F339066

General Info

Members Datasets Scaffolds Average Seq Length
226 126 452 137

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0867804|Ga0395898_0867804_157_648
Length 163
Sequence MPSWEGPDHGTREEEPAVSPETADQRNVLGGPLEPCGTEPLTGFYRDGCCTSGPEDLGSHTVCAVVSSEFLTYQRRIGNDLSTPRPEFGFPGLRPGDRWCVVAARWLQAYEVGAAAGVVLAATNERALEVVPLEALRRHAVDVPDDLSALDDLHDLDEDDDAE

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 2508501039 Frankia saprophytica CN3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.88
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0.44
Rhizoplane 6.64
Rhizosphere 88.94
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0867804 3300037466 Bacteria 841
2 JGI25405J52794_10020034 3300003911 Bacteria 1345
3 Ga0070683_100258864 3300005329 Bacteria 1655
4 Ga0070689_101837581 3300005340 Bacteria 553
5 Ga0070668_100437834 3300005347 Bacteria 1122
6 Ga0070714_100462648 3300005435 Bacteria 1206
7 Ga0070678_100220152 3300005456 Bacteria 1577
8 Ga0070678_100244777 3300005456 Bacteria 1501
9 Ga0070678_100479865 3300005456 Bacteria 1094
10 Ga0070698_100545416 3300005471 Bacteria 1099
11 Ga0070679_100044592 3300005530 Bacteria 4418
12 Ga0070679_100594426 3300005530 Bacteria 1050
13 Ga0070679_100797061 3300005530 Bacteria 888
14 Ga0070684_100226603 3300005535 Bacteria 1706
15 Ga0070693_100150445 3300005547 Bacteria 1474
16 Ga0070693_100216100 3300005547 Bacteria 1254
17 Ga0070693_100511917 3300005547 Bacteria 853
18 Ga0070665_100369625 3300005548 Bacteria 1441
19 Ga0068855_100153010 3300005563 Bacteria 2622
20 Ga0068855_100772581 3300005563 Bacteria 1023
21 Ga0070664_101111358 3300005564 Bacteria 745
22 Ga0068856_100567727 3300005614 Bacteria 1156
23 Ga0068856_101444585 3300005614 Bacteria 702
24 Ga0070702_100201136 3300005615 Bacteria 1319
25 Ga0068852_101884315 3300005616 Bacteria 620
26 Ga0068859_100532117 3300005617 Bacteria 1270
27 Ga0068866_10273302 3300005718 Bacteria 1044
28 Ga0068858_100012372 3300005842 Bacteria 8045
29 Ga0068862_100000046 3300005844 Bacteria 152473
30 Ga0081455_10000112 3300005937 Bacteria 92158
31 Ga0075365_11064018 3300006038 Bacteria 570
32 Ga0068865_100315440 3300006881 Bacteria 1256
33 Ga0075436_100274617 3300006914 Bacteria 1204
34 Ga0097620_100049561 3300006931 Bacteria 4217
35 Ga0097620_100074975 3300006931 Bacteria 3423
36 Ga0097620_100532082 3300006931 Bacteria 1270
37 Ga0105251_10043678 3300009011 Bacteria 2169
38 Ga0105240_10598889 3300009093 Bacteria 1214
39 Ga0105247_10000090 3300009101 Bacteria 98558
40 Ga0105248_10000058 3300009177 Bacteria 137708
41 Ga0105248_10018862 3300009177 Bacteria 7628
42 Ga0105237_10784624 3300009545 Bacteria 959
43 Ga0105238_10235459 3300009551 Bacteria 1808
44 Ga0105249_10052676 3300009553 Bacteria 3717
45 Ga0105239_13418394 3300010375 Bacteria 516
46 Ga0105246_10206666 3300011119 Bacteria 1530
47 Ga0157370_11633560 3300013104 Bacteria 579
48 Ga0157369_10183147 3300013105 Bacteria 2203
