHLGATAVIEITGLRTPCRQLDRFHEGLKTTLMPRDADGNFVRRAGVMSIVLTDGEVRPGDPIRVELPPEPHRPLEPV

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
168 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
171 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
172 2891562705 Microbispora tritici MT50 Isolate Unclassified
173 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
174 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
175 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 2.2
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 0.44
Rhizoplane 2.2
Rhizosphere 80.18
Stem 0
Stem Tuber 0
Unclassified 3.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0023496 3300037312 Bacteria 4668
2 rootH1_10103342 3300003323 Bacteria 13039
3 Ga0058863_11567609 3300004799 Bacteria 590
4 Ga0070660_100441142 3300005339 Bacteria 1079
5 Ga0070691_10577551 3300005341 Unclassified 660
6 Ga0070671_100017289 3300005355 Bacteria 5840
7 Ga0070674_100465719 3300005356 Bacteria 1046
8 Ga0070714_101809151 3300005435 Bacteria 596
9 Ga0070711_100648787 3300005439 Bacteria 885
10 Ga0070663_101363111 3300005455 Bacteria 627
11 Ga0070662_100000099 3300005457 Bacteria 47948
12 Ga0070681_10018510 3300005458 Bacteria 6962
13 Ga0070681_10997080 3300005458 Unclassified 757
14 Ga0070699_100200143 3300005518 Bacteria 1776
15 Ga0070679_100025874 3300005530 Bacteria 5758
16 Ga0070679_100085887 3300005530 Bacteria 3133
17 Ga0070679_100149367 3300005530 Bacteria 2314
18 Ga0070679_100466909 3300005530 Bacteria 1207
19 Ga0070697_100013902 3300005536 Bacteria 6318
20 Ga0068853_100402755 3300005539 Bacteria 1281
21 Ga0070704_100275193 3300005549 Bacteria 1392
22 Ga0068855_100657375 3300005563 Bacteria 1125
23 Ga0068855_100827073 3300005563 Bacteria 983
24 Ga0068857_101015219 3300005577 Bacteria 799
25 Ga0068852_100059287 3300005616 Bacteria 3319
26 Ga0068859_100111092 3300005617 Bacteria 2803
27 Ga0068859_100824367 3300005617 Bacteria 1014
28 Ga0068859_101694876 3300005617 Bacteria 698
29 Ga0068863_100170271 3300005841 Bacteria 2089
30 Ga0068863_100679559 3300005841 Bacteria 1022
31 Ga0068858_100000082 3300005842 Bacteria 99205
32 Ga0068860_100225443 3300005843 Bacteria 1820
33 Ga0068862_100129541 3300005844 Bacteria 2230
34 Ga0075362_10210535 3300006177 Bacteria 948
35 Ga0075367_10054180 3300006178 Bacteria 2378
36 Ga0075367_10085459 3300006178 Bacteria 1914
37 Ga0097621_100601996 3300006237 Bacteria 1005
38 Ga0068871_100556774 3300006358 Bacteria 1039
39 Ga0075428_100012193 3300006844 Bacteria 9558
40 Ga0075428_100111804 3300006844 Bacteria 2976
41 Ga0075428_100247947 3300006844 Bacteria 1920
42 Ga0075430_100066346 3300006846 Bacteria 3031
43 Ga0075430_100107613 3300006846 Bacteria 2326
44 Ga0075430_100429759 3300006846 Bacteria 1090
45 Ga0075431_100048722 3300006847 Bacteria 4369
46 Ga0075431_100139357 3300006847 Bacteria 2501
47 Ga0075429_100082208 3300006880 Bacteria 2807
48 Ga0097620_100111090 3300006931 Bacteria 2803
49 Ga0097620_100824399 3300006931 Bacteria 1014
