F338903

General Info

Members Datasets Scaffolds Average Seq Length
226 176 217 123

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10280751|Ga0163161_102807511
Length 141
Sequence MIVESKAKLAATPLMPDHTAPEIELLRAAYAAFNARDTDAALALMTPDVAWPQACKGGFVRGHEEVRAYWREQWSEIDPHVEPMAFHSEGAEQVLVDVHQVVRDLAGAVLADEYVGHRFTLARGLIQAMEVGPLPLSTPKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
3 2831426010 Nostoc sp. 106C Isolate Unclassified
4 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
5 2849660919 Nostoc sp. T09 Isolate Unclassified
6 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
7 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
8 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
96 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
168 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0.44
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 12.83
Rhizosphere 77.43
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1894069 2162886007 Bacteria 1198
2 rootH1_10230892 3300003323 Bacteria 2587
3 Ga0065704_10111953 3300005289 Bacteria 1944
4 Ga0065712_10248636 3300005290 Bacteria 958
5 Ga0070676_10171803 3300005328 Bacteria 1403
6 Ga0070666_10142013 3300005335 Bacteria 1672
7 Ga0068868_100209468 3300005338 Bacteria 1629
8 Ga0070660_100506084 3300005339 Bacteria 1005
9 Ga0070689_100357299 3300005340 Bacteria 1227
10 Ga0070668_100150675 3300005347 Bacteria 1880
11 Ga0070675_100886058 3300005354 Bacteria 817
12 Ga0070671_101162719 3300005355 Bacteria 679
13 Ga0070673_100143810 3300005364 Bacteria 2014
14 Ga0070667_100591714 3300005367 Bacteria 1022
15 Ga0070709_10508154 3300005434 Bacteria 916
16 Ga0070714_100587801 3300005435 Bacteria 1068
17 Ga0070713_100944252 3300005436 Unclassified 830
18 Ga0070713_101275677 3300005436 Bacteria 712
19 Ga0070710_10013898 3300005437 Bacteria 4041
20 Ga0070710_10033463 3300005437 Bacteria 2791
21 Ga0070711_100125381 3300005439 Bacteria 1905
22 Ga0070711_100597279 3300005439 Bacteria 920
23 Ga0070708_100070746 3300005445 Bacteria 3139
24 Ga0070707_102064015 3300005468 Unclassified 538
25 Ga0070698_100561000 3300005471 Bacteria 1081
26 Ga0070684_100496604 3300005535 Unclassified 1130
27 Ga0070697_100035033 3300005536 Bacteria 4049
28 Ga0070696_100042604 3300005546 Unclassified 3137
29 Ga0068854_102142018 3300005578 Bacteria 517
30 Ga0068859_100432432 3300005617 Bacteria 1413
31 Ga0070717_10063481 3300006028 Bacteria 3066
32 Ga0070717_10274257 3300006028 Unclassified 1494
33 Ga0070715_10641315 3300006163 Bacteria 628
34 Ga0070716_100635590 3300006173 Bacteria 807
35 Ga0070712_100025026 3300006175 Bacteria 3962
36 Ga0070712_100104011 3300006175 Bacteria 2106
37 Ga0070712_101288487 3300006175 Bacteria 637
38 Ga0075367_10371602 3300006178 Bacteria 903
39 Ga0075367_10748317 3300006178 Bacteria 622
40 Ga0075366_10972562 3300006195 Bacteria 529
41 Ga0075434_100663826 3300006871 Bacteria 1061
42 Ga0097620_100432466 3300006931 Bacteria 1413
43 Ga0099794_10135698 3300007265 Bacteria 1244
44 Ga0105245_11670458 3300009098 Bacteria 689
45 Ga0099796_10507721 3300010159 Bacteria 540
46 Ga0157371_10110468 3300013102 Bacteria 1951
47 Ga0157374_10515233 3300013296 Bacteria 1201
48 Ga0157378_10826988 3300013297 Bacteria 953
49 Ga0163162_10350077 3300013306 Bacteria 1610
