F338903
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 226 | 176 | 217 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10280751|Ga0163161_102807511 |
| Length | 141 |
| Sequence | MIVESKAKLAATPLMPDHTAPEIELLRAAYAAFNARDTDAALALMTPDVAWPQACKGGFVRGHEEVRAYWREQWSEIDPHVEPMAFHSEGAEQVLVDVHQVVRDLAGAVLADEYVGHRFTLARGLIQAMEVGPLPLSTPKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 3 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 4 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 5 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 6 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 7 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 8 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 81 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 82 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 83 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 84 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 85 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 86 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 87 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 88 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 89 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 90 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 91 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 92 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 93 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 94 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 95 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 96 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 97 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 98 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 99 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 100 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 101 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 102 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 103 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 104 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 105 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 110 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 113 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 157 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 169 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 176 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.58 |
| Metatranscriptomes | 0.44 |
| Isolates | 3.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.77 |
| Nodule | 0 |
| Rhizoplane | 12.83 |
| Rhizosphere | 77.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1894069 | 2162886007 | Bacteria | 1198 |
| 2 | rootH1_10230892 | 3300003323 | Bacteria | 2587 |
| 3 | Ga0065704_10111953 | 3300005289 | Bacteria | 1944 |
| 4 | Ga0065712_10248636 | 3300005290 | Bacteria | 958 |
| 5 | Ga0070676_10171803 | 3300005328 | Bacteria | 1403 |
| 6 | Ga0070666_10142013 | 3300005335 | Bacteria | 1672 |
| 7 | Ga0068868_100209468 | 3300005338 | Bacteria | 1629 |
| 8 | Ga0070660_100506084 | 3300005339 | Bacteria | 1005 |
| 9 | Ga0070689_100357299 | 3300005340 | Bacteria | 1227 |
| 10 | Ga0070668_100150675 | 3300005347 | Bacteria | 1880 |
| 11 | Ga0070675_100886058 | 3300005354 | Bacteria | 817 |
| 12 | Ga0070671_101162719 | 3300005355 | Bacteria | 679 |
| 13 | Ga0070673_100143810 | 3300005364 | Bacteria | 2014 |
| 14 | Ga0070667_100591714 | 3300005367 | Bacteria | 1022 |
| 15 | Ga0070709_10508154 | 3300005434 | Bacteria | 916 |
| 16 | Ga0070714_100587801 | 3300005435 | Bacteria | 1068 |
| 17 | Ga0070713_100944252 | 3300005436 | Unclassified | 830 |
| 18 | Ga0070713_101275677 | 3300005436 | Bacteria | 712 |
| 19 | Ga0070710_10013898 | 3300005437 | Bacteria | 4041 |
| 20 | Ga0070710_10033463 | 3300005437 | Bacteria | 2791 |
| 21 | Ga0070711_100125381 | 3300005439 | Bacteria | 1905 |
| 22 | Ga0070711_100597279 | 3300005439 | Bacteria | 920 |
| 23 | Ga0070708_100070746 | 3300005445 | Bacteria | 3139 |
| 24 | Ga0070707_102064015 | 3300005468 | Unclassified | 538 |
| 25 | Ga0070698_100561000 | 3300005471 | Bacteria | 1081 |
| 26 | Ga0070684_100496604 | 3300005535 | Unclassified | 1130 |
