F339947

General Info

Members Datasets Scaffolds Average Seq Length
227 140 454 134

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10187738|Ga0157380_101877383
Length 154
Sequence MIGKAKPFRTVRRQSRYLVSPQMPFTFINPETLGAPRGYANGVLTESGGRLLFIAGQIGWDQRQQIVSNDFVAQFDQALANVIAVVKAAGGKSEQIARLVIYVTDKPEYKVRTREVGERYRAHMGKHFPAMALVEVKSLLDDRAKVEIEGIAVL

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
117 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 25.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10187738 3300014326 Bacteria 1822
2 SwRhRL2b_contig_1690722 2162886007 Bacteria 871
3 Ga0065704_10096432 3300005289 Bacteria 2442
4 Ga0065712_10463986 3300005290 Unclassified 676
5 Ga0065715_10171230 3300005293 Bacteria 1545
6 Ga0065715_10251217 3300005293 Unclassified 1166
7 Ga0065707_10004038 3300005295 Bacteria 3396
8 Ga0065707_10097033 3300005295 Bacteria 3207
9 Ga0065707_10162325 3300005295 Unclassified 1547
10 Ga0065707_10191412 3300005295 Unclassified 1359
11 Ga0070690_100801230 3300005330 Bacteria 731
12 Ga0070670_100000413 3300005331 Bacteria 35230
13 Ga0068869_100024509 3300005334 Bacteria 4178
14 Ga0068869_100027918 3300005334 Bacteria 3939
15 Ga0070680_100848178 3300005336 Unclassified 788
16 Ga0070682_100000027 3300005337 Bacteria 188799
17 Ga0070689_100010625 3300005340 Bacteria 6565
18 Ga0070689_101122014 3300005340 Unclassified 703
19 Ga0070687_100036834 3300005343 Bacteria 2441
20 Ga0070692_10140823 3300005345 Bacteria 1365
21 Ga0070668_100027025 3300005347 Bacteria 4356
22 Ga0070669_100002495 3300005353 Bacteria 13325
23 Ga0070669_100338258 3300005353 Unclassified 1219
24 Ga0070675_100578696 3300005354 Bacteria 1017
25 Ga0070675_100992313 3300005354 Unclassified 771
26 Ga0070675_101241503 3300005354 Bacteria 686
27 Ga0070671_101019743 3300005355 Unclassified 725
28 Ga0070688_100225777 3300005365 Bacteria 1322
29 Ga0070688_101175353 3300005365 Bacteria 616
30 Ga0070701_10088024 3300005438 Bacteria 1695
31 Ga0070700_100034326 3300005441 Bacteria 3063
32 Ga0070700_100834047 3300005441 Unclassified 745
33 Ga0070694_100069353 3300005444 Bacteria 2425
34 Ga0070694_100106490 3300005444 Bacteria 1991
35 Ga0070694_100209194 3300005444 Bacteria 1458
36 Ga0070694_100809647 3300005444 Bacteria 769
37 Ga0070694_101274045 3300005444 Bacteria 618
38 Ga0070708_100163607 3300005445 Bacteria 2074
39 Ga0070708_100370301 3300005445 Bacteria 1350
40 Ga0070662_100134411 3300005457 Bacteria 1911
41 Ga0070706_100042512 3300005467 Bacteria 4199
42 Ga0070706_100752882 3300005467 Bacteria 902
43 Ga0070707_100000452 3300005468 Bacteria 40667
44 Ga0070707_100028205 3300005468 Bacteria 5340
45 Ga0070698_100014091 3300005471 Bacteria 8454
46 Ga0070698_100058719 3300005471 Bacteria 3889
47 Ga0070698_100323623 3300005471 Bacteria 1473
48 Ga0070698_100396127 3300005471 Unclassified 1314
49 Ga0070699_100007923 3300005518 Bacteria 9226
50 Ga0070699_100438302 3300005518 Bacteria 1184
51 Ga0070697_100001825 3300005536 Bacteria 16277
52 Ga0070697_100067440 3300005536 Bacteria 2927
53 Ga0070697_100185105 3300005536 Unclassified 1766