50 Ga0163162_13000935 3300013306 Bacteria 542
51 Ga0157372_10135978 3300013307 Bacteria 2830
52 Ga0157372_11586841 3300013307 Bacteria 753
53 Ga0157375_10085344 3300013308 Bacteria 3207
54 Ga0157380_10532083 3300014326 Bacteria 1149
55 Ga0157379_10247368 3300014968 Bacteria 1618
56 Ga0157379_12226916 3300014968 Bacteria 545
57 Ga0157376_10188152 3300014969 Bacteria 1891
58 Ga0163161_10280751 3300017792 Bacteria 1306
59 Ga0207697_10005836 3300025315 Bacteria 5660
60 Ga0207692_10020248 3300025898 Bacteria 3022
61 Ga0207688_10189603 3300025901 Bacteria 1229
62 Ga0207680_10456686 3300025903 Bacteria 907
63 Ga0207685_10013183 3300025905 Bacteria 2549
64 Ga0207699_10184790 3300025906 Bacteria 1403
65 Ga0207645_10003569 3300025907 Bacteria 11773
66 Ga0207705_10022830 3300025909 Bacteria 4461
67 Ga0207693_10011417 3300025915 Bacteria 7192
68 Ga0207693_10351212 3300025915 Bacteria 1154
69 Ga0207663_10282632 3300025916 Bacteria 1233
70 Ga0207652_11608459 3300025921 Bacteria 554
71 Ga0207659_10167538 3300025926 Bacteria 1730
72 Ga0207700_10137373 3300025928 Bacteria 2004
73 Ga0207700_10350506 3300025928 Bacteria 1285
74 Ga0207700_11481307 3300025928 Bacteria 602
75 Ga0207664_10321600 3300025929 Bacteria 1365
76 Ga0207706_10179683 3300025933 Bacteria 1858
77 Ga0207665_10147498 3300025939 Bacteria 1682
78 Ga0207665_10602546 3300025939 Bacteria 858
79 Ga0207667_10693943 3300025949 Bacteria 1021
80 Ga0207668_10579270 3300025972 Bacteria 975
81 Ga0207677_10353174 3300026023 Bacteria 1232
82 Ga0207702_10444021 3300026078 Bacteria 1258
83 Ga0207674_11763195 3300026116 Bacteria 587
84 Ga0207683_11462809 3300026121 Bacteria 631
85 Ga0265760_10145715 3300031090 Bacteria 774
86 Ga0307414_10010543 3300032004 Bacteria 5370
87 Ga0307414_10012697 3300032004 Bacteria 4992
88 Ga0307414_10019660 3300032004 Bacteria 4191
89 Ga0307414_10858118 3300032004 Unclassified 830
90 Ga0373923_0075389 3300035111 Bacteria 1455
91 Ga0373936_0330366 3300035113 Bacteria 692
92 Ga0373956_0234908 3300035119 Bacteria 871
93 Ga0373924_0178208 3300035410 Bacteria 935
94 Ga0373933_0551142 3300035724 Bacteria 756
95 Ga0373937_0088832 3300036401 Bacteria 2861
96 Ga0373937_0219545 3300036401 Bacteria 1789
97 Ga0395899_0135976 3300037312 Bacteria 1752
98 Ga0395900_0040478 3300037418 Bacteria 4803
99 Ga0395898_0007205 3300037466 Bacteria 11807
100 Ga0395905_0004007 3300037471 Bacteria 15478
101 Ga0395905_0154388 3300037471 Bacteria 2159
102 Ga0395901_0005765 3300038443 Bacteria 12544
103 Ga0237819_09034 3300038705 Bacteria 1354
104 Ga0436365_0253912 3300039437 Unclassified 664
105 Ga0436365_0512507 3300039437 Bacteria 701
106 Ga0436365_1560335 3300039437 Unclassified 1044
107 Ga0436361_0225780 3300039447 Bacteria 2640
108 Ga0436361_0534868 3300039447 Bacteria 1824
109 Ga0436361_0777385 3300039447 Bacteria 8776
110 Ga0436361_1110676 3300039447 Bacteria 1114
111 Ga0436362_0115735 3300039453 Unclassified 542
112 Ga0436362_0851004 3300039453 Unclassified 1399
113 Ga0451787_213985 3300041441 Unclassified 552
114 Ga0451789_0057032 3300041443 Bacteria 1646
115 Ga0451789_0762726 3300041443 Bacteria 1241
116 Ga0451791_1158263 3300041451 Bacteria 3883
117 Ga0451791_1831018 3300041451 Bacteria 519
118 Ga0451793_1914508 3300041452 Unclassified 1088
119 Ga0451797_0383096 3300041453 Unclassified 1496