50 Ga0097620_101694837 3300006931 Bacteria 698
51 Ga0099794_10124610 3300007265 Bacteria 1298
52 Ga0099795_10097174 3300007788 Bacteria 1150
53 Ga0099795_10124827 3300007788 Bacteria 1033
54 Ga0111539_10220164 3300009094 Bacteria 2211
55 Ga0111539_10535549 3300009094 Bacteria 1364
56 Ga0105245_10085432 3300009098 Bacteria 2892
57 Ga0105247_10010767 3300009101 Bacteria 5524
58 Ga0105247_10012729 3300009101 Bacteria 5049
59 Ga0105248_10694685 3300009177 Bacteria 1148
60 Ga0105237_10056842 3300009545 Bacteria 3915
61 Ga0105249_10966109 3300009553 Bacteria 920
62 Ga0099796_10051212 3300010159 Bacteria 1434
63 Ga0105239_11594994 3300010375 Bacteria 755
64 Ga0157370_10332140 3300013104 Bacteria 1402
65 Ga0157378_10383410 3300013297 Bacteria 1381
66 Ga0157375_10458037 3300013308 Bacteria 1441
67 Ga0182008_10194656 3300014497 Bacteria 1030
68 Ga0157379_10006252 3300014968 Bacteria 10252
69 Ga0157379_10816679 3300014968 Bacteria 881
70 Ga0206350_10236122 3300020080 Bacteria 1016
71 Ga0206354_11125564 3300020081 Bacteria 677
72 Ga0224712_10106455 3300022467 Bacteria 1197
73 Ga0224712_10254317 3300022467 Unclassified 812
74 Ga0209758_1001988 3300025297 Bacteria 22050
75 Ga0207710_10000012 3300025900 Bacteria 409603
76 Ga0207647_10184143 3300025904 Bacteria 1212
77 Ga0207707_10374499 3300025912 Bacteria 1225
78 Ga0207707_10847204 3300025912 Unclassified 759
79 Ga0207671_10040207 3300025914 Bacteria 3462
80 Ga0207671_10072718 3300025914 Bacteria 2567
81 Ga0207663_10505348 3300025916 Bacteria 939
82 Ga0207660_10036168 3300025917 Unclassified 3432
83 Ga0207662_10301803 3300025918 Bacteria 1065
84 Ga0207657_10015386 3300025919 Bacteria 7411
85 Ga0207652_10039186 3300025921 Unclassified 4021
86 Ga0207659_10161615 3300025926 Bacteria 1759
87 Ga0207687_10112485 3300025927 Unclassified 2023
88 Ga0207644_10027025 3300025931 Bacteria 3962
89 Ga0207706_10000436 3300025933 Bacteria 44676
90 Ga0207670_10194875 3300025936 Bacteria 1535
91 Ga0207712_10116959 3300025961 Bacteria 2010
92 Ga0207703_10000029 3300026035 Bacteria 199952
93 Ga0207703_10986893 3300026035 Bacteria 808
94 Ga0207639_10083473 3300026041 Bacteria 2536
95 Ga0207674_10138276 3300026116 Bacteria 2397
96 Ga0209588_1061542 3300027671 Bacteria 1213
97 Ga0268264_10563350 3300028381 Bacteria 1119
98 Ga0265325_10137416 3300031241 Bacteria 1165
99 Ga0265316_10154387 3300031344 Bacteria 1718
100 Ga0265316_10406382 3300031344 Bacteria 980
101 Ga0307509_10021646 3300031507 Bacteria 7264
102 Ga0265313_10107305 3300031595 Bacteria 1232
103 Ga0265314_10013404 3300031711 Bacteria 6622
104 Ga0316576_10016534 3300031727 Bacteria 4986
105 Ga0307405_10296491 3300031731 Bacteria 1224
106 Ga0316577_10080560 3300031733 Bacteria 1820
107 Ga0307411_10594501 3300032005 Bacteria 951
108 Ga0307507_10012662 3300033179 Bacteria 10388
109 Ga0307507_10048074 3300033179 Bacteria 4156
110 Ga0373923_0165938 3300035111 Bacteria 1009
111 Ga0373953_0061391 3300035117 Bacteria 1537
112 Ga0373955_0384008 3300035172 Bacteria 852