49 Ga0157369_10361492 3300013105 Bacteria 1507
50 Ga0157369_10925485 3300013105 Bacteria 894
51 Ga0157369_11327203 3300013105 Bacteria 733
52 Ga0157374_11057935 3300013296 Bacteria 831
53 Ga0163162_10716395 3300013306 Bacteria 1121
54 Ga0157372_10558544 3300013307 Bacteria 1334
55 Ga0157372_12522130 3300013307 Bacteria 590
56 Ga0157375_10213508 3300013308 Bacteria 2087
57 Ga0157375_10526835 3300013308 Bacteria 1344
58 Ga0163163_10012365 3300014325 Bacteria 7776
59 Ga0163163_10307940 3300014325 Bacteria 1637
60 Ga0163163_10787602 3300014325 Bacteria 1014
61 Ga0157379_10026292 3300014968 Bacteria 5181
62 Ga0157376_10124815 3300014969 Bacteria 2287
63 Ga0206354_10962391 3300020081 Bacteria 5115
64 Ga0206353_10982531 3300020082 Bacteria 6505
65 Ga0207642_10143411 3300025899 Bacteria 1262
66 Ga0207652_10117671 3300025921 Bacteria 2361
67 Ga0207694_10347069 3300025924 Bacteria 1228
68 Ga0207686_10075981 3300025934 Bacteria 2176
69 Ga0207704_10864704 3300025938 Bacteria 759
70 Ga0207661_10916302 3300025944 Bacteria 807
71 Ga0207712_10033897 3300025961 Bacteria 3455
72 Ga0207712_10372840 3300025961 Bacteria 1192
73 Ga0207668_10610521 3300025972 Bacteria 951
74 Ga0207640_10715825 3300025981 Bacteria 860
75 Ga0207702_10442652 3300026078 Bacteria 1260
76 Ga0207683_10122150 3300026121 Bacteria 2339
77 Ga0268265_10000039 3300028380 Bacteria 198606
78 Ga0307515_10388606 3300028794 Bacteria 1025
79 Ga0307512_10328945 3300030522 Unclassified 689
80 Ga0265340_10168239 3300031247 Bacteria 993
81 Ga0307405_11127759 3300031731 Bacteria 675
82 Ga0307410_10530667 3300031852 Bacteria 973
83 Ga0307409_100593466 3300031995 Bacteria 1094
84 Ga0307409_100930234 3300031995 Bacteria 884
85 Ga0307409_101532506 3300031995 Bacteria 694
86 Ga0307416_102223562 3300032002 Bacteria 649
87 Ga0307416_102839848 3300032002 Bacteria 579
88 Ga0307416_103294308 3300032002 Bacteria 540
89 Ga0307414_11424944 3300032004 Bacteria 644
90 Ga0307414_11595121 3300032004 Bacteria 608
91 Ga0307414_12182759 3300032004 Bacteria 517
92 Ga0307415_100657783 3300032126 Bacteria 940
93 Ga0373937_1916382 3300036401 Bacteria 539
94 Ga0395899_0336018 3300037312 Bacteria 1014
95 Ga0395900_0125158 3300037418 Bacteria 2636
96 Ga0395898_0086839 3300037466 Bacteria 3014
97 Ga0395898_0121975 3300037466 Bacteria 2497
98 Ga0395898_0324671 3300037466 Bacteria 1468
99 Ga0395905_1687355 3300037471 Bacteria 539
100 Ga0395901_0002817 3300038443 Bacteria 17558
101 Ga0395901_0118247 3300038443 Bacteria 2785
102 Ga0395901_0266742 3300038443 Bacteria 1781
103 Ga0395901_0345019 3300038443 Bacteria 1538
104 Ga0395901_0648968 3300038443 Bacteria 1059
105 Ga0395901_0704375 3300038443 Bacteria 1007
106 Ga0451793_1000374 3300041452 Bacteria 532
107 Ga0451833_0955963 3300041491 Unclassified 686
108 Ga0466969_0274732 3300044656 Bacteria 763
109 Ga0466972_0188851 3300044658 Bacteria 966
110 Ga0466972_0227549 3300044658 Bacteria 873
111 Ga0466972_0246123 3300044658 Bacteria 836