120 Ga0451797_0760379 3300041453 Unclassified 1173
121 Ga0451802_1713574 3300041460 Bacteria 1062
122 Ga0451802_1938233 3300041460 Unclassified 904
123 Ga0451804_0591161 3300041463 Unclassified 502
124 Ga0451807_0131851 3300041486 Bacteria 2316
125 Ga0451807_0553760 3300041486 Bacteria 672
126 Ga0451807_1852362 3300041486 Bacteria 606
127 Ga0451837_1367605 3300041494 Bacteria 520
128 Ga0451843_0394257 3300041509 Unclassified 1054
129 Ga0466965_0528501 3300044683 Unclassified 664
130 Ga0466966_0232540 3300044684 Bacteria 1112
131 Ga0466966_0357226 3300044684 Bacteria 878
132 Ga0466966_0937215 3300044684 Bacteria 522
133 Ga0466961_0145343 3300044693 Unclassified 1483
134 Ga0466963_0167565 3300044694 Bacteria 1530
135 Ga0466971_0026085 3300044719 Bacteria 2610
136 Ga0466968_0156297 3300044735 Bacteria 1050
137 Ga0466957_0711250 3300044842 Unclassified 709
138 Ga0466959_0172638 3300045049 Bacteria 1516
139 Ga0466959_0510717 3300045049 Bacteria 812
140 Ga0466959_1042749 3300045049 Unclassified 544
141 Ga0466958_0064355 3300045836 Bacteria 2236
142 Ga0466967_0032272 3300045976 Bacteria 4420
143 Ga0466967_0167819 3300045976 Bacteria 2063
144 Ga0466967_0607158 3300045976 Bacteria 1080
145 Ga0466967_0894673 3300045976 Unclassified 883
146 Ga0495592_0073685 3300046454 Bacteria 2482
147 Ga0495592_0851095 3300046454 Bacteria 539
148 Ga0495651_0031467 3300046462 Bacteria 4137
149 Ga0495653_0131803 3300046463 Bacteria 1768
150 Ga0495653_0321382 3300046463 Bacteria 1003
151 Ga0495650_0108321 3300046471 Unclassified 1034
152 Ga0495582_0401260 3300046473 Bacteria 791
153 Ga0495605_0045000 3300046474 Bacteria 2178
154 Ga0495607_0066674 3300046501 Bacteria 2024
155 Ga0495606_0072707 3300046507 Unclassified 2159
156 Ga0495610_0048057 3300046512 Bacteria 2096
157 Ga0495616_0013766 3300046513 Bacteria 4553
158 Ga0495618_0018200 3300046514 Bacteria 4314
159 Ga0495618_0264221 3300046514 Bacteria 1077
160 Ga0495628_0040923 3300046516 Bacteria 3700
161 Ga0495630_0813520 3300046517 Bacteria 713
162 Ga0495631_0410014 3300046518 Unclassified 577
163 Ga0495632_0115147 3300046519 Unclassified 1260
164 Ga0495652_0257673 3300046529 Bacteria 1289
165 Ga0495640_0062069 3300046533 Bacteria 2536
166 Ga0495587_0074499 3300046536 Bacteria 1971
167 Ga0495633_0063976 3300046558 Bacteria 1720
168 Ga0495667_0028433 3300046559 Bacteria 3764
169 Ga0495635_0008601 3300046663 Bacteria 7127
170 Ga0495635_0287806 3300046663 Bacteria 1103
171 Ga0495623_0129300 3300046679 Bacteria 1514
172 Ga0495646_0006180 3300046680 Bacteria 7597
173 Ga0495613_0187428 3300046689 Bacteria 1463
174 Ga0495624_0532847 3300046690 Bacteria 702
175 Ga0495600_0010807 3300046809 Bacteria 5676
176 Ga0495660_0321783 3300046810 Unclassified 695
177 Ga0495660_0392752 3300046810 Unclassified 609
178 Ga0495581_0049279 3300047315 Bacteria 2432
179 Ga0495604_0002267 3300047317 Bacteria 15397
180 Ga0495604_0477856 3300047317 Bacteria 811
181 Ga0495674_0056702 3300047319 Bacteria 3430
182 Ga0495680_0006204 3300047322 Bacteria 11140
183 Ga0495675_0245180 3300047444 Bacteria 1077
184 Ga0495681_0155652 3300047470 Unclassified 955
185 Ga0495684_0486558 3300047471 Bacteria 851
186 Ga0495686_0093108 3300047472 Bacteria 1828
187 Ga0495593_0230226 3300047673 Bacteria 929
188 Ga0495602_0023601 3300048088 Bacteria 5989