54 Ga0070697_100406694 3300005536 Bacteria 1182
55 Ga0070697_100900277 3300005536 Bacteria 785
56 Ga0070686_100003517 3300005544 Bacteria 8589
57 Ga0070695_100089006 3300005545 Bacteria 2057
58 Ga0070695_100108300 3300005545 Unclassified 1881
59 Ga0070695_100338782 3300005545 Unclassified 1123
60 Ga0070695_100459373 3300005545 Bacteria 977
61 Ga0070695_100645756 3300005545 Bacteria 835
62 Ga0070695_100761768 3300005545 Unclassified 773
63 Ga0070696_100230401 3300005546 Bacteria 1393
64 Ga0070696_101729182 3300005546 Unclassified 539
65 Ga0070704_100007720 3300005549 Bacteria 6413
66 Ga0070704_100093313 3300005549 Unclassified 2249
67 Ga0070704_100113057 3300005549 Bacteria 2070
68 Ga0070704_100269955 3300005549 Bacteria 1405
69 Ga0070664_100574489 3300005564 Unclassified 1044
70 Ga0070664_100745102 3300005564 Unclassified 914
71 Ga0068857_100280437 3300005577 Unclassified 1533
72 Ga0070702_100796835 3300005615 Bacteria 730
73 Ga0070702_100932052 3300005615 Unclassified 682
74 Ga0068859_100028539 3300005617 Bacteria 5595
75 Ga0068864_100187777 3300005618 Bacteria 1893
76 Ga0068864_100261467 3300005618 Unclassified 1610
77 Ga0068864_100718553 3300005618 Unclassified 977
78 Ga0068866_10095941 3300005718 Bacteria 1625
79 Ga0068861_100062135 3300005719 Bacteria 2868
80 Ga0068861_100289853 3300005719 Bacteria 1413
81 Ga0068861_100587484 3300005719 Unclassified 1020
82 Ga0068861_101669709 3300005719 Unclassified 629
83 Ga0068863_100182389 3300005841 Bacteria 2015
84 Ga0068860_100204128 3300005843 Bacteria 1916
85 Ga0068862_100027399 3300005844 Plasmid 4796
86 Ga0081455_10399188 3300005937 Bacteria 955
87 Ga0081540_1015996 3300005983 Bacteria 4723
88 Ga0097621_102063515 3300006237 Unclassified 545
89 Ga0068871_102206979 3300006358 Unclassified 525
90 Ga0075428_100049390 3300006844 Bacteria 4616
91 Ga0075430_100117903 3300006846 Bacteria 2212
92 Ga0075431_100058068 3300006847 Bacteria 3991
93 Ga0075434_100702374 3300006871 Archaea 1029
94 Ga0075429_101110217 3300006880 Bacteria 691
95 Ga0097620_100028539 3300006931 Bacteria 5595
96 Ga0075435_100000717 3300007076 Bacteria 20581
97 Ga0099794_10015722 3300007265 Unclassified 3345
98 Ga0105240_10642072 3300009093 Bacteria 1164
99 Ga0105240_10831033 3300009093 Unclassified 999
100 Ga0111539_10082100 3300009094 Bacteria 3791
101 Ga0111539_10131221 3300009094 Unclassified 2934
102 Ga0111539_10519625 3300009094 Bacteria 1387
103 Ga0105245_10328767 3300009098 Bacteria 1508
104 Ga0105245_10828545 3300009098 Bacteria 964
105 Ga0114129_10003615 3300009147 Bacteria 21747
106 Ga0114129_10009289 3300009147 Bacteria 14022
107 Ga0114129_10462664 3300009147 Bacteria 1662
108 Ga0114129_11195631 3300009147 Bacteria 947
109 Ga0105243_10047688 3300009148 Unclassified 3374
110 Ga0105243_10417220 3300009148 Bacteria 1251
111 Ga0105243_10494563 3300009148 Bacteria 1157
112 Ga0105243_10872269 3300009148 Bacteria 893
113 Ga0105243_12193421 3300009148 Unclassified 589
114 Ga0105243_12371266 3300009148 Bacteria 569
115 Ga0105241_10686521 3300009174 Unclassified 933