112 Ga0466965_0029316 3300044683 Bacteria 2678
113 Ga0466965_0110404 3300044683 Bacteria 1413
114 Ga0466965_0206959 3300044683 Bacteria 1042
115 Ga0466965_0266027 3300044683 Bacteria 923
116 Ga0466965_0510774 3300044683 Bacteria 675
117 Ga0466965_0721239 3300044683 Bacteria 573
118 Ga0466965_0785000 3300044683 Bacteria 550
119 Ga0466966_0059433 3300044684 Bacteria 2414
120 Ga0466966_0578708 3300044684 Bacteria 676
121 Ga0466966_0782189 3300044684 Bacteria 575
122 Ga0466961_0065269 3300044693 Bacteria 2313
123 Ga0466961_0071782 3300044693 Bacteria 2197
124 Ga0466961_0111523 3300044693 Bacteria 1720
125 Ga0466961_0713466 3300044693 Bacteria 600
126 Ga0466963_0179363 3300044694 Bacteria 1478
127 Ga0466963_0194536 3300044694 Bacteria 1417
128 Ga0466963_0203890 3300044694 Bacteria 1383
129 Ga0466963_0256903 3300044694 Bacteria 1226
130 Ga0466963_0360959 3300044694 Bacteria 1023
131 Ga0466963_0399149 3300044694 Bacteria 970
132 Ga0466963_0505042 3300044694 Bacteria 854
133 Ga0466963_0604455 3300044694 Bacteria 774
134 Ga0466963_0858003 3300044694 Bacteria 640
135 Ga0466963_1153179 3300044694 Bacteria 545
136 Ga0466964_0022444 3300044706 Bacteria 2449
137 Ga0466964_0141066 3300044706 Bacteria 1108
138 Ga0466964_0340158 3300044706 Bacteria 768
139 Ga0466964_0424386 3300044706 Bacteria 700
140 Ga0466971_0039987 3300044719 Bacteria 2106
141 Ga0466971_0070967 3300044719 Bacteria 1582
142 Ga0466971_0151317 3300044719 Bacteria 1083
143 Ga0466971_0529350 3300044719 Bacteria 584
144 Ga0466970_0051369 3300044765 Bacteria 2200
145 Ga0466970_0424114 3300044765 Bacteria 761
146 Ga0466970_0503716 3300044765 Bacteria 697
147 Ga0466970_0570103 3300044765 Bacteria 655
148 Ga0466957_0009838 3300044842 Bacteria 5467
149 Ga0466957_0037759 3300044842 Bacteria 2908
150 Ga0466957_0252382 3300044842 Bacteria 1173
151 Ga0466957_0259801 3300044842 Bacteria 1157
152 Ga0466957_0276655 3300044842 Bacteria 1122
153 Ga0466957_0470806 3300044842 Bacteria 868
154 Ga0466960_0011934 3300044901 Bacteria 3655
155 Ga0466960_0123105 3300044901 Bacteria 1360
156 Ga0466960_0312920 3300044901 Bacteria 887
157 Ga0466959_0089980 3300045049 Bacteria 2205
158 Ga0466959_0189506 3300045049 Bacteria 1436
159 Ga0466959_0256647 3300045049 Bacteria 1204
160 Ga0466958_0003826 3300045836 Bacteria 7860
161 Ga0466958_0210669 3300045836 Bacteria 1238
162 Ga0466958_0311700 3300045836 Bacteria 1011
163 Ga0466958_0422690 3300045836 Bacteria 861
164 Ga0466958_0569193 3300045836 Bacteria 736
165 Ga0466967_0004557 3300045976 Bacteria 9382
166 Ga0466967_0066355 3300045976 Bacteria 3215
167 Ga0466967_0071392 3300045976 Unclassified 3109
168 Ga0466967_0106500 3300045976 Bacteria 2570
169 Ga0466967_0287142 3300045976 Bacteria 1580
170 Ga0466967_0288381 3300045976 Bacteria 1576
171 Ga0466967_0567319 3300045976 Bacteria 1118
172 Ga0466967_1095373 3300045976 Unclassified 794
173 Ga0466967_1344719 3300045976 Bacteria 711
174 Ga0495608_0594266 3300046511 Bacteria 665