189 Ga0496101_0606413 3300048904 Bacteria 865
190 Ga0496102_0018668 3300048905 Bacteria 6099
191 Ga0496102_0733189 3300048905 Bacteria 911
192 Ga0496103_0069770 3300048906 Bacteria 2198
193 Ga0496104_0070124 3300048907 Bacteria 3332
194 Ga0496104_1159131 3300048907 Bacteria 676
195 Ga0496106_0058781 3300048909 Bacteria 2911
196 Ga0496107_0007674 3300048910 Bacteria 7450
197 Ga0496107_1315256 3300048910 Bacteria 517
198 Ga0496109_0055260 3300048912 Bacteria 3622
199 Ga0496112_0876732 3300048915 Bacteria 820
200 Ga0496113_0257472 3300048916 Unclassified 1394
201 Ga0496113_0573746 3300048916 Unclassified 904
202 Ga0496114_0259636 3300048917 Unclassified 1529
203 Ga0496115_0089122 3300048918 Bacteria 2519
204 Ga0496122_0107669 3300048925 Bacteria 1841
205 Ga0496124_0933289 3300048927 Bacteria 523
206 Ga0495678_098453 3300049459 Unclassified 1017
207 Ga0501077_0487363 3300049593 Bacteria 790
208 Ga0501236_027747 3300049670 Bacteria 879
209 Ga0501261_012927 3300049690 Bacteria 1128
210 nmdc:mga06z11_335694_c1 3300050494 Bacteria 903
211 nmdc:mga0n895_791558_c1 3300050512 Unclassified 939
212 nmdc:mga08x19_1063926_c1 3300050514 Unclassified 574
213 Ga0495601_0119496 3300053077 Unclassified 1711
214 Ga0495601_0433200 3300053077 Bacteria 851
215 Ga0495612_0350664 3300053078 Bacteria 666
216 Ga0495595_0043747 3300053084 Bacteria 2055
217 Ga0466962_0091789 3300061719 Bacteria 1455

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_1315256 Ga0496107_1315256_181_507 108
2 3300044684 Ga0466966_0357226 Ga0466966_0357226_183_530 115
3 3300044694 Ga0466963_0167565 Ga0466963_0167565_136_483 115
4 3300044842 Ga0466957_0711250 Ga0466957_0711250_206_553 115
5 3300045049 Ga0466959_0172638 Ga0466959_0172638_960_1307 115
6 3300045836 Ga0466958_0064355 Ga0466958_0064355_287_634 115
7 3300045976 Ga0466967_0032272 Ga0466967_0032272_1278_1625 115
8 3300045976 Ga0466967_0894673 Ga0466967_0894673_210_557 115
9 3300039447 Ga0436361_1110676 Ga0436361_1110676_561_911 116
10 3300044719 Ga0466971_0026085 Ga0466971_0026085_1933_2283 116
11 3300049690 Ga0501261_012927 Ga0501261_012927_552_935 116
12 3300061719 Ga0466962_0091789 Ga0466962_0091789_894_1244 116
13 3300005535 Ga0070684_100496604 Ga0070684_1004966042 117
14 3300037312 Ga0395899_0135976 Ga0395899_0135976_122_475 117
15 3300037418 Ga0395900_0040478 Ga0395900_0040478_3227_3580 117
16 3300037466 Ga0395898_0007205 Ga0395898_0007205_2647_3000 117
17 3300037471 Ga0395905_0154388 Ga0395905_0154388_1365_1718 117
18 3300038443 Ga0395901_0005765 Ga0395901_0005765_8643_8996 117
19 3300044684 Ga0466966_0232540 Ga0466966_0232540_149_502 117
20 3300044684 Ga0466966_0937215 Ga0466966_0937215_76_429 117
21 3300044693 Ga0466961_0145343 Ga0466961_0145343_207_560 117
22 3300044735 Ga0466968_0156297 Ga0466968_0156297_136_489 117
23 3300045049 Ga0466959_0510717 Ga0466959_0510717_19_372 117
24 3300045049 Ga0466959_1042749 Ga0466959_1042749_20_373 117
25 3300045976 Ga0466967_0167819 Ga0466967_0167819_1684_2037 117
26 3300045976 Ga0466967_0607158 Ga0466967_0607158_452_805 117
27 3300046454 Ga0495592_0851095 Ga0495592_0851095_38_391 117
28 3300046463 Ga0495653_0321382 Ga0495653_0321382_505_858 117
29 3300046473 Ga0495582_0401260 Ga0495582_0401260_261_614 117
30 3300046514 Ga0495618_0264221 Ga0495618_0264221_282_635 117