116 Ga0105241_12116027 3300009174 Unclassified 556
117 Ga0105242_10354153 3300009176 Bacteria 1357
118 Ga0105242_11328667 3300009176 Bacteria 744
119 Ga0105248_12102141 3300009177 Bacteria 642
120 Ga0105249_10000003 3300009553 Bacteria 370855
121 Ga0105249_10011935 3300009553 Bacteria 7642
122 Ga0099796_10403028 3300010159 Unclassified 600
123 Ga0105246_10043449 3300011119 Bacteria 3049
124 Ga0105246_11582713 3300011119 Bacteria 619
125 Ga0157374_11158717 3300013296 Unclassified 794
126 Ga0157378_10213764 3300013297 Bacteria 1830
127 Ga0157378_10254089 3300013297 Bacteria 1684
128 Ga0157378_11152209 3300013297 Bacteria 814
129 Ga0157378_12352594 3300013297 Unclassified 584
130 Ga0163162_10000033 3300013306 Bacteria 150185
131 Ga0163162_10094578 3300013306 Bacteria 3074
132 Ga0157375_10073170 3300013308 Bacteria 3446
133 Ga0157375_10222015 3300013308 Bacteria 2048
134 Ga0157375_11845894 3300013308 Unclassified 717
135 Ga0157375_11947611 3300013308 Unclassified 698
136 Ga0163163_10023043 3300014325 Bacteria 5904
137 Ga0157380_10083269 3300014326 Bacteria 2620
138 Ga0157380_10117976 3300014326 Bacteria 2242
139 Ga0157377_10502406 3300014745 Bacteria 848
140 Ga0213876_10083378 3300021384 Bacteria 1691
141 Ga0207653_10210362 3300025885 Unclassified 736
142 Ga0207645_10239483 3300025907 Unclassified 1199
143 Ga0207684_10009230 3300025910 Bacteria 8716
144 Ga0207684_10073174 3300025910 Unclassified 2910
145 Ga0207684_10128192 3300025910 Bacteria 2178
146 Ga0207684_10265603 3300025910 Bacteria 1481
147 Ga0207695_10472052 3300025913 Bacteria 1137
148 Ga0207662_10325709 3300025918 Bacteria 1026
149 Ga0207662_10521438 3300025918 Bacteria 820
150 Ga0207646_10000798 3300025922 Bacteria 41005
151 Ga0207646_10008901 3300025922 Bacteria 9999
152 Ga0207646_10107115 3300025922 Bacteria 2507
153 Ga0207681_10005479 3300025923 Bacteria 7795
154 Ga0207650_10000304 3300025925 Bacteria 48674
155 Ga0207659_10453887 3300025926 Bacteria 1080
156 Ga0207687_10481697 3300025927 Unclassified 1033
157 Ga0207644_10903942 3300025931 Unclassified 740
158 Ga0207706_10812493 3300025933 Bacteria 794
159 Ga0207709_10660952 3300025935 Bacteria 833
160 Ga0207670_10320593 3300025936 Bacteria 1219
161 Ga0207711_10529584 3300025941 Bacteria 1099
162 Ga0207689_10001120 3300025942 Bacteria 25840
163 Ga0207689_10164040 3300025942 Bacteria 1831
164 Ga0207689_10602239 3300025942 Unclassified 924
165 Ga0207712_10000060 3300025961 Bacteria 136248
166 Ga0207712_10192226 3300025961 Bacteria 1612
167 Ga0207668_10017714 3300025972 Bacteria 4469
168 Ga0207708_10008599 3300026075 Bacteria 7555
169 Ga0207708_10564614 3300026075 Unclassified 961
170 Ga0207641_10065418 3300026088 Bacteria 3110
171 Ga0207674_10205826 3300026116 Unclassified 1917
172 Ga0207675_100182689 3300026118 Bacteria 2009
173 Ga0209974_10179667 3300027876 Unclassified 774
174 Ga0207428_10023248 3300027907 Bacteria 5215
175 Ga0207428_10696301 3300027907 Unclassified 727
176 Ga0207428_10726784 3300027907 Bacteria 709
177 Ga0268265_10024604 3300028380 Unclassified 4262
178 Ga0268264_10343872 3300028381 Bacteria 1418