| 27 | Ga0070697_100035033 | 3300005536 | Bacteria | 4049 |
| 28 | Ga0070696_100042604 | 3300005546 | Unclassified | 3137 |
| 29 | Ga0068854_102142018 | 3300005578 | Bacteria | 517 |
| 30 | Ga0068859_100432432 | 3300005617 | Bacteria | 1413 |
| 31 | Ga0070717_10063481 | 3300006028 | Bacteria | 3066 |
| 32 | Ga0070717_10274257 | 3300006028 | Unclassified | 1494 |
| 33 | Ga0070715_10641315 | 3300006163 | Bacteria | 628 |
| 34 | Ga0070716_100635590 | 3300006173 | Bacteria | 807 |
| 35 | Ga0070712_100025026 | 3300006175 | Bacteria | 3962 |
| 36 | Ga0070712_100104011 | 3300006175 | Bacteria | 2106 |
| 37 | Ga0070712_101288487 | 3300006175 | Bacteria | 637 |
| 38 | Ga0075367_10371602 | 3300006178 | Bacteria | 903 |
| 39 | Ga0075367_10748317 | 3300006178 | Bacteria | 622 |
| 40 | Ga0075366_10972562 | 3300006195 | Bacteria | 529 |
| 41 | Ga0075434_100663826 | 3300006871 | Bacteria | 1061 |
| 42 | Ga0097620_100432466 | 3300006931 | Bacteria | 1413 |
| 43 | Ga0099794_10135698 | 3300007265 | Bacteria | 1244 |
| 44 | Ga0105245_11670458 | 3300009098 | Bacteria | 689 |
| 45 | Ga0099796_10507721 | 3300010159 | Bacteria | 540 |
| 46 | Ga0157371_10110468 | 3300013102 | Bacteria | 1951 |
| 47 | Ga0157374_10515233 | 3300013296 | Bacteria | 1201 |
| 48 | Ga0157378_10826988 | 3300013297 | Bacteria | 953 |
| 49 | Ga0163162_10350077 | 3300013306 | Bacteria | 1610 |
| 50 | Ga0163162_13000935 | 3300013306 | Bacteria | 542 |
| 51 | Ga0157372_10135978 | 3300013307 | Bacteria | 2830 |
| 52 | Ga0157372_11586841 | 3300013307 | Bacteria | 753 |
| 53 | Ga0157375_10085344 | 3300013308 | Bacteria | 3207 |
| 54 | Ga0157380_10532083 | 3300014326 | Bacteria | 1149 |
| 55 | Ga0157379_10247368 | 3300014968 | Bacteria | 1618 |
| 56 | Ga0157379_12226916 | 3300014968 | Bacteria | 545 |
| 57 | Ga0157376_10188152 | 3300014969 | Bacteria | 1891 |
| 58 | Ga0163161_10280751 | 3300017792 | Bacteria | 1306 |
| 59 | Ga0207697_10005836 | 3300025315 | Bacteria | 5660 |
| 60 | Ga0207692_10020248 | 3300025898 | Bacteria | 3022 |
| 61 | Ga0207688_10189603 | 3300025901 | Bacteria | 1229 |
| 62 | Ga0207680_10456686 | 3300025903 | Bacteria | 907 |
| 63 | Ga0207685_10013183 | 3300025905 | Bacteria | 2549 |
| 64 | Ga0207699_10184790 | 3300025906 | Bacteria | 1403 |
| 65 | Ga0207645_10003569 | 3300025907 | Bacteria | 11773 |
| 66 | Ga0207705_10022830 | 3300025909 | Bacteria | 4461 |
| 67 | Ga0207693_10011417 | 3300025915 | Bacteria | 7192 |
| 68 | Ga0207693_10351212 | 3300025915 | Bacteria | 1154 |
| 69 | Ga0207663_10282632 | 3300025916 | Bacteria | 1233 |
| 70 | Ga0207652_11608459 | 3300025921 | Bacteria | 554 |
| 71 | Ga0207659_10167538 | 3300025926 | Bacteria | 1730 |
| 72 | Ga0207700_10137373 | 3300025928 | Bacteria | 2004 |
| 73 | Ga0207700_10350506 | 3300025928 | Bacteria | 1285 |
| 74 | Ga0207700_11481307 | 3300025928 | Bacteria | 602 |
| 75 | Ga0207664_10321600 | 3300025929 | Bacteria | 1365 |
| 76 | Ga0207706_10179683 | 3300025933 | Bacteria | 1858 |
| 77 | Ga0207665_10147498 | 3300025939 | Bacteria | 1682 |
| 78 | Ga0207665_10602546 | 3300025939 | Bacteria | 858 |
| 79 | Ga0207667_10693943 | 3300025949 | Bacteria | 1021 |
| 80 | Ga0207668_10579270 | 3300025972 | Bacteria | 975 |
| 81 | Ga0207677_10353174 | 3300026023 | Bacteria | 1232 |
| 82 | Ga0207702_10444021 | 3300026078 | Bacteria | 1258 |
| 83 | Ga0207674_11763195 | 3300026116 | Bacteria | 587 |
| 84 | Ga0207683_11462809 | 3300026121 | Bacteria | 631 |
| 85 | Ga0265760_10145715 | 3300031090 | Bacteria | 774 |
| 86 | Ga0307414_10010543 | 3300032004 | Bacteria | 5370 |
| 87 | Ga0307414_10012697 | 3300032004 | Bacteria | 4992 |
| 88 | Ga0307414_10019660 | 3300032004 | Bacteria | 4191 |
| 89 | Ga0307414_10858118 | 3300032004 | Unclassified | 830 |
| 90 | Ga0373923_0075389 | 3300035111 | Bacteria | 1455 |
| 91 | Ga0373936_0330366 | 3300035113 | Bacteria | 692 |
| 92 | Ga0373956_0234908 | 3300035119 | Bacteria | 871 |
| 93 | Ga0373924_0178208 | 3300035410 | Bacteria | 935 |
| 94 | Ga0373933_0551142 | 3300035724 | Bacteria | 756 |
| 95 | Ga0373937_0088832 | 3300036401 | Bacteria | 2861 |
| 96 | Ga0373937_0219545 | 3300036401 | Bacteria | 1789 |
| 97 | Ga0395899_0135976 | 3300037312 | Bacteria | 1752 |