31 3300046663 Ga0495635_0287806 Ga0495635_0287806_421_774 117
32 3300047317 Ga0495604_0477856 Ga0495604_0477856_282_635 117
33 3300047471 Ga0495684_0486558 Ga0495684_0486558_48_401 117
34 3300048905 Ga0496102_0733189 Ga0496102_0733189_544_897 117
35 3300048907 Ga0496104_0070124 Ga0496104_0070124_1153_1506 117
36 3300048907 Ga0496104_1159131 Ga0496104_1159131_186_539 117
37 3300048915 Ga0496112_0876732 Ga0496112_0876732_329_682 117
38 3300048916 Ga0496113_0257472 Ga0496113_0257472_673_1026 117
39 3300048917 Ga0496114_0259636 Ga0496114_0259636_1155_1508 117
40 3300049670 Ga0501236_027747 Ga0501236_027747_161_514 117
41 3300053077 Ga0495601_0433200 Ga0495601_0433200_42_395 117
42 iso_pu_bacteria 2913939268 2913940912 117
43 3300005436 Ga0070713_100944252 Ga0070713_1009442522 118
44 3300005437 Ga0070710_10013898 Ga0070710_100138983 118
45 3300005439 Ga0070711_100125381 Ga0070711_1001253812 118
46 3300006028 Ga0070717_10274257 Ga0070717_102742572 118
47 3300006173 Ga0070716_100635590 Ga0070716_1006355902 118
48 3300006175 Ga0070712_100025026 Ga0070712_1000250264 118
49 3300013102 Ga0157371_10110468 Ga0157371_101104682 118
50 3300025898 Ga0207692_10020248 Ga0207692_100202482 118
51 3300025915 Ga0207693_10011417 Ga0207693_100114176 118
52 3300025928 Ga0207700_10137373 Ga0207700_101373732 118
53 3300025929 Ga0207664_10321600 Ga0207664_103216002 118
54 3300025939 Ga0207665_10602546 Ga0207665_106025462 118
55 3300035113 Ga0373936_0330366 Ga0373936_0330366_190_546 118
56 3300035119 Ga0373956_0234908 Ga0373956_0234908_383_739 118
57 3300035410 Ga0373924_0178208 Ga0373924_0178208_315_671 118
58 3300036401 Ga0373937_0219545 Ga0373937_0219545_516_872 118
59 3300041486 Ga0451807_0553760 Ga0451807_0553760_70_426 118
60 3300046454 Ga0495592_0073685 Ga0495592_0073685_1416_1772 118
61 3300046462 Ga0495651_0031467 Ga0495651_0031467_2116_2472 118
62 3300046463 Ga0495653_0131803 Ga0495653_0131803_211_567 118
63 3300046514 Ga0495618_0018200 Ga0495618_0018200_1493_1849 118
64 3300046516 Ga0495628_0040923 Ga0495628_0040923_801_1157 118
65 3300046517 Ga0495630_0813520 Ga0495630_0813520_133_489 118
66 3300046529 Ga0495652_0257673 Ga0495652_0257673_59_415 118
67 3300046533 Ga0495640_0062069 Ga0495640_0062069_1274_1630 118
68 3300046536 Ga0495587_0074499 Ga0495587_0074499_127_483 118
69 3300046559 Ga0495667_0028433 Ga0495667_0028433_2771_3127 118
70 3300046663 Ga0495635_0008601 Ga0495635_0008601_2754_3110 118
71 3300046679 Ga0495623_0129300 Ga0495623_0129300_477_833 118
72 3300046680 Ga0495646_0006180 Ga0495646_0006180_4490_4846 118
73 3300046689 Ga0495613_0187428 Ga0495613_0187428_292_648 118
74 3300046690 Ga0495624_0532847 Ga0495624_0532847_332_688 118
75 3300046809 Ga0495600_0010807 Ga0495600_0010807_1604_1960 118
76 3300047315 Ga0495581_0049279 Ga0495581_0049279_202_558 118
77 3300047317 Ga0495604_0002267 Ga0495604_0002267_12248_12604 118
78 3300047319 Ga0495674_0056702 Ga0495674_0056702_271_627 118
79 3300047322 Ga0495680_0006204 Ga0495680_0006204_6889_7245 118
80 3300047444 Ga0495675_0245180 Ga0495675_0245180_248_604 118
81 3300047673 Ga0495593_0230226 Ga0495593_0230226_403_759 118
82 3300048088 Ga0495602_0023601 Ga0495602_0023601_2728_3084 118
83 3300048912 Ga0496109_0055260 Ga0496109_0055260_649_1005 118
84 3300048916 Ga0496113_0573746 Ga0496113_0573746_250_606 118