179 Ga0316575_10049500 3300031665 Bacteria 1672
180 Ga0307412_10638148 3300031911 Bacteria 907
181 Ga0307416_100225436 3300032002 Bacteria 1802
182 Ga0373939_0187308 3300035114 Unclassified 775
183 Ga0395900_0946122 3300037418 Bacteria 783
184 Ga0395898_0266167 3300037466 Bacteria 1635
185 Ga0395901_0839123 3300038443 Bacteria 905
186 Ga0436365_1809606 3300039437 Bacteria 3050
187 Ga0439436_0191619 3300041404 Bacteria 583
188 Ga0439460_0084996 3300042461 Bacteria 998
189 Ga0451577_0005002 3300042876 Bacteria 13737
190 Ga0451577_0351386 3300042876 Bacteria 1337
191 Ga0466963_0000255 3300044694 Bacteria 23380
192 Ga0466957_0149325 3300044842 Bacteria 1510
193 Ga0495596_0034674 3300046500 Bacteria 2003
194 Ga0495610_0154142 3300046512 Unclassified 977
195 Ga0495620_0171113 3300046515 Bacteria 842
196 Ga0495663_0000102 3300046525 Bacteria 35062
197 Ga0495598_0000045 3300046537 Bacteria 18787
198 Ga0495598_0160360 3300046537 Bacteria 791
199 Ga0495621_0003074 3300046539 Bacteria 4556
200 Ga0495621_0048777 3300046539 Unclassified 1509
201 Ga0495633_0451933 3300046558 Unclassified 580
202 Ga0495668_0378482 3300046616 Unclassified 777
203 Ga0495636_0259272 3300047318 Bacteria 806
204 Ga0495685_197532 3300047447 Unclassified 645
205 Ga0501034_0041285 3300049571 Bacteria 4667
206 Ga0501067_0072139 3300049583 Bacteria 1913
207 Ga0501069_0125987 3300049585 Bacteria 1465
208 Ga0501070_0054208 3300049586 Bacteria 3325
209 Ga0501071_0071223 3300049587 Bacteria 2534
210 Ga0501074_0491682 3300049590 Bacteria 869
211 Ga0501035_0113099 3300049822 Bacteria 2378
212 Ga0501044_0121142 3300049823 Bacteria 2617
213 nmdc:mga05p37_18640_c1 3300050507 Bacteria 8387
214 nmdc:mga05p37_212949_c1 3300050507 Unclassified 2335
215 nmdc:mga05p37_46060_c1 3300050507 Bacteria 5363
216 nmdc:mga09592_392060_c1 3300050508 Bacteria 1200
217 nmdc:mga0qj67_1195674_c1 3300050509 Unclassified 592
218 nmdc:mga06r32_628033_c1 3300050510 Bacteria 1044
219 nmdc:mga08y16_1019578_c1 3300050511 Bacteria 807
220 nmdc:mga08y16_140094_c1 3300050511 Bacteria 2514
221 nmdc:mga08y16_253993_c1 3300050511 Unclassified 1816
222 nmdc:mga08y16_36966_c1 3300050511 Bacteria 5128
223 nmdc:mga0n895_928570_c1 3300050512 Archaea 854
224 nmdc:mga0rr50_98_c1 3300050513 Bacteria 48790
225 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
226 Ga0500627_0106572 3300053158 Bacteria 1260
227 Ga0501082_0059883 3300060353 Bacteria 3281
228 Ga0157380_10187738
229 SwRhRL2b_contig_1690722
230 Ga0065704_10096432
231 Ga0065712_10463986
232 Ga0065715_10171230
233 Ga0065715_10251217
234 Ga0065707_10004038
235 Ga0065707_10097033
236 Ga0065707_10162325
237 Ga0065707_10191412
238 Ga0070690_100801230
239 Ga0070670_100000413
240 Ga0068869_100024509
241 Ga0068869_100027918
242 Ga0070680_100848178
243 Ga0070682_100000027
244 Ga0070689_100010625
245 Ga0070689_101122014
246 Ga0070687_100036834
247 Ga0070692_10140823
248 Ga0070668_100027025
249 Ga0070669_100002495
250 Ga0070669_100338258
251 Ga0070675_100578696
252 Ga0070675_100992313
253 Ga0070675_101241503
254 Ga0070671_101019743