113 Ga0373924_0090694 3300035410 Bacteria 1307
114 Ga0373935_0066275 3300035692 Bacteria 2319
115 Ga0373927_0576941 3300035695 Bacteria 743
116 Ga0373933_0125409 3300035724 Bacteria 1611
117 Ga0373937_0002075 3300036401 Bacteria 16763
118 Ga0373937_0214388 3300036401 Bacteria 1812
119 Ga0373937_0782108 3300036401 Bacteria 902
120 Ga0373925_0022895 3300037068 Bacteria 4559
121 Ga0373925_0313192 3300037068 Bacteria 1269
122 Ga0395899_0003055 3300037312 Bacteria 13364
123 Ga0395899_0250513 3300037312 Bacteria 1215
124 Ga0395900_0064928 3300037418 Bacteria 3749
125 Ga0395898_0144567 3300037466 Bacteria 2276
126 Ga0395905_0085652 3300037471 Bacteria 2952
127 Ga0436364_0935971 3300037853 Bacteria 1835
128 Ga0395901_0049439 3300038443 Bacteria 4368
129 Ga0436365_0263078 3300039437 Bacteria 1697
130 Ga0436360_0854679 3300039438 Bacteria 1803
131 Ga0436360_1229505 3300039438 Bacteria 2697
132 Ga0436361_0026476 3300039447 Bacteria 2109
133 Ga0436361_0038661 3300039447 Bacteria 932
134 Ga0436361_1019927 3300039447 Bacteria 1478
135 Ga0436362_0336560 3300039453 Bacteria 2011
136 Ga0451791_0258125 3300041451 Bacteria 867
137 Ga0466972_0011585 3300044658 Bacteria 4428
138 Ga0453683_0000448 3300044673 Bacteria 47323
139 Ga0466965_0001305 3300044683 Bacteria 9950
140 Ga0466963_0179347 3300044694 Bacteria 1478
141 Ga0466968_0011540 3300044735 Bacteria 3444
142 Ga0451576_0002465 3300045051 Bacteria 27543
143 Ga0451576_0388103 3300045051 Bacteria 1464
144 Ga0495584_0183910 3300046491 Bacteria 1062
145 Ga0495585_0058614 3300046492 Bacteria 2124
146 Ga0495607_0291401 3300046501 Bacteria 771
147 Ga0495640_0174049 3300046533 Bacteria 1374
148 Ga0495586_0073315 3300046535 Bacteria 1873
149 Ga0495658_0464838 3300046683 Bacteria 809
150 Ga0495600_0779584 3300046809 Bacteria 571
151 Ga0495680_0360079 3300047322 Bacteria 1011
152 Ga0496104_0420092 3300048907 Bacteria 1249
153 Ga0496107_0590312 3300048910 Bacteria 821
154 Ga0496108_1436788 3300048911 Bacteria 576
155 Ga0496115_0000409 3300048918 Bacteria 35229
156 Ga0496117_0038443 3300048920 Bacteria 3548
157 Ga0496117_0240913 3300048920 Bacteria 993
158 Ga0496118_0044521 3300048921 Bacteria 3475
159 Ga0496118_0067945 3300048921 Bacteria 2591
160 Ga0496119_0014684 3300048922 Bacteria 6102
161 Ga0496121_0017132 3300048924 Bacteria 7422
162 Ga0496121_0040867 3300048924 Bacteria 4062
163 Ga0496123_0001068 3300048926 Bacteria 41396
164 Ga0496124_0626066 3300048927 Bacteria 695
165 Ga0496126_0272478 3300048929 Bacteria 1404
166 Ga0495682_0122761 3300049460 Bacteria 930
167 Ga0501031_0049420 3300049568 Bacteria 2741
168 Ga0501032_0000046 3300049569 Bacteria 109405
169 Ga0501033_0007141 3300049570 Bacteria 8716
170 Ga0501033_0428376 3300049570 Bacteria 921
171 Ga0501034_0043583 3300049571 Bacteria 4540
172 Ga0501034_0208195 3300049571 Unclassified 1912
173 Ga0501036_0000326 3300049572 Bacteria 33146
174 Ga0501037_0000309 3300049573 Bacteria 41492
175 Ga0501038_0000026 3300049574 Bacteria 146493