85 3300053077 Ga0495601_0119496 Ga0495601_0119496_1067_1423 118
86 3300053078 Ga0495612_0350664 Ga0495612_0350664_299_655 118
87 3300053084 Ga0495595_0043747 Ga0495595_0043747_661_1017 118
88 3300044683 Ga0466965_0528501 Ga0466965_0528501_131_493 120
89 3300046810 Ga0495660_0392752 Ga0495660_0392752_12_374 120
90 iso_pu_bacteria 2886627955 2886634686 120
91 3300003323 rootH1_10230892 rootH1_102308923 121
92 3300005546 Ga0070696_100042604 Ga0070696_1000426042 121
93 3300036401 Ga0373937_0088832 Ga0373937_0088832_2076_2441 121
94 3300037471 Ga0395905_0004007 Ga0395905_0004007_8703_9068 121
95 3300047472 Ga0495686_0093108 Ga0495686_0093108_1240_1626 121
96 3300013307 Ga0157372_10135978 Ga0157372_101359782 122
97 3300039437 Ga0436365_1560335 Ga0436365_1560335_118_486 122
98 3300041451 Ga0451791_1158263 Ga0451791_1158263_2136_2504 122
99 3300041453 Ga0451797_0760379 Ga0451797_0760379_558_926 122
100 3300041460 Ga0451802_1938233 Ga0451802_1938233_308_676 122
101 3300041463 Ga0451804_0591161 Ga0451804_0591161_35_403 122
102 3300041486 Ga0451807_0131851 Ga0451807_0131851_1052_1420 122
103 iso_pu_bacteria 2617270889 2617916021 122
104 iso_pu_bacteria 642555144 642604264 122
105 iso_pu_bacteria 2831426010 2831427983 123
106 iso_pu_bacteria 2831426010 2831433272 123
107 iso_pu_bacteria 2848694841 2848701765 123
108 iso_pu_bacteria 2849660919 2849667330 123
109 iso_pu_bacteria 2913844669 2913850107 123
110 3300005339 Ga0070660_100506084 Ga0070660_1005060842 124
111 3300025909 Ga0207705_10022830 Ga0207705_100228302 124
112 3300006195 Ga0075366_10972562 Ga0075366_109725621 125
113 3300007265 Ga0099794_10135698 Ga0099794_101356982 125
114 3300013306 Ga0163162_13000935 Ga0163162_130009351 125
115 3300006178 Ga0075367_10371602 Ga0075367_103716021 126
116 3300009098 Ga0105245_11670458 Ga0105245_116704581 126
117 3300046471 Ga0495650_0108321 Ga0495650_0108321_208_588 126
118 3300046474 Ga0495605_0045000 Ga0495605_0045000_565_945 126
119 3300046501 Ga0495607_0066674 Ga0495607_0066674_283_663 126
120 3300046507 Ga0495606_0072707 Ga0495606_0072707_425_805 126
121 3300046512 Ga0495610_0048057 Ga0495610_0048057_1474_1854 126
122 3300046513 Ga0495616_0013766 Ga0495616_0013766_3307_3687 126
123 3300046518 Ga0495631_0410014 Ga0495631_0410014_129_509 126
124 3300046519 Ga0495632_0115147 Ga0495632_0115147_230_610 126
125 3300046558 Ga0495633_0063976 Ga0495633_0063976_1000_1380 126
126 3300046810 Ga0495660_0321783 Ga0495660_0321783_278_658 126
127 3300047470 Ga0495681_0155652 Ga0495681_0155652_548_928 126
128 3300049459 Ga0495678_098453 Ga0495678_098453_91_471 126
129 3300050494 nmdc:mga06z11_335694_c1 nmdc:mga06z11_335694_c1_237_617 126
130 3300050512 nmdc:mga0n895_791558_c1 nmdc:mga0n895_791558_c1_263_643 126
131 2162886007 SwRhRL2b_contig_1894069 SwRhRL2b_0927.00010550 127
132 3300005289 Ga0065704_10111953 Ga0065704_101119533 127
133 3300005290 Ga0065712_10248636 Ga0065712_102486361 127
134 3300005328 Ga0070676_10171803 Ga0070676_101718033 127
135 3300005335 Ga0070666_10142013 Ga0070666_101420132 127
136 3300005338 Ga0068868_100209468 Ga0068868_1002094682 127
137 3300005340 Ga0070689_100357299 Ga0070689_1003572991 127
138 3300005347 Ga0070668_100150675 Ga0070668_1001506752 127
139 3300005354 Ga0070675_100886058 Ga0070675_1008860582 127