255 Ga0070688_100225777
256 Ga0070688_101175353
257 Ga0070701_10088024
258 Ga0070700_100034326
259 Ga0070700_100834047
260 Ga0070694_100069353
261 Ga0070694_100106490
262 Ga0070694_100209194
263 Ga0070694_100809647
264 Ga0070694_101274045
265 Ga0070708_100163607
266 Ga0070708_100370301
267 Ga0070662_100134411
268 Ga0070706_100042512
269 Ga0070706_100752882
270 Ga0070707_100000452
271 Ga0070707_100028205
272 Ga0070698_100014091
273 Ga0070698_100058719
274 Ga0070698_100323623
275 Ga0070698_100396127
276 Ga0070699_100007923
277 Ga0070699_100438302
278 Ga0070697_100001825
279 Ga0070697_100067440
280 Ga0070697_100185105
281 Ga0070697_100406694
282 Ga0070697_100900277
283 Ga0070686_100003517
284 Ga0070695_100089006
285 Ga0070695_100108300
286 Ga0070695_100338782
287 Ga0070695_100459373
288 Ga0070695_100645756
289 Ga0070695_100761768
290 Ga0070696_100230401
291 Ga0070696_101729182
292 Ga0070704_100007720
293 Ga0070704_100093313
294 Ga0070704_100113057
295 Ga0070704_100269955
296 Ga0070664_100574489
297 Ga0070664_100745102
298 Ga0068857_100280437
299 Ga0070702_100796835
300 Ga0070702_100932052
301 Ga0068859_100028539
302 Ga0068864_100187777
303 Ga0068864_100261467
304 Ga0068864_100718553
305 Ga0068866_10095941
306 Ga0068861_100062135
307 Ga0068861_100289853
308 Ga0068861_100587484
309 Ga0068861_101669709
310 Ga0068863_100182389
311 Ga0068860_100204128
312 Ga0068862_100027399
313 Ga0081455_10399188
314 Ga0081540_1015996
315 Ga0097621_102063515
316 Ga0068871_102206979
317 Ga0075428_100049390
318 Ga0075430_100117903
319 Ga0075431_100058068
320 Ga0075434_100702374
321 Ga0075429_101110217
322 Ga0097620_100028539
323 Ga0075435_100000717
324 Ga0099794_10015722
325 Ga0105240_10642072
326 Ga0105240_10831033
327 Ga0111539_10082100
328 Ga0111539_10131221
329 Ga0111539_10519625
330 Ga0105245_10328767
331 Ga0105245_10828545
332 Ga0114129_10003615
333 Ga0114129_10009289
334 Ga0114129_10462664
335 Ga0114129_11195631
336 Ga0105243_10047688
337 Ga0105243_10417220
338 Ga0105243_10494563
339 Ga0105243_10872269
340 Ga0105243_12193421
341 Ga0105243_12371266
342 Ga0105241_10686521
343 Ga0105241_12116027
344 Ga0105242_10354153
345 Ga0105242_11328667
346 Ga0105248_12102141
347 Ga0105249_10000003
348 Ga0105249_10011935
349 Ga0099796_10403028
350 Ga0105246_10043449
351 Ga0105246_11582713
352 Ga0157374_11158717
353 Ga0157378_10213764
354 Ga0157378_10254089
355 Ga0157378_11152209
356 Ga0157378_12352594
357 Ga0163162_10000033
358 Ga0163162_10094578
359 Ga0157375_10073170
360 Ga0157375_10222015
361 Ga0157375_11845894
362 Ga0157375_11947611
363 Ga0163163_10023043
364 Ga0157380_10083269
365 Ga0157380_10117976
366 Ga0157377_10502406
367 Ga0213876_10083378
368 Ga0207653_10210362
369 Ga0207645_10239483
370 Ga0207684_10009230
371 Ga0207684_10073174
372 Ga0207684_10128192
373 Ga0207684_10265603
374 Ga0207695_10472052
375 Ga0207662_10325709
376 Ga0207662_10521438
377 Ga0207646_10000798
378 Ga0207646_10008901
379 Ga0207646_10107115
380 Ga0207681_10005479
381 Ga0207650_10000304
382 Ga0207659_10453887
383 Ga0207687_10481697
384 Ga0207644_10903942