176 Ga0501039_0000121 3300049575 Bacteria 54152
177 Ga0501043_0000135 3300049579 Bacteria 68762
178 Ga0501046_0062285 3300049580 Bacteria 2915
179 Ga0501047_0000101 3300049581 Bacteria 104950
180 Ga0501047_0530063 3300049581 Bacteria 1003
181 Ga0501048_0051791 3300049582 Bacteria 2921
182 Ga0501067_0011387 3300049583 Bacteria 4925
183 Ga0501070_0026453 3300049586 Bacteria 4866
184 Ga0501071_0106801 3300049587 Bacteria 2067
185 Ga0501071_0145580 3300049587 Bacteria 1766
186 Ga0501073_0380869 3300049589 Bacteria 974
187 Ga0501074_0010958 3300049590 Bacteria 6582
188 Ga0501080_0000121 3300049742 Bacteria 54804
189 Ga0501035_0000588 3300049822 Bacteria 40021
190 Ga0501044_0003949 3300049823 Bacteria 16609
191 Ga0501044_0155441 3300049823 Bacteria 2267
192 Ga0501044_0411967 3300049823 Bacteria 1263
193 Ga0501044_0471884 3300049823 Unclassified 1159
194 Ga0501045_0117525 3300049824 Bacteria 1974
195 nmdc:mga06z11_64722_c1 3300050494 Bacteria 1917
196 nmdc:mga05p37_122549_c1 3300050507 Bacteria 3193
197 nmdc:mga05p37_36676_c1 3300050507 Bacteria 6013
198 nmdc:mga09592_18835_c1 3300050508 Bacteria 5664
199 nmdc:mga0qj67_5771_c1 3300050509 Bacteria 9062
200 nmdc:mga0qj67_987981_c1 3300050509 Bacteria 661
201 nmdc:mga06r32_261878_c1 3300050510 Bacteria 1717
202 nmdc:mga06r32_778183_c1 3300050510 Bacteria 919
203 nmdc:mga06r32_900751_c1 3300050510 Bacteria 841
204 nmdc:mga08y16_1750475_c1 3300050511 Bacteria 576
205 nmdc:mga08y16_72092_c1 3300050511 Bacteria 3599
206 Ga0495601_0070800 3300053077 Bacteria 2226
207 Ga0495619_0007111 3300053085 Bacteria 7086
208 Ga0500647_0144511 3300053091 Bacteria 1114
209 Ga0500651_0235294 3300053093 Bacteria 1070
210 Ga0500562_004460 3300053108 Bacteria 3540
211 Ga0500608_068335 3300053122 Bacteria 1692
212 Ga0500559_0011691 3300053136 Bacteria 3744
213 Ga0500559_0035510 3300053136 Bacteria 2153
214 Ga0500564_188113 3300053138 Bacteria 856
215 Ga0500573_0008076 3300053140 Bacteria 5785
216 Ga0500590_230831 3300053148 Bacteria 754
217 Ga0500616_0105977 3300053153 Bacteria 1366
218 Ga0500638_220891 3300053162 Bacteria 786
219 Ga0500636_0114342 3300053177 Bacteria 1520
220 Ga0500636_0205063 3300053177 Bacteria 1039
221 Ga0501082_0435739 3300060353 Bacteria 1145
222 2513593386 2513237087 Bacteria 5817514
223 2856744566 2856741275 Bacteria 8096094
224 2891566002 2891562705 Bacteria 8039471
225 2925326740 2925326138 Bacteria 9652120
226 2980188533 2980182181 Bacteria 9454109
227 8047716526 8047710418 Bacteria 11023148
228 Ga0395899_0023496
229 rootH1_10103342
230 Ga0058863_11567609
231 Ga0070660_100441142
232 Ga0070691_10577551
233 Ga0070671_100017289
234 Ga0070674_100465719
235 Ga0070714_101809151
236 Ga0070711_100648787
237 Ga0070663_101363111
238 Ga0070662_100000099
239 Ga0070681_10018510
240 Ga0070681_10997080
241 Ga0070699_100200143
242 Ga0070679_100025874
243 Ga0070679_100085887
244 Ga0070679_100149367
245 Ga0070679_100466909
246 Ga0070697_100013902
247 Ga0068853_100402755
248 Ga0070704_100275193