| 98 | Ga0395900_0040478 | 3300037418 | Bacteria | 4803 |
| 99 | Ga0395898_0007205 | 3300037466 | Bacteria | 11807 |
| 100 | Ga0395905_0004007 | 3300037471 | Bacteria | 15478 |
| 101 | Ga0395905_0154388 | 3300037471 | Bacteria | 2159 |
| 102 | Ga0395901_0005765 | 3300038443 | Bacteria | 12544 |
| 103 | Ga0237819_09034 | 3300038705 | Bacteria | 1354 |
| 104 | Ga0436365_0253912 | 3300039437 | Unclassified | 664 |
| 105 | Ga0436365_0512507 | 3300039437 | Bacteria | 701 |
| 106 | Ga0436365_1560335 | 3300039437 | Unclassified | 1044 |
| 107 | Ga0436361_0225780 | 3300039447 | Bacteria | 2640 |
| 108 | Ga0436361_0534868 | 3300039447 | Bacteria | 1824 |
| 109 | Ga0436361_0777385 | 3300039447 | Bacteria | 8776 |
| 110 | Ga0436361_1110676 | 3300039447 | Bacteria | 1114 |
| 111 | Ga0436362_0115735 | 3300039453 | Unclassified | 542 |
| 112 | Ga0436362_0851004 | 3300039453 | Unclassified | 1399 |
| 113 | Ga0451787_213985 | 3300041441 | Unclassified | 552 |
| 114 | Ga0451789_0057032 | 3300041443 | Bacteria | 1646 |
| 115 | Ga0451789_0762726 | 3300041443 | Bacteria | 1241 |
| 116 | Ga0451791_1158263 | 3300041451 | Bacteria | 3883 |
| 117 | Ga0451791_1831018 | 3300041451 | Bacteria | 519 |
| 118 | Ga0451793_1914508 | 3300041452 | Unclassified | 1088 |
| 119 | Ga0451797_0383096 | 3300041453 | Unclassified | 1496 |
| 120 | Ga0451797_0760379 | 3300041453 | Unclassified | 1173 |
| 121 | Ga0451802_1713574 | 3300041460 | Bacteria | 1062 |
| 122 | Ga0451802_1938233 | 3300041460 | Unclassified | 904 |
| 123 | Ga0451804_0591161 | 3300041463 | Unclassified | 502 |
| 124 | Ga0451807_0131851 | 3300041486 | Bacteria | 2316 |
| 125 | Ga0451807_0553760 | 3300041486 | Bacteria | 672 |
| 126 | Ga0451807_1852362 | 3300041486 | Bacteria | 606 |
| 127 | Ga0451837_1367605 | 3300041494 | Bacteria | 520 |
| 128 | Ga0451843_0394257 | 3300041509 | Unclassified | 1054 |
| 129 | Ga0466965_0528501 | 3300044683 | Unclassified | 664 |
| 130 | Ga0466966_0232540 | 3300044684 | Bacteria | 1112 |
| 131 | Ga0466966_0357226 | 3300044684 | Bacteria | 878 |
| 132 | Ga0466966_0937215 | 3300044684 | Bacteria | 522 |
| 133 | Ga0466961_0145343 | 3300044693 | Unclassified | 1483 |
| 134 | Ga0466963_0167565 | 3300044694 | Bacteria | 1530 |
| 135 | Ga0466971_0026085 | 3300044719 | Bacteria | 2610 |
| 136 | Ga0466968_0156297 | 3300044735 | Bacteria | 1050 |
| 137 | Ga0466957_0711250 | 3300044842 | Unclassified | 709 |
| 138 | Ga0466959_0172638 | 3300045049 | Bacteria | 1516 |
| 139 | Ga0466959_0510717 | 3300045049 | Bacteria | 812 |
| 140 | Ga0466959_1042749 | 3300045049 | Unclassified | 544 |
| 141 | Ga0466958_0064355 | 3300045836 | Bacteria | 2236 |
| 142 | Ga0466967_0032272 | 3300045976 | Bacteria | 4420 |
| 143 | Ga0466967_0167819 | 3300045976 | Bacteria | 2063 |
| 144 | Ga0466967_0607158 | 3300045976 | Bacteria | 1080 |
| 145 | Ga0466967_0894673 | 3300045976 | Unclassified | 883 |
| 146 | Ga0495592_0073685 | 3300046454 | Bacteria | 2482 |
| 147 | Ga0495592_0851095 | 3300046454 | Bacteria | 539 |
| 148 | Ga0495651_0031467 | 3300046462 | Bacteria | 4137 |
| 149 | Ga0495653_0131803 | 3300046463 | Bacteria | 1768 |
| 150 | Ga0495653_0321382 | 3300046463 | Bacteria | 1003 |
| 151 | Ga0495650_0108321 | 3300046471 | Unclassified | 1034 |
| 152 | Ga0495582_0401260 | 3300046473 | Bacteria | 791 |
| 153 | Ga0495605_0045000 | 3300046474 | Bacteria | 2178 |
| 154 | Ga0495607_0066674 | 3300046501 | Bacteria | 2024 |
| 155 | Ga0495606_0072707 | 3300046507 | Unclassified | 2159 |
| 156 | Ga0495610_0048057 | 3300046512 | Bacteria | 2096 |
| 157 | Ga0495616_0013766 | 3300046513 | Bacteria | 4553 |
| 158 | Ga0495618_0018200 | 3300046514 | Bacteria | 4314 |
| 159 | Ga0495618_0264221 | 3300046514 | Bacteria | 1077 |
| 160 | Ga0495628_0040923 | 3300046516 | Bacteria | 3700 |
| 161 | Ga0495630_0813520 | 3300046517 | Bacteria | 713 |
| 162 | Ga0495631_0410014 | 3300046518 | Unclassified | 577 |
| 163 | Ga0495632_0115147 | 3300046519 | Unclassified | 1260 |
| 164 | Ga0495652_0257673 | 3300046529 | Bacteria | 1289 |
| 165 | Ga0495640_0062069 | 3300046533 | Bacteria | 2536 |
| 166 | Ga0495587_0074499 | 3300046536 | Bacteria | 1971 |
| 167 | Ga0495633_0063976 | 3300046558 | Bacteria | 1720 |