385 Ga0207706_10812493
386 Ga0207709_10660952
387 Ga0207670_10320593
388 Ga0207711_10529584
389 Ga0207689_10001120
390 Ga0207689_10164040
391 Ga0207689_10602239
392 Ga0207712_10000060
393 Ga0207712_10192226
394 Ga0207668_10017714
395 Ga0207708_10008599
396 Ga0207708_10564614
397 Ga0207641_10065418
398 Ga0207674_10205826
399 Ga0207675_100182689
400 Ga0209974_10179667
401 Ga0207428_10023248
402 Ga0207428_10696301
403 Ga0207428_10726784
404 Ga0268265_10024604
405 Ga0268264_10343872
406 Ga0316575_10049500
407 Ga0307412_10638148
408 Ga0307416_100225436
409 Ga0373939_0187308
410 Ga0395900_0946122
411 Ga0395898_0266167
412 Ga0395901_0839123
413 Ga0436365_1809606
414 Ga0439436_0191619
415 Ga0439460_0084996
416 Ga0451577_0005002
417 Ga0451577_0351386
418 Ga0466963_0000255
419 Ga0466957_0149325
420 Ga0495596_0034674
421 Ga0495610_0154142
422 Ga0495620_0171113
423 Ga0495663_0000102
424 Ga0495598_0000045
425 Ga0495598_0160360
426 Ga0495621_0003074
427 Ga0495621_0048777
428 Ga0495633_0451933
429 Ga0495668_0378482
430 Ga0495636_0259272
431 Ga0495685_197532
432 Ga0501034_0041285
433 Ga0501067_0072139
434 Ga0501069_0125987
435 Ga0501070_0054208
436 Ga0501071_0071223
437 Ga0501074_0491682
438 Ga0501035_0113099
439 Ga0501044_0121142
440 nmdc:mga05p37_18640_c1
441 nmdc:mga05p37_212949_c1
442 nmdc:mga05p37_46060_c1
443 nmdc:mga09592_392060_c1
444 nmdc:mga0qj67_1195674_c1
445 nmdc:mga06r32_628033_c1
446 nmdc:mga08y16_1019578_c1
447 nmdc:mga08y16_140094_c1
448 nmdc:mga08y16_253993_c1
449 nmdc:mga08y16_36966_c1
450 nmdc:mga0n895_928570_c1
451 nmdc:mga0rr50_98_c1
452 nmdc:mga08x19_3_c1
453 Ga0500627_0106572
454 Ga0501082_0059883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

31

154

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mqw-assembly2.cif.gz_F crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.9165 29 132
2dyy-assembly3.cif.gz_I crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.908 26 133
3m1x-assembly1.cif.gz_A crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form 0.889 24 132
3m4s-assembly2.cif.gz_F crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, orthorhombic form 0.8851 24 132
7kgc-assembly2.cif.gz_A crystal structure of a perchloric acid-soluble protein (psp) from trichomonas vaginalis at 1.95 a 0.885 28 132
ID Description Score Start End Superfamily
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9154 29 132 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.889 24 132 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8798 24 131 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8649 23 132 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8615 23 132 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2E8K4U8-F1-model_v4 RidA family protein 0.9933 58 132
AF-A0A7Y2CI40-F1-model_v4 RidA family protein 0.9926 49 132
AF-A0A511D8H3-F1-model_v4 Enamine deaminase RidA 0.9869 30 134 GO:0005829
GO:0019239
AF-A0A2H5ZY24-F1-model_v4 2-iminobutanoate/2-iminopropanoate deaminase 0.9863 36 134
AF-A0A530QID1-F1-model_v4 RidA family protein 0.9852 57 134

Map