249 Ga0068855_100657375
250 Ga0068855_100827073
251 Ga0068857_101015219
252 Ga0068852_100059287
253 Ga0068859_100111092
254 Ga0068859_100824367
255 Ga0068859_101694876
256 Ga0068863_100170271
257 Ga0068863_100679559
258 Ga0068858_100000082
259 Ga0068860_100225443
260 Ga0068862_100129541
261 Ga0075362_10210535
262 Ga0075367_10054180
263 Ga0075367_10085459
264 Ga0097621_100601996
265 Ga0068871_100556774
266 Ga0075428_100012193
267 Ga0075428_100111804
268 Ga0075428_100247947
269 Ga0075430_100066346
270 Ga0075430_100107613
271 Ga0075430_100429759
272 Ga0075431_100048722
273 Ga0075431_100139357
274 Ga0075429_100082208
275 Ga0097620_100111090
276 Ga0097620_100824399
277 Ga0097620_101694837
278 Ga0099794_10124610
279 Ga0099795_10097174
280 Ga0099795_10124827
281 Ga0111539_10220164
282 Ga0111539_10535549
283 Ga0105245_10085432
284 Ga0105247_10010767
285 Ga0105247_10012729
286 Ga0105248_10694685
287 Ga0105237_10056842
288 Ga0105249_10966109
289 Ga0099796_10051212
290 Ga0105239_11594994
291 Ga0157370_10332140
292 Ga0157378_10383410
293 Ga0157375_10458037
294 Ga0182008_10194656
295 Ga0157379_10006252
296 Ga0157379_10816679
297 Ga0206350_10236122
298 Ga0206354_11125564
299 Ga0224712_10106455
300 Ga0224712_10254317
301 Ga0209758_1001988
302 Ga0207710_10000012
303 Ga0207647_10184143
304 Ga0207707_10374499
305 Ga0207707_10847204
306 Ga0207671_10040207
307 Ga0207671_10072718
308 Ga0207663_10505348
309 Ga0207660_10036168
310 Ga0207662_10301803
311 Ga0207657_10015386
312 Ga0207652_10039186
313 Ga0207659_10161615
314 Ga0207687_10112485
315 Ga0207644_10027025
316 Ga0207706_10000436
317 Ga0207670_10194875
318 Ga0207712_10116959
319 Ga0207703_10000029
320 Ga0207703_10986893
321 Ga0207639_10083473
322 Ga0207674_10138276
323 Ga0209588_1061542
324 Ga0268264_10563350
325 Ga0265325_10137416
326 Ga0265316_10154387
327 Ga0265316_10406382
328 Ga0307509_10021646
329 Ga0265313_10107305
330 Ga0265314_10013404
331 Ga0316576_10016534
332 Ga0307405_10296491
333 Ga0316577_10080560
334 Ga0307411_10594501
335 Ga0307507_10012662
336 Ga0307507_10048074
337 Ga0373923_0165938
338 Ga0373953_0061391
339 Ga0373955_0384008
340 Ga0373924_0090694
341 Ga0373935_0066275
342 Ga0373927_0576941
343 Ga0373933_0125409
344 Ga0373937_0002075
345 Ga0373937_0214388
346 Ga0373937_0782108
347 Ga0373925_0022895
348 Ga0373925_0313192
349 Ga0395899_0003055
350 Ga0395899_0250513
351 Ga0395900_0064928
352 Ga0395898_0144567
353 Ga0395905_0085652
354 Ga0436364_0935971
355 Ga0395901_0049439
356 Ga0436365_0263078
357 Ga0436360_0854679
358 Ga0436360_1229505
359 Ga0436361_0026476
360 Ga0436361_0038661
361 Ga0436361_1019927
362 Ga0436362_0336560
363 Ga0451791_0258125
364 Ga0466972_0011585
365 Ga0453683_0000448
366 Ga0466965_0001305
367 Ga0466963_0179347
368 Ga0466968_0011540
369 Ga0451576_0002465
370 Ga0451576_0388103
371 Ga0495584_0183910
372 Ga0495585_0058614
373 Ga0495607_0291401
374 Ga0495640_0174049
375 Ga0495586_0073315
376 Ga0495658_0464838
377 Ga0495600_0779584
378 Ga0495680_0360079
379 Ga0496104_0420092