| 168 | Ga0495667_0028433 | 3300046559 | Bacteria | 3764 |
| 169 | Ga0495635_0008601 | 3300046663 | Bacteria | 7127 |
| 170 | Ga0495635_0287806 | 3300046663 | Bacteria | 1103 |
| 171 | Ga0495623_0129300 | 3300046679 | Bacteria | 1514 |
| 172 | Ga0495646_0006180 | 3300046680 | Bacteria | 7597 |
| 173 | Ga0495613_0187428 | 3300046689 | Bacteria | 1463 |
| 174 | Ga0495624_0532847 | 3300046690 | Bacteria | 702 |
| 175 | Ga0495600_0010807 | 3300046809 | Bacteria | 5676 |
| 176 | Ga0495660_0321783 | 3300046810 | Unclassified | 695 |
| 177 | Ga0495660_0392752 | 3300046810 | Unclassified | 609 |
| 178 | Ga0495581_0049279 | 3300047315 | Bacteria | 2432 |
| 179 | Ga0495604_0002267 | 3300047317 | Bacteria | 15397 |
| 180 | Ga0495604_0477856 | 3300047317 | Bacteria | 811 |
| 181 | Ga0495674_0056702 | 3300047319 | Bacteria | 3430 |
| 182 | Ga0495680_0006204 | 3300047322 | Bacteria | 11140 |
| 183 | Ga0495675_0245180 | 3300047444 | Bacteria | 1077 |
| 184 | Ga0495681_0155652 | 3300047470 | Unclassified | 955 |
| 185 | Ga0495684_0486558 | 3300047471 | Bacteria | 851 |
| 186 | Ga0495686_0093108 | 3300047472 | Bacteria | 1828 |
| 187 | Ga0495593_0230226 | 3300047673 | Bacteria | 929 |
| 188 | Ga0495602_0023601 | 3300048088 | Bacteria | 5989 |
| 189 | Ga0496101_0606413 | 3300048904 | Bacteria | 865 |
| 190 | Ga0496102_0018668 | 3300048905 | Bacteria | 6099 |
| 191 | Ga0496102_0733189 | 3300048905 | Bacteria | 911 |
| 192 | Ga0496103_0069770 | 3300048906 | Bacteria | 2198 |
| 193 | Ga0496104_0070124 | 3300048907 | Bacteria | 3332 |
| 194 | Ga0496104_1159131 | 3300048907 | Bacteria | 676 |
| 195 | Ga0496106_0058781 | 3300048909 | Bacteria | 2911 |
| 196 | Ga0496107_0007674 | 3300048910 | Bacteria | 7450 |
| 197 | Ga0496107_1315256 | 3300048910 | Bacteria | 517 |
| 198 | Ga0496109_0055260 | 3300048912 | Bacteria | 3622 |
| 199 | Ga0496112_0876732 | 3300048915 | Bacteria | 820 |
| 200 | Ga0496113_0257472 | 3300048916 | Unclassified | 1394 |
| 201 | Ga0496113_0573746 | 3300048916 | Unclassified | 904 |
| 202 | Ga0496114_0259636 | 3300048917 | Unclassified | 1529 |
| 203 | Ga0496115_0089122 | 3300048918 | Bacteria | 2519 |
| 204 | Ga0496122_0107669 | 3300048925 | Bacteria | 1841 |
| 205 | Ga0496124_0933289 | 3300048927 | Bacteria | 523 |
| 206 | Ga0495678_098453 | 3300049459 | Unclassified | 1017 |
| 207 | Ga0501077_0487363 | 3300049593 | Bacteria | 790 |
| 208 | Ga0501236_027747 | 3300049670 | Bacteria | 879 |
| 209 | Ga0501261_012927 | 3300049690 | Bacteria | 1128 |
| 210 | nmdc:mga06z11_335694_c1 | 3300050494 | Bacteria | 903 |
| 211 | nmdc:mga0n895_791558_c1 | 3300050512 | Unclassified | 939 |
| 212 | nmdc:mga08x19_1063926_c1 | 3300050514 | Unclassified | 574 |
| 213 | Ga0495601_0119496 | 3300053077 | Unclassified | 1711 |
| 214 | Ga0495601_0433200 | 3300053077 | Bacteria | 851 |
| 215 | Ga0495612_0350664 | 3300053078 | Bacteria | 666 |
| 216 | Ga0495595_0043747 | 3300053084 | Bacteria | 2055 |
| 217 | Ga0466962_0091789 | 3300061719 | Bacteria | 1455 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_1315256 | Ga0496107_1315256_181_507 | 108 |
| 2 | 3300044684 | Ga0466966_0357226 | Ga0466966_0357226_183_530 | 115 |
| 3 | 3300044694 | Ga0466963_0167565 | Ga0466963_0167565_136_483 | 115 |
| 4 | 3300044842 | Ga0466957_0711250 | Ga0466957_0711250_206_553 | 115 |
| 5 | 3300045049 | Ga0466959_0172638 | Ga0466959_0172638_960_1307 | 115 |
| 6 | 3300045836 | Ga0466958_0064355 | Ga0466958_0064355_287_634 | 115 |
| 7 | 3300045976 | Ga0466967_0032272 | Ga0466967_0032272_1278_1625 | 115 |
| 8 | 3300045976 | Ga0466967_0894673 | Ga0466967_0894673_210_557 | 115 |
| 9 | 3300039447 | Ga0436361_1110676 | Ga0436361_1110676_561_911 | 116 |
| 10 | 3300044719 | Ga0466971_0026085 | Ga0466971_0026085_1933_2283 | 116 |
| 11 | 3300049690 | Ga0501261_012927 | Ga0501261_012927_552_935 | 116 |
| 12 | 3300061719 | Ga0466962_0091789 | Ga0466962_0091789_894_1244 | 116 |
| 13 | 3300005535 | Ga0070684_100496604 | Ga0070684_1004966042 | 117 |
| 14 | 3300037312 | Ga0395899_0135976 | Ga0395899_0135976_122_475 | 117 |
| 15 | 3300037418 | Ga0395900_0040478 | Ga0395900_0040478_3227_3580 | 117 |
| 16 | 3300037466 | Ga0395898_0007205 | Ga0395898_0007205_2647_3000 | 117 |