175 Ga0496101_1542841 3300048904 Bacteria 517
176 Ga0496102_0322325 3300048905 Bacteria 1456
177 Ga0496104_0077091 3300048907 Bacteria 3176
178 Ga0496105_1406496 3300048908 Bacteria 505
179 Ga0496108_0059814 3300048911 Bacteria 3204
180 Ga0496108_0570463 3300048911 Bacteria 987
181 Ga0496109_0104563 3300048912 Bacteria 2629
182 Ga0496109_0244824 3300048912 Bacteria 1688
183 Ga0496110_0140538 3300048913 Bacteria 2183
184 Ga0496111_0058367 3300048914 Bacteria 2794
185 Ga0496113_0229259 3300048916 Bacteria 1481
186 Ga0496114_0020077 3300048917 Bacteria 5420
187 Ga0496114_0057585 3300048917 Bacteria 3244
188 Ga0496115_0040837 3300048918 Bacteria 3690
189 Ga0496119_0001071 3300048922 Bacteria 34667
190 Ga0496120_0001873 3300048923 Bacteria 23429
191 Ga0501031_0739515 3300049568 Bacteria 631
192 Ga0501040_0415252 3300049576 Bacteria 967
193 Ga0501047_0357325 3300049581 Bacteria 1297
194 Ga0501067_0001106 3300049583 Bacteria 14556
195 Ga0501068_0133421 3300049584 Bacteria 1554
196 Ga0501069_0072425 3300049585 Bacteria 1932
197 Ga0501070_0007756 3300049586 Bacteria 9099
198 Ga0501070_0074261 3300049586 Bacteria 2815
199 Ga0501071_0109762 3300049587 Bacteria 2038
200 Ga0501072_0085331 3300049588 Bacteria 2504
201 Ga0501072_0167708 3300049588 Bacteria 1752
202 Ga0501073_0001525 3300049589 Bacteria 17144
203 Ga0501073_0065065 3300049589 Bacteria 2543
204 Ga0501074_0001517 3300049590 Bacteria 15685
205 Ga0501074_0024460 3300049590 Bacteria 4390
206 Ga0501074_0144895 3300049590 Bacteria 1699
207 Ga0501076_1330053 3300049592 Bacteria 591
208 Ga0501079_0263455 3300049741 Bacteria 1347
209 Ga0501080_0065618 3300049742 Bacteria 3376
210 Ga0501080_0129190 3300049742 Bacteria 2339
211 Ga0501083_0530297 3300049744 Bacteria 766
212 Ga0501083_0580187 3300049744 Bacteria 730
213 Ga0501265_107875 3300049762 Bacteria 517
214 nmdc:mga0qj67_6256_c1 3300050509 Bacteria 8735
215 nmdc:mga06r32_64340_c1 3300050510 Bacteria 3537
216 Ga0500583_0143274 3300053092 Bacteria 1188
217 Ga0500616_0047089 3300053153 Bacteria 2290
218 Ga0500616_0134258 3300053153 Bacteria 1165
219 Ga0501084_0101320 3300054114 Bacteria 2418
220 Ga0501082_0132073 3300060353 Bacteria 2166
221 Ga0466962_0019946 3300061719 Bacteria 3222
222 Ga0466962_0172807 3300061719 Bacteria 1052
223 Ga0466962_0346312 3300061719 Bacteria 740
224 Ga0466962_0450912 3300061719 Bacteria 648
225 Ga0466962_0578931 3300061719 Bacteria 571
226 2508672721 2508501039 Bacteria 9978592
227 Ga0395898_0867804
228 JGI25405J52794_10020034
229 Ga0070683_100258864
230 Ga0070689_101837581
231 Ga0070668_100437834
232 Ga0070714_100462648
233 Ga0070678_100220152
234 Ga0070678_100244777
235 Ga0070678_100479865
236 Ga0070698_100545416
237 Ga0070679_100044592
238 Ga0070679_100594426
239 Ga0070679_100797061
240 Ga0070684_100226603
241 Ga0070693_100150445
242 Ga0070693_100216100
243 Ga0070693_100511917
244 Ga0070665_100369625
245 Ga0068855_100153010
246 Ga0068855_100772581