140 3300005355 Ga0070671_101162719 Ga0070671_1011627191 127
141 3300005364 Ga0070673_100143810 Ga0070673_1001438102 127
142 3300005367 Ga0070667_100591714 Ga0070667_1005917141 127
143 3300005434 Ga0070709_10508154 Ga0070709_105081541 127
144 3300005435 Ga0070714_100587801 Ga0070714_1005878012 127
145 3300005436 Ga0070713_101275677 Ga0070713_1012756771 127
146 3300005437 Ga0070710_10033463 Ga0070710_100334631 127
147 3300005439 Ga0070711_100597279 Ga0070711_1005972791 127
148 3300005445 Ga0070708_100070746 Ga0070708_1000707466 127
149 3300005468 Ga0070707_102064015 Ga0070707_1020640151 127
150 3300005471 Ga0070698_100561000 Ga0070698_1005610002 127
151 3300005536 Ga0070697_100035033 Ga0070697_1000350334 127
152 3300005578 Ga0068854_102142018 Ga0068854_1021420181 127
153 3300005617 Ga0068859_100432432 Ga0068859_1004324322 127
154 3300006028 Ga0070717_10063481 Ga0070717_100634812 127
155 3300006163 Ga0070715_10641315 Ga0070715_106413151 127
156 3300006175 Ga0070712_100104011 Ga0070712_1001040113 127
157 3300006175 Ga0070712_101288487 Ga0070712_1012884871 127
158 3300006178 Ga0075367_10748317 Ga0075367_107483172 127
159 3300006871 Ga0075434_100663826 Ga0075434_1006638262 127
160 3300006931 Ga0097620_100432466 Ga0097620_1004324662 127
161 3300010159 Ga0099796_10507721 Ga0099796_105077211 127
162 3300013296 Ga0157374_10515233 Ga0157374_105152332 127
163 3300013297 Ga0157378_10826988 Ga0157378_108269882 127
164 3300013306 Ga0163162_10350077 Ga0163162_103500772 127
165 3300013307 Ga0157372_11586841 Ga0157372_115868412 127
166 3300013308 Ga0157375_10085344 Ga0157375_100853442 127
167 3300014326 Ga0157380_10532083 Ga0157380_105320832 127
168 3300014968 Ga0157379_10247368 Ga0157379_102473681 127
169 3300014968 Ga0157379_12226916 Ga0157379_122269161 127
170 3300014969 Ga0157376_10188152 Ga0157376_101881521 127
171 3300017792 Ga0163161_10280751 Ga0163161_102807511 127
172 3300025315 Ga0207697_10005836 Ga0207697_100058368 127
173 3300025901 Ga0207688_10189603 Ga0207688_101896032 127
174 3300025903 Ga0207680_10456686 Ga0207680_104566862 127
175 3300025905 Ga0207685_10013183 Ga0207685_100131832 127
176 3300025906 Ga0207699_10184790 Ga0207699_101847902 127
177 3300025907 Ga0207645_10003569 Ga0207645_100035694 127
178 3300025915 Ga0207693_10351212 Ga0207693_103512122 127
179 3300025916 Ga0207663_10282632 Ga0207663_102826321 127
180 3300025921 Ga0207652_11608459 Ga0207652_116084591 127
181 3300025926 Ga0207659_10167538 Ga0207659_101675381 127
182 3300025928 Ga0207700_10350506 Ga0207700_103505062 127
183 3300025928 Ga0207700_11481307 Ga0207700_114813071 127
184 3300025933 Ga0207706_10179683 Ga0207706_101796832 127
185 3300025939 Ga0207665_10147498 Ga0207665_101474982 127
186 3300025949 Ga0207667_10693943 Ga0207667_106939432 127
187 3300025972 Ga0207668_10579270 Ga0207668_105792702 127
188 3300026023 Ga0207677_10353174 Ga0207677_103531741 127
189 3300026078 Ga0207702_10444021 Ga0207702_104440212 127
190 3300026116 Ga0207674_11763195 Ga0207674_117631952 127
191 3300026121 Ga0207683_11462809 Ga0207683_114628091 127
192 3300031090 Ga0265760_10145715 Ga0265760_101457152 127
193 3300032004 Ga0307414_10010543 Ga0307414_100105436 127
194 3300032004 Ga0307414_10012697 Ga0307414_100126973 127
195 3300032004 Ga0307414_10019660 Ga0307414_100196608 127