| 17 | 3300037471 | Ga0395905_0154388 | Ga0395905_0154388_1365_1718 | 117 |
| 18 | 3300038443 | Ga0395901_0005765 | Ga0395901_0005765_8643_8996 | 117 |
| 19 | 3300044684 | Ga0466966_0232540 | Ga0466966_0232540_149_502 | 117 |
| 20 | 3300044684 | Ga0466966_0937215 | Ga0466966_0937215_76_429 | 117 |
| 21 | 3300044693 | Ga0466961_0145343 | Ga0466961_0145343_207_560 | 117 |
| 22 | 3300044735 | Ga0466968_0156297 | Ga0466968_0156297_136_489 | 117 |
| 23 | 3300045049 | Ga0466959_0510717 | Ga0466959_0510717_19_372 | 117 |
| 24 | 3300045049 | Ga0466959_1042749 | Ga0466959_1042749_20_373 | 117 |
| 25 | 3300045976 | Ga0466967_0167819 | Ga0466967_0167819_1684_2037 | 117 |
| 26 | 3300045976 | Ga0466967_0607158 | Ga0466967_0607158_452_805 | 117 |
| 27 | 3300046454 | Ga0495592_0851095 | Ga0495592_0851095_38_391 | 117 |
| 28 | 3300046463 | Ga0495653_0321382 | Ga0495653_0321382_505_858 | 117 |
| 29 | 3300046473 | Ga0495582_0401260 | Ga0495582_0401260_261_614 | 117 |
| 30 | 3300046514 | Ga0495618_0264221 | Ga0495618_0264221_282_635 | 117 |
| 31 | 3300046663 | Ga0495635_0287806 | Ga0495635_0287806_421_774 | 117 |
| 32 | 3300047317 | Ga0495604_0477856 | Ga0495604_0477856_282_635 | 117 |
| 33 | 3300047471 | Ga0495684_0486558 | Ga0495684_0486558_48_401 | 117 |
| 34 | 3300048905 | Ga0496102_0733189 | Ga0496102_0733189_544_897 | 117 |
| 35 | 3300048907 | Ga0496104_0070124 | Ga0496104_0070124_1153_1506 | 117 |
| 36 | 3300048907 | Ga0496104_1159131 | Ga0496104_1159131_186_539 | 117 |
| 37 | 3300048915 | Ga0496112_0876732 | Ga0496112_0876732_329_682 | 117 |
| 38 | 3300048916 | Ga0496113_0257472 | Ga0496113_0257472_673_1026 | 117 |
| 39 | 3300048917 | Ga0496114_0259636 | Ga0496114_0259636_1155_1508 | 117 |
| 40 | 3300049670 | Ga0501236_027747 | Ga0501236_027747_161_514 | 117 |
| 41 | 3300053077 | Ga0495601_0433200 | Ga0495601_0433200_42_395 | 117 |
| 42 | iso_pu_bacteria | 2913939268 | 2913940912 | 117 |
| 43 | 3300005436 | Ga0070713_100944252 | Ga0070713_1009442522 | 118 |
| 44 | 3300005437 | Ga0070710_10013898 | Ga0070710_100138983 | 118 |
| 45 | 3300005439 | Ga0070711_100125381 | Ga0070711_1001253812 | 118 |
| 46 | 3300006028 | Ga0070717_10274257 | Ga0070717_102742572 | 118 |
| 47 | 3300006173 | Ga0070716_100635590 | Ga0070716_1006355902 | 118 |
| 48 | 3300006175 | Ga0070712_100025026 | Ga0070712_1000250264 | 118 |
| 49 | 3300013102 | Ga0157371_10110468 | Ga0157371_101104682 | 118 |
| 50 | 3300025898 | Ga0207692_10020248 | Ga0207692_100202482 | 118 |
| 51 | 3300025915 | Ga0207693_10011417 | Ga0207693_100114176 | 118 |
| 52 | 3300025928 | Ga0207700_10137373 | Ga0207700_101373732 | 118 |
| 53 | 3300025929 | Ga0207664_10321600 | Ga0207664_103216002 | 118 |
| 54 | 3300025939 | Ga0207665_10602546 | Ga0207665_106025462 | 118 |
| 55 | 3300035113 | Ga0373936_0330366 | Ga0373936_0330366_190_546 | 118 |
| 56 | 3300035119 | Ga0373956_0234908 | Ga0373956_0234908_383_739 | 118 |
| 57 | 3300035410 | Ga0373924_0178208 | Ga0373924_0178208_315_671 | 118 |
| 58 | 3300036401 | Ga0373937_0219545 | Ga0373937_0219545_516_872 | 118 |
| 59 | 3300041486 | Ga0451807_0553760 | Ga0451807_0553760_70_426 | 118 |
| 60 | 3300046454 | Ga0495592_0073685 | Ga0495592_0073685_1416_1772 | 118 |
| 61 | 3300046462 | Ga0495651_0031467 | Ga0495651_0031467_2116_2472 | 118 |
| 62 | 3300046463 | Ga0495653_0131803 | Ga0495653_0131803_211_567 | 118 |
| 63 | 3300046514 | Ga0495618_0018200 | Ga0495618_0018200_1493_1849 | 118 |
| 64 | 3300046516 | Ga0495628_0040923 | Ga0495628_0040923_801_1157 | 118 |
| 65 | 3300046517 | Ga0495630_0813520 | Ga0495630_0813520_133_489 | 118 |
| 66 | 3300046529 | Ga0495652_0257673 | Ga0495652_0257673_59_415 | 118 |
| 67 | 3300046533 | Ga0495640_0062069 | Ga0495640_0062069_1274_1630 | 118 |
| 68 | 3300046536 | Ga0495587_0074499 | Ga0495587_0074499_127_483 | 118 |
| 69 | 3300046559 | Ga0495667_0028433 | Ga0495667_0028433_2771_3127 | 118 |
| 70 | 3300046663 | Ga0495635_0008601 | Ga0495635_0008601_2754_3110 | 118 |
| 71 | 3300046679 | Ga0495623_0129300 | Ga0495623_0129300_477_833 | 118 |
| 72 | 3300046680 | Ga0495646_0006180 | Ga0495646_0006180_4490_4846 | 118 |
| 73 | 3300046689 | Ga0495613_0187428 | Ga0495613_0187428_292_648 | 118 |
| 74 | 3300046690 | Ga0495624_0532847 | Ga0495624_0532847_332_688 | 118 |