380 Ga0496107_0590312
381 Ga0496108_1436788
382 Ga0496115_0000409
383 Ga0496117_0038443
384 Ga0496117_0240913
385 Ga0496118_0044521
386 Ga0496118_0067945
387 Ga0496119_0014684
388 Ga0496121_0017132
389 Ga0496121_0040867
390 Ga0496123_0001068
391 Ga0496124_0626066
392 Ga0496126_0272478
393 Ga0495682_0122761
394 Ga0501031_0049420
395 Ga0501032_0000046
396 Ga0501033_0007141
397 Ga0501033_0428376
398 Ga0501034_0043583
399 Ga0501034_0208195
400 Ga0501036_0000326
401 Ga0501037_0000309
402 Ga0501038_0000026
403 Ga0501039_0000121
404 Ga0501043_0000135
405 Ga0501046_0062285
406 Ga0501047_0000101
407 Ga0501047_0530063
408 Ga0501048_0051791
409 Ga0501067_0011387
410 Ga0501070_0026453
411 Ga0501071_0106801
412 Ga0501071_0145580
413 Ga0501073_0380869
414 Ga0501074_0010958
415 Ga0501080_0000121
416 Ga0501035_0000588
417 Ga0501044_0003949
418 Ga0501044_0155441
419 Ga0501044_0411967
420 Ga0501044_0471884
421 Ga0501045_0117525
422 nmdc:mga06z11_64722_c1
423 nmdc:mga05p37_122549_c1
424 nmdc:mga05p37_36676_c1
425 nmdc:mga09592_18835_c1
426 nmdc:mga0qj67_5771_c1
427 nmdc:mga0qj67_987981_c1
428 nmdc:mga06r32_261878_c1
429 nmdc:mga06r32_778183_c1
430 nmdc:mga06r32_900751_c1
431 nmdc:mga08y16_1750475_c1
432 nmdc:mga08y16_72092_c1
433 Ga0495601_0070800
434 Ga0495619_0007111
435 Ga0500647_0144511
436 Ga0500651_0235294
437 Ga0500562_004460
438 Ga0500608_068335
439 Ga0500559_0011691
440 Ga0500559_0035510
441 Ga0500564_188113
442 Ga0500573_0008076
443 Ga0500590_230831
444 Ga0500616_0105977
445 Ga0500638_220891
446 Ga0500636_0114342
447 Ga0500636_0205063
448 Ga0501082_0435739
449 2513593386
450 2856744566
451 2891566002
452 2925326740
453 2980188533
454 8047716526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

35

167

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vgg-assembly1.cif.gz_D human erythrocyte pyruvate kinase: r479h mutant 0.789 84 167
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.7862 1 167
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.7839 4 168
6su2-assembly1.cif.gz_A trypanosoma congolense pyruvate kinase in complex with citrate and glycerol 0.7821 84 167
1o67-assembly3.cif.gz_C crystal structure of an hypothetical protein 0.7784 1 170
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7634 1 171 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.759 4 175 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7442 3 176 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7394 1 171 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7355 58 166 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A8A9AWL9-F1-model_v4 deleted 0.9993 3 180
AF-A0A387HRZ8-F1-model_v4 MOSC domain-containing protein 0.9987 2 180 GO:0003824
GO:0030151
GO:0030170
AF-A0A4Q3P7J3-F1-model_v4 deleted 0.9983 3 115
AF-A0A848NLI4-F1-model_v4 MOSC domain-containing protein 0.9976 3 119 GO:0003824
GO:0030151
GO:0030170
AF-A0A327U1J2-F1-model_v4 MOSC domain-containing protein YiiM 0.9973 1 180 GO:0003824
GO:0030151
GO:0030170

Map