247 Ga0070664_101111358
248 Ga0068856_100567727
249 Ga0068856_101444585
250 Ga0070702_100201136
251 Ga0068852_101884315
252 Ga0068859_100532117
253 Ga0068866_10273302
254 Ga0068858_100012372
255 Ga0068862_100000046
256 Ga0081455_10000112
257 Ga0075365_11064018
258 Ga0068865_100315440
259 Ga0075436_100274617
260 Ga0097620_100049561
261 Ga0097620_100074975
262 Ga0097620_100532082
263 Ga0105251_10043678
264 Ga0105240_10598889
265 Ga0105247_10000090
266 Ga0105248_10000058
267 Ga0105248_10018862
268 Ga0105237_10784624
269 Ga0105238_10235459
270 Ga0105249_10052676
271 Ga0105239_13418394
272 Ga0105246_10206666
273 Ga0157370_11633560
274 Ga0157369_10183147
275 Ga0157369_10361492
276 Ga0157369_10925485
277 Ga0157369_11327203
278 Ga0157374_11057935
279 Ga0163162_10716395
280 Ga0157372_10558544
281 Ga0157372_12522130
282 Ga0157375_10213508
283 Ga0157375_10526835
284 Ga0163163_10012365
285 Ga0163163_10307940
286 Ga0163163_10787602
287 Ga0157379_10026292
288 Ga0157376_10124815
289 Ga0206354_10962391
290 Ga0206353_10982531
291 Ga0207642_10143411
292 Ga0207652_10117671
293 Ga0207694_10347069
294 Ga0207686_10075981
295 Ga0207704_10864704
296 Ga0207661_10916302
297 Ga0207712_10033897
298 Ga0207712_10372840
299 Ga0207668_10610521
300 Ga0207640_10715825
301 Ga0207702_10442652
302 Ga0207683_10122150
303 Ga0268265_10000039
304 Ga0307515_10388606
305 Ga0307512_10328945
306 Ga0265340_10168239
307 Ga0307405_11127759
308 Ga0307410_10530667
309 Ga0307409_100593466
310 Ga0307409_100930234
311 Ga0307409_101532506
312 Ga0307416_102223562
313 Ga0307416_102839848
314 Ga0307416_103294308
315 Ga0307414_11424944
316 Ga0307414_11595121
317 Ga0307414_12182759
318 Ga0307415_100657783
319 Ga0373937_1916382
320 Ga0395899_0336018
321 Ga0395900_0125158
322 Ga0395898_0086839
323 Ga0395898_0121975
324 Ga0395898_0324671
325 Ga0395905_1687355
326 Ga0395901_0002817
327 Ga0395901_0118247
328 Ga0395901_0266742
329 Ga0395901_0345019
330 Ga0395901_0648968
331 Ga0395901_0704375
332 Ga0451793_1000374
333 Ga0451833_0955963
334 Ga0466969_0274732
335 Ga0466972_0188851
336 Ga0466972_0227549
337 Ga0466972_0246123
338 Ga0466965_0029316
339 Ga0466965_0110404
340 Ga0466965_0206959
341 Ga0466965_0266027
342 Ga0466965_0510774
343 Ga0466965_0721239
344 Ga0466965_0785000
345 Ga0466966_0059433
346 Ga0466966_0578708
347 Ga0466966_0782189
348 Ga0466961_0065269
349 Ga0466961_0071782
350 Ga0466961_0111523
351 Ga0466961_0713466
352 Ga0466963_0179363
353 Ga0466963_0194536
354 Ga0466963_0203890
355 Ga0466963_0256903
356 Ga0466963_0360959
357 Ga0466963_0399149
358 Ga0466963_0505042
359 Ga0466963_0604455
360 Ga0466963_0858003
361 Ga0466963_1153179
362 Ga0466964_0022444
363 Ga0466964_0141066
364 Ga0466964_0340158
365 Ga0466964_0424386
366 Ga0466971_0039987
367 Ga0466971_0070967
368 Ga0466971_0151317
369 Ga0466971_0529350
370 Ga0466970_0051369
371 Ga0466970_0424114
372 Ga0466970_0503716
373 Ga0466970_0570103
374 Ga0466957_0009838
375 Ga0466957_0037759
376 Ga0466957_0252382
377 Ga0466957_0259801
378 Ga0466957_0276655
379 Ga0466957_0470806
380 Ga0466960_0011934
381 Ga0466960_0123105
382 Ga0466960_0312920
383 Ga0466959_0089980
384 Ga0466959_0189506
385 Ga0466959_0256647
386 Ga0466958_0003826
387 Ga0466958_0210669
388 Ga0466958_0311700
389 Ga0466958_0422690
390 Ga0466958_0569193
391 Ga0466967_0004557
392 Ga0466967_0066355
393 Ga0466967_0071392
394 Ga0466967_0106500
395 Ga0466967_0287142
396 Ga0466967_0288381
397 Ga0466967_0567319
398 Ga0466967_1095373
399 Ga0466967_1344719
400 Ga0495608_0594266
401 Ga0496101_1542841
402 Ga0496102_0322325
403 Ga0496104_0077091
404 Ga0496105_1406496
405 Ga0496108_0059814
406 Ga0496108_0570463
407 Ga0496109_0104563
408 Ga0496109_0244824
409 Ga0496110_0140538
410 Ga0496111_0058367
411 Ga0496113_0229259
412 Ga0496114_0020077
413 Ga0496114_0057585
414 Ga0496115_0040837
415 Ga0496119_0001071
416 Ga0496120_0001873
417 Ga0501031_0739515
418 Ga0501040_0415252
419 Ga0501047_0357325
420 Ga0501067_0001106
421 Ga0501068_0133421
422 Ga0501069_0072425
423 Ga0501070_0007756
424 Ga0501070_0074261
425 Ga0501071_0109762
426 Ga0501072_0085331
427 Ga0501072_0167708
428 Ga0501073_0001525
429 Ga0501073_0065065
430 Ga0501074_0001517
431 Ga0501074_0024460
432 Ga0501074_0144895
433 Ga0501076_1330053
434 Ga0501079_0263455
435 Ga0501080_0065618
436 Ga0501080_0129190
437 Ga0501083_0530297
438 Ga0501083_0580187
439 Ga0501265_107875
440 nmdc:mga0qj67_6256_c1
441 nmdc:mga06r32_64340_c1
442 Ga0500583_0143274
443 Ga0500616_0047089
444 Ga0500616_0134258
445 Ga0501084_0101320
446 Ga0501082_0132073
447 Ga0466962_0019946
448 Ga0466962_0172807
449 Ga0466962_0346312
450 Ga0466962_0450912
451 Ga0466962_0578931
452 2508672721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

26

140

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.9766 5 121
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.9604 5 121
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8459 2 121
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8391 2 121
2lq3-assembly1.cif.gz_A solution nmr structure of syc0711_d from synechococcus sp., northeast structural genomics consortium (nesg) target snr212 0.5064 1 123
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9736 5 121 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9568 5 121 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8701 6 121 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8487 6 121 3.30.56.110
2lq3A01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.6846 47 121 1.10.1660.80
ID Description Score Start End GO Terms
AF-A0A1Z8KNJ8-F1-model_v4 Uncharacterized protein 0.9977 82 121
AF-Q0FK62-F1-model_v4 DUF2237 domain-containing protein 0.9971 48 120
AF-A0A353DFF3-F1-model_v4 DUF2237 domain-containing protein 0.996 49 120
AF-A0A2P2DZE0-F1-model_v4 DUF2237 domain-containing protein 0.9935 36 121
AF-K5BGS2-F1-model_v4 DUF2237 domain-containing protein 0.9928 20 87

Map