| 75 | 3300046809 | Ga0495600_0010807 | Ga0495600_0010807_1604_1960 | 118 |
| 76 | 3300047315 | Ga0495581_0049279 | Ga0495581_0049279_202_558 | 118 |
| 77 | 3300047317 | Ga0495604_0002267 | Ga0495604_0002267_12248_12604 | 118 |
| 78 | 3300047319 | Ga0495674_0056702 | Ga0495674_0056702_271_627 | 118 |
| 79 | 3300047322 | Ga0495680_0006204 | Ga0495680_0006204_6889_7245 | 118 |
| 80 | 3300047444 | Ga0495675_0245180 | Ga0495675_0245180_248_604 | 118 |
| 81 | 3300047673 | Ga0495593_0230226 | Ga0495593_0230226_403_759 | 118 |
| 82 | 3300048088 | Ga0495602_0023601 | Ga0495602_0023601_2728_3084 | 118 |
| 83 | 3300048912 | Ga0496109_0055260 | Ga0496109_0055260_649_1005 | 118 |
| 84 | 3300048916 | Ga0496113_0573746 | Ga0496113_0573746_250_606 | 118 |
| 85 | 3300053077 | Ga0495601_0119496 | Ga0495601_0119496_1067_1423 | 118 |
| 86 | 3300053078 | Ga0495612_0350664 | Ga0495612_0350664_299_655 | 118 |
| 87 | 3300053084 | Ga0495595_0043747 | Ga0495595_0043747_661_1017 | 118 |
| 88 | 3300044683 | Ga0466965_0528501 | Ga0466965_0528501_131_493 | 120 |
| 89 | 3300046810 | Ga0495660_0392752 | Ga0495660_0392752_12_374 | 120 |
| 90 | iso_pu_bacteria | 2886627955 | 2886634686 | 120 |
| 91 | 3300003323 | rootH1_10230892 | rootH1_102308923 | 121 |
| 92 | 3300005546 | Ga0070696_100042604 | Ga0070696_1000426042 | 121 |
| 93 | 3300036401 | Ga0373937_0088832 | Ga0373937_0088832_2076_2441 | 121 |
| 94 | 3300037471 | Ga0395905_0004007 | Ga0395905_0004007_8703_9068 | 121 |
| 95 | 3300047472 | Ga0495686_0093108 | Ga0495686_0093108_1240_1626 | 121 |
| 96 | 3300013307 | Ga0157372_10135978 | Ga0157372_101359782 | 122 |
| 97 | 3300039437 | Ga0436365_1560335 | Ga0436365_1560335_118_486 | 122 |
| 98 | 3300041451 | Ga0451791_1158263 | Ga0451791_1158263_2136_2504 | 122 |
| 99 | 3300041453 | Ga0451797_0760379 | Ga0451797_0760379_558_926 | 122 |
| 100 | 3300041460 | Ga0451802_1938233 | Ga0451802_1938233_308_676 | 122 |
| 101 | 3300041463 | Ga0451804_0591161 | Ga0451804_0591161_35_403 | 122 |
| 102 | 3300041486 | Ga0451807_0131851 | Ga0451807_0131851_1052_1420 | 122 |
| 103 | iso_pu_bacteria | 2617270889 | 2617916021 | 122 |
| 104 | iso_pu_bacteria | 642555144 | 642604264 | 122 |
| 105 | iso_pu_bacteria | 2831426010 | 2831427983 | 123 |
| 106 | iso_pu_bacteria | 2831426010 | 2831433272 | 123 |
| 107 | iso_pu_bacteria | 2848694841 | 2848701765 | 123 |
| 108 | iso_pu_bacteria | 2849660919 | 2849667330 | 123 |
| 109 | iso_pu_bacteria | 2913844669 | 2913850107 | 123 |
| 110 | 3300005339 | Ga0070660_100506084 | Ga0070660_1005060842 | 124 |
| 111 | 3300025909 | Ga0207705_10022830 | Ga0207705_100228302 | 124 |
| 112 | 3300006195 | Ga0075366_10972562 | Ga0075366_109725621 | 125 |
| 113 | 3300007265 | Ga0099794_10135698 | Ga0099794_101356982 | 125 |
| 114 | 3300013306 | Ga0163162_13000935 | Ga0163162_130009351 | 125 |
| 115 | 3300006178 | Ga0075367_10371602 | Ga0075367_103716021 | 126 |
| 116 | 3300009098 | Ga0105245_11670458 | Ga0105245_116704581 | 126 |
| 117 | 3300046471 | Ga0495650_0108321 | Ga0495650_0108321_208_588 | 126 |
| 118 | 3300046474 | Ga0495605_0045000 | Ga0495605_0045000_565_945 | 126 |
| 119 | 3300046501 | Ga0495607_0066674 | Ga0495607_0066674_283_663 | 126 |
| 120 | 3300046507 | Ga0495606_0072707 | Ga0495606_0072707_425_805 | 126 |
| 121 | 3300046512 | Ga0495610_0048057 | Ga0495610_0048057_1474_1854 | 126 |
| 122 | 3300046513 | Ga0495616_0013766 | Ga0495616_0013766_3307_3687 | 126 |
| 123 | 3300046518 | Ga0495631_0410014 | Ga0495631_0410014_129_509 | 126 |
| 124 | 3300046519 | Ga0495632_0115147 | Ga0495632_0115147_230_610 | 126 |
| 125 | 3300046558 | Ga0495633_0063976 | Ga0495633_0063976_1000_1380 | 126 |
| 126 | 3300046810 | Ga0495660_0321783 | Ga0495660_0321783_278_658 | 126 |
| 127 | 3300047470 | Ga0495681_0155652 | Ga0495681_0155652_548_928 | 126 |
| 128 | 3300049459 | Ga0495678_098453 | Ga0495678_098453_91_471 | 126 |
| 129 | 3300050494 | nmdc:mga06z11_335694_c1 | nmdc:mga06z11_335694_c1_237_617 | 126 |
| 130 | 3300050512 | nmdc:mga0n895_791558_c1 | nmdc:mga0n895_791558_c1_263_643 | 126 |
| 131 | 2162886007 | SwRhRL2b_contig_1894069 | SwRhRL2b_0927.00010550 | 127 |
| 132 | 3300005289 | Ga0065704_10111953 | Ga0065704_101119533 | 127 |