196 3300032004 Ga0307414_10858118 Ga0307414_108581182 127
197 3300035111 Ga0373923_0075389 Ga0373923_0075389_815_1201 127
198 3300035724 Ga0373933_0551142 Ga0373933_0551142_37_420 127
199 3300038705 Ga0237819_09034 Ga0237819_09034_379_762 127
200 3300039437 Ga0436365_0253912 Ga0436365_0253912_141_530 127
201 3300039437 Ga0436365_0512507 Ga0436365_0512507_172_555 127
202 3300039447 Ga0436361_0225780 Ga0436361_0225780_1961_2344 127
203 3300039447 Ga0436361_0534868 Ga0436361_0534868_249_632 127
204 3300039447 Ga0436361_0777385 Ga0436361_0777385_1834_2217 127
205 3300039453 Ga0436362_0115735 Ga0436362_0115735_86_475 127
206 3300039453 Ga0436362_0851004 Ga0436362_0851004_961_1344 127
207 3300041441 Ga0451787_213985 Ga0451787_213985_57_440 127
208 3300041443 Ga0451789_0057032 Ga0451789_0057032_503_886 127
209 3300041443 Ga0451789_0762726 Ga0451789_0762726_404_787 127
210 3300041451 Ga0451791_1831018 Ga0451791_1831018_75_458 127
211 3300041452 Ga0451793_1914508 Ga0451793_1914508_102_485 127
212 3300041453 Ga0451797_0383096 Ga0451797_0383096_623_1006 127
213 3300041460 Ga0451802_1713574 Ga0451802_1713574_603_986 127
214 3300041486 Ga0451807_1852362 Ga0451807_1852362_135_548 127
215 3300041494 Ga0451837_1367605 Ga0451837_1367605_44_427 127
216 3300041509 Ga0451843_0394257 Ga0451843_0394257_531_914 127
217 3300048904 Ga0496101_0606413 Ga0496101_0606413_272_655 127
218 3300048905 Ga0496102_0018668 Ga0496102_0018668_5261_5644 127
219 3300048906 Ga0496103_0069770 Ga0496103_0069770_1172_1555 127
220 3300048909 Ga0496106_0058781 Ga0496106_0058781_1215_1598 127
221 3300048910 Ga0496107_0007674 Ga0496107_0007674_2698_3081 127
222 3300048918 Ga0496115_0089122 Ga0496115_0089122_955_1338 127
223 3300048925 Ga0496122_0107669 Ga0496122_0107669_664_1047 127
224 3300048927 Ga0496124_0933289 Ga0496124_0933289_13_396 127
225 3300049593 Ga0501077_0487363 Ga0501077_0487363_77_460 127
226 3300050514 nmdc:mga08x19_1063926_c1 nmdc:mga08x19_1063926_c1_143_526 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

26

129

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.9058 10 118
6wf4-assembly1.cif.gz_A crystal structure of terc co-crystallized with polyporic acid 0.8738 6 120
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.8638 63 110
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8619 7 121
1tuh-assembly1.cif.gz_A-2 structure of bal32a from a soil-derived mobile gene cassette 0.8555 7 118
ID Description Score Start End Superfamily
6d34B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.883 5 120 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8745 1 118 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8669 1 118 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8619 7 121 3.10.450.50
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8555 7 118 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A556MM84-F1-model_v4 Nuclear transport factor 2 family protein 0.99 10 118
AF-A0A3L9ZHF2-F1-model_v4 deleted 0.9881 10 118
AF-A0A2V7XEL8-F1-model_v4 Ketosteroid isomerase 0.986 7 119 GO:0016853
AF-A0A2E6LVU9-F1-model_v4 SnoaL-like domain-containing protein 0.9848 7 119
AF-A0A3P1BJF2-F1-model_v4 Nuclear transport factor 2 family protein 0.9847 7 118

Feature Viewer

pLDDT pTM Quality
91.28 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map