| 133 | 3300005290 | Ga0065712_10248636 | Ga0065712_102486361 | 127 |
| 134 | 3300005328 | Ga0070676_10171803 | Ga0070676_101718033 | 127 |
| 135 | 3300005335 | Ga0070666_10142013 | Ga0070666_101420132 | 127 |
| 136 | 3300005338 | Ga0068868_100209468 | Ga0068868_1002094682 | 127 |
| 137 | 3300005340 | Ga0070689_100357299 | Ga0070689_1003572991 | 127 |
| 138 | 3300005347 | Ga0070668_100150675 | Ga0070668_1001506752 | 127 |
| 139 | 3300005354 | Ga0070675_100886058 | Ga0070675_1008860582 | 127 |
| 140 | 3300005355 | Ga0070671_101162719 | Ga0070671_1011627191 | 127 |
| 141 | 3300005364 | Ga0070673_100143810 | Ga0070673_1001438102 | 127 |
| 142 | 3300005367 | Ga0070667_100591714 | Ga0070667_1005917141 | 127 |
| 143 | 3300005434 | Ga0070709_10508154 | Ga0070709_105081541 | 127 |
| 144 | 3300005435 | Ga0070714_100587801 | Ga0070714_1005878012 | 127 |
| 145 | 3300005436 | Ga0070713_101275677 | Ga0070713_1012756771 | 127 |
| 146 | 3300005437 | Ga0070710_10033463 | Ga0070710_100334631 | 127 |
| 147 | 3300005439 | Ga0070711_100597279 | Ga0070711_1005972791 | 127 |
| 148 | 3300005445 | Ga0070708_100070746 | Ga0070708_1000707466 | 127 |
| 149 | 3300005468 | Ga0070707_102064015 | Ga0070707_1020640151 | 127 |
| 150 | 3300005471 | Ga0070698_100561000 | Ga0070698_1005610002 | 127 |
| 151 | 3300005536 | Ga0070697_100035033 | Ga0070697_1000350334 | 127 |
| 152 | 3300005578 | Ga0068854_102142018 | Ga0068854_1021420181 | 127 |
| 153 | 3300005617 | Ga0068859_100432432 | Ga0068859_1004324322 | 127 |
| 154 | 3300006028 | Ga0070717_10063481 | Ga0070717_100634812 | 127 |
| 155 | 3300006163 | Ga0070715_10641315 | Ga0070715_106413151 | 127 |
| 156 | 3300006175 | Ga0070712_100104011 | Ga0070712_1001040113 | 127 |
| 157 | 3300006175 | Ga0070712_101288487 | Ga0070712_1012884871 | 127 |
| 158 | 3300006178 | Ga0075367_10748317 | Ga0075367_107483172 | 127 |
| 159 | 3300006871 | Ga0075434_100663826 | Ga0075434_1006638262 | 127 |
| 160 | 3300006931 | Ga0097620_100432466 | Ga0097620_1004324662 | 127 |
| 161 | 3300010159 | Ga0099796_10507721 | Ga0099796_105077211 | 127 |
| 162 | 3300013296 | Ga0157374_10515233 | Ga0157374_105152332 | 127 |
| 163 | 3300013297 | Ga0157378_10826988 | Ga0157378_108269882 | 127 |
| 164 | 3300013306 | Ga0163162_10350077 | Ga0163162_103500772 | 127 |
| 165 | 3300013307 | Ga0157372_11586841 | Ga0157372_115868412 | 127 |
| 166 | 3300013308 | Ga0157375_10085344 | Ga0157375_100853442 | 127 |
| 167 | 3300014326 | Ga0157380_10532083 | Ga0157380_105320832 | 127 |
| 168 | 3300014968 | Ga0157379_10247368 | Ga0157379_102473681 | 127 |
| 169 | 3300014968 | Ga0157379_12226916 | Ga0157379_122269161 | 127 |
| 170 | 3300014969 | Ga0157376_10188152 | Ga0157376_101881521 | 127 |
| 171 | 3300017792 | Ga0163161_10280751 | Ga0163161_102807511 | 127 |
| 172 | 3300025315 | Ga0207697_10005836 | Ga0207697_100058368 | 127 |
| 173 | 3300025901 | Ga0207688_10189603 | Ga0207688_101896032 | 127 |
| 174 | 3300025903 | Ga0207680_10456686 | Ga0207680_104566862 | 127 |
| 175 | 3300025905 | Ga0207685_10013183 | Ga0207685_100131832 | 127 |
| 176 | 3300025906 | Ga0207699_10184790 | Ga0207699_101847902 | 127 |
| 177 | 3300025907 | Ga0207645_10003569 | Ga0207645_100035694 | 127 |
| 178 | 3300025915 | Ga0207693_10351212 | Ga0207693_103512122 | 127 |
| 179 | 3300025916 | Ga0207663_10282632 | Ga0207663_102826321 | 127 |
| 180 | 3300025921 | Ga0207652_11608459 | Ga0207652_116084591 | 127 |
| 181 | 3300025926 | Ga0207659_10167538 | Ga0207659_101675381 | 127 |
| 182 | 3300025928 | Ga0207700_10350506 | Ga0207700_103505062 | 127 |
| 183 | 3300025928 | Ga0207700_11481307 | Ga0207700_114813071 | 127 |
| 184 | 3300025933 | Ga0207706_10179683 | Ga0207706_101796832 | 127 |
| 185 | 3300025939 | Ga0207665_10147498 | Ga0207665_101474982 | 127 |
| 186 | 3300025949 | Ga0207667_10693943 | Ga0207667_106939432 | 127 |
| 187 | 3300025972 | Ga0207668_10579270 | Ga0207668_105792702 | 127 |
| 188 | 3300026023 | Ga0207677_10353174 | Ga0207677_103531741 | 127 |
| 189 | 3300026078 | Ga0207702_10444021 | Ga0207702_104440212 | 127 |
| 190 | 3300026116 | Ga0207674_11763195 | Ga0207674_117631952 | 127 |
| 191 | 3300026121 | Ga0207683_11462809 | Ga0207683_114628091 | 127 |
| 192 | 3300031090 | Ga0265760_10145715 | Ga0265760_101457152 | 127 |
| 193 | 3300032004 | Ga0307414_10010543 | Ga0307414_100105436 | 127 |
| 194 | 3300032004 | Ga0307414_10012697 | Ga0307414_100126973 | 127 |
| 195 | 3300032004 | Ga0307414_10019660 | Ga0307414_100196608 | 127 |
| 196 | 3300032004 | Ga0307414_10858118 | Ga0307414_108581182 | 127 |
| 197 | 3300035111 | Ga0373923_0075389 | Ga0373923_0075389_815_1201 | 127 |
| 198 | 3300035724 | Ga0373933_0551142 | Ga0373933_0551142_37_420 | 127 |
| 199 | 3300038705 | Ga0237819_09034 | Ga0237819_09034_379_762 | 127 |
| 200 | 3300039437 | Ga0436365_0253912 | Ga0436365_0253912_141_530 | 127 |
| 201 | 3300039437 | Ga0436365_0512507 | Ga0436365_0512507_172_555 | 127 |
| 202 | 3300039447 | Ga0436361_0225780 | Ga0436361_0225780_1961_2344 | 127 |
| 203 | 3300039447 | Ga0436361_0534868 | Ga0436361_0534868_249_632 | 127 |
| 204 | 3300039447 | Ga0436361_0777385 | Ga0436361_0777385_1834_2217 | 127 |
| 205 | 3300039453 | Ga0436362_0115735 | Ga0436362_0115735_86_475 | 127 |
| 206 | 3300039453 | Ga0436362_0851004 | Ga0436362_0851004_961_1344 | 127 |
| 207 | 3300041441 | Ga0451787_213985 | Ga0451787_213985_57_440 | 127 |
| 208 | 3300041443 | Ga0451789_0057032 | Ga0451789_0057032_503_886 | 127 |
| 209 | 3300041443 | Ga0451789_0762726 | Ga0451789_0762726_404_787 | 127 |
| 210 | 3300041451 | Ga0451791_1831018 | Ga0451791_1831018_75_458 | 127 |
| 211 | 3300041452 | Ga0451793_1914508 | Ga0451793_1914508_102_485 | 127 |
| 212 | 3300041453 | Ga0451797_0383096 | Ga0451797_0383096_623_1006 | 127 |
| 213 | 3300041460 | Ga0451802_1713574 | Ga0451802_1713574_603_986 | 127 |
| 214 | 3300041486 | Ga0451807_1852362 | Ga0451807_1852362_135_548 | 127 |
| 215 | 3300041494 | Ga0451837_1367605 | Ga0451837_1367605_44_427 | 127 |
| 216 | 3300041509 | Ga0451843_0394257 | Ga0451843_0394257_531_914 | 127 |
| 217 | 3300048904 | Ga0496101_0606413 | Ga0496101_0606413_272_655 | 127 |
| 218 | 3300048905 | Ga0496102_0018668 | Ga0496102_0018668_5261_5644 | 127 |
| 219 | 3300048906 | Ga0496103_0069770 | Ga0496103_0069770_1172_1555 | 127 |
| 220 | 3300048909 | Ga0496106_0058781 | Ga0496106_0058781_1215_1598 | 127 |
| 221 | 3300048910 | Ga0496107_0007674 | Ga0496107_0007674_2698_3081 | 127 |
| 222 | 3300048918 | Ga0496115_0089122 | Ga0496115_0089122_955_1338 | 127 |
| 223 | 3300048925 | Ga0496122_0107669 | Ga0496122_0107669_664_1047 | 127 |
| 224 | 3300048927 | Ga0496124_0933289 | Ga0496124_0933289_13_396 | 127 |
| 225 | 3300049593 | Ga0501077_0487363 | Ga0501077_0487363_77_460 | 127 |
| 226 | 3300050514 | nmdc:mga08x19_1063926_c1 | nmdc:mga08x19_1063926_c1_143_526 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u13-assembly1.cif.gz_B | crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution | 0.9058 | 10 | 118 |
| 6wf4-assembly1.cif.gz_A | crystal structure of terc co-crystallized with polyporic acid | 0.8738 | 6 | 120 |
| 8hgn-assembly1.cif.gz_A | crystal structure of meac (mesaconyl-coa hydratase) | 0.8638 | 63 | 110 |
| 4kvh-assembly1.cif.gz_A-2 | crystal structure of ketosteroid isomerase fold protein hmuk_0747 | 0.8619 | 7 | 121 |
| 1tuh-assembly1.cif.gz_A-2 | structure of bal32a from a soil-derived mobile gene cassette | 0.8555 | 7 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6d34B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.883 | 5 | 120 | 3.10.450.50 |
| 4u13B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8745 | 1 | 118 | 3.10.450.50 |
| 4u13B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8669 | 1 | 118 | 3.10.450.50 |
| 4kvhA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8619 | 7 | 121 | 3.10.450.50 |
| 1tuhA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8555 | 7 | 118 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A556MM84-F1-model_v4 | Nuclear transport factor 2 family protein | 0.99 | 10 | 118 |
|
| AF-A0A3L9ZHF2-F1-model_v4 | deleted | 0.9881 | 10 | 118 |
|
| AF-A0A2V7XEL8-F1-model_v4 | Ketosteroid isomerase | 0.986 | 7 | 119 |
GO:0016853
|
| AF-A0A2E6LVU9-F1-model_v4 | SnoaL-like domain-containing protein | 0.9848 | 7 | 119 |
|
| AF-A0A3P1BJF2-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9847 | 7 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar