F338832

General Info

Members Datasets Scaffolds Average Seq Length
226 183 217 393

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10157940|Ga0105237_101579402
Length 399
Sequence VTEAMLRQPNTVDQTPASTRIGSLDRARTFITLLVVLHHSVVNYTHFGTGDKARWLGFDLIVLFNDSFFMACMFLISGLFVCESLSRRGFTNFLANRAWRLGIPFLVSIFVLMPIAYYPTFLRYHLPGTTDFNFFHFWGRIFTVGPWPSGPAWFLWVLLAFDALVALSWSLAPAAIAALGRAIHALRYRPGVAFIAFLIFSVIVYLPMRLYFGDAAWYELDDRYPLPIQTSRIFLYSGYFLVGVGIGATDLRAGIFAENGEIAARWKTWLGVALVFYGAILVLVYAHHNWVADFNAPPLSWRIGYGLAFALFSGAMVFAEPGFFLRFAKAPLRLLDAMRPNAYGIFLTHYIFIIWLQYAVYETTLSAFVKFAIVFAGTLSGSWALTVLLRKIPVIGRMI

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
5 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
6 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
7 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
84 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
168 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
169 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
170 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
174 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
177 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
178 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
179 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
180 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
181 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
182 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
183 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.96
Nodule 2.21
Rhizoplane 3.1
Rhizosphere 78.32
Stem 0
Stem Tuber 0
Unclassified 8.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10036200 3300003323 Bacteria 4603
2 Ga0070683_100051935 3300005329 Bacteria 3797
3 Ga0070683_100270003 3300005329 Bacteria 1618
4 Ga0070690_100049249 3300005330 Bacteria 2685
5 Ga0070677_10040909 3300005333 Bacteria 1827
6 Ga0070680_100086325 3300005336 Bacteria 2594
7 Ga0070692_10102385 3300005345 Bacteria 1572
8 Ga0070668_100017724 3300005347 Bacteria 5340
9 Ga0070668_100178690 3300005347 Bacteria 1732
10 Ga0070673_100143837 3300005364 Bacteria 2014
11 Ga0070713_100001422 3300005436 Bacteria 15343
12 Ga0070713_100016987 3300005436 Bacteria 5487
13 Ga0070713_100092300 3300005436 Bacteria 2606
14 Ga0070711_100020857 3300005439 Bacteria 4230
15 Ga0070663_100052565 3300005455 Bacteria 2906
16 Ga0070663_100182810 3300005455 Bacteria 1628
17 Ga0070681_10042435 3300005458 Bacteria 4558
18 Ga0070681_10235057 3300005458 Bacteria 1747
19 Ga0068867_100081717 3300005459 Bacteria 2436
20 Ga0070706_100279223 3300005467 Bacteria 1559
21 Ga0070707_100263013 3300005468 Bacteria 1678
22 Ga0070679_100055374 3300005530 Bacteria 3949
23 Ga0070679_100136536 3300005530 Bacteria 2433
24 Ga0070679_100142633 3300005530 Bacteria 2374
25 Ga0070684_100334263 3300005535 Bacteria 1392
26 Ga0070697_100172734 3300005536 Bacteria 1830
27 Ga0070693_100041909 3300005547 Bacteria 2578
28 Ga0070665_100051750 3300005548 Bacteria 4118
29 Ga0070665_100134695 3300005548 Bacteria 2472
30 Ga0068855_100038944 3300005563 Bacteria 5644
31 Ga0068854_100039524 3300005578 Bacteria 3324
32 Ga0068861_100039048 3300005719 Bacteria 3541
33 Ga0068861_100127449 3300005719 Bacteria 2061
34 Ga0068870_10060066 3300005840 Bacteria 2040
35 Ga0068860_100108000 3300005843 Bacteria 2659
36 Ga0068862_100054794 3300005844 Bacteria 3414
37 Ga0081455_10019742 3300005937 Bacteria 6366
38 Ga0081540_1057766 3300005983 Bacteria 1874
39 Ga0070717_10000329 3300006028 Bacteria 30746
40 Ga0070717_10011544 3300006028 Bacteria 6710
41 Ga0070716_100096399 3300006173 Bacteria 1803
42 Ga0068871_100203784 3300006358 Bacteria 1709
43 Ga0068865_100061465 3300006881 Bacteria 2634
44 Ga0099794_10038225 3300007265 Bacteria 2273
45 Ga0099794_10062383 3300007265 Bacteria 1812
46 Ga0099794_10074951 3300007265 Bacteria 1662
47 Ga0099795_10029544 3300007788 Bacteria 1874
48 Ga0105240_10004081 3300009093 Bacteria 22462
49 Ga0105240_10129425 3300009093 Bacteria 3029
50 Ga0105243_10025828 3300009148 Bacteria 4492
51 Ga0105248_10291575 3300009177 Bacteria 1837
52 Ga0105237_10157940 3300009545 Bacteria 2265
53 Ga0105238_10027903 3300009551 Bacteria 5753
54 Ga0105238_10046731 3300009551 Bacteria 4366
55 Ga0105238_10195197 3300009551 Bacteria 2000
56 Ga0105239_10070172 3300010375 Bacteria 3849
57 Ga0157370_10137978 3300013104 Bacteria 2272
58 Ga0157369_10004364 3300013105 Bacteria 16692
59 Ga0157369_10011444 3300013105 Bacteria 10076
60 Ga0163162_10178172 3300013306 Bacteria 2251
61 Ga0163162_10237893 3300013306 Bacteria 1951
62 Ga0157372_10365871 3300013307 Bacteria 1680
63 Ga0163161_10092182 3300017792 Bacteria 2243
64 Ga0207645_10016440 3300025907 Bacteria 4898
65 Ga0207643_10014727 3300025908 Bacteria 4253
66 Ga0207684_10044736 3300025910 Bacteria 3755
67 Ga0207654_10034890 3300025911 Bacteria 2798
68 Ga0207707_10001341 3300025912 Bacteria 22930
69 Ga0207707_10048999 3300025912 Bacteria 3681
70 Ga0207707_10060291 3300025912 Bacteria 3301
71 Ga0207707_10061520 3300025912 Bacteria 3266
72 Ga0207695_10040362 3300025913 Bacteria 5006
73 Ga0207693_10021310 3300025915 Bacteria 5150
74 Ga0207660_10023116 3300025917 Bacteria 4195
75 Ga0207660_10031222 3300025917 Bacteria 3666
76 Ga0207652_10019365 3300025921 Bacteria 5597
77 Ga0207652_10183914 3300025921 Bacteria 1879
78 Ga0207694_10226383 3300025924 Bacteria 1526
79 Ga0207700_10161583 3300025928 Bacteria 1861
80 Ga0207704_10109936 3300025938 Bacteria 1861
81 Ga0207665_10087755 3300025939 Bacteria 2151
82 Ga0207691_10049732 3300025940 Bacteria 3841
83 Ga0207689_10030856 3300025942 Bacteria 4466
84 Ga0207661_10000159 3300025944 Bacteria 43412
85 Ga0207667_10254120 3300025949 Bacteria 1798
86 Ga0207651_10033668 3300025960 Bacteria 3308
87 Ga0207712_10197468 3300025961 Bacteria 1593
88 Ga0207712_10237808 3300025961 Bacteria 1466
89 Ga0207668_10121113 3300025972 Bacteria 1981
90 Ga0207640_10044261 3300025981 Bacteria 2851
91 Ga0207639_10218149 3300026041 Bacteria 1646
92 Ga0207678_10104561 3300026067 Bacteria 2416
93 Ga0207678_10220930 3300026067 Bacteria 1622
94 Ga0207648_10020359 3300026089 Bacteria 5975
95 Ga0207675_100135112 3300026118 Bacteria 2339
96 Ga0209179_1011838 3300027512 Bacteria 1555
97 Ga0268266_10035062 3300028379 Bacteria 4267
98 Ga0268266_10065619 3300028379 Bacteria 3138
99 Ga0268265_10034107 3300028380 Bacteria 3707
100 Ga0268265_10077993 3300028380 Bacteria 2604
101 Ga0265326_10003400 3300028558 Bacteria 5215
102 Ga0265319_1016981 3300028563 Bacteria 2780
103 Ga0265334_10004112 3300028573 Bacteria 6519
104 Ga0265322_10015235 3300028654 Bacteria 2222
105 Ga0265336_10001567 3300028666 Bacteria 10262
106 Ga0307515_10228605 3300028794 Bacteria 1659
107 Ga0265338_10000034 3300028800 Bacteria 244623
108 Ga0265324_10006370 3300029957 Bacteria 4930
109 Ga0307508_10099482 3300031616 Bacteria 2502
110 Ga0307516_10039342 3300031730 Bacteria 4714
111 Ga0307415_100261978 3300032126 Bacteria 1411
112 Ga0373936_0003181 3300035113 Bacteria 6150
113 Ga0373943_0031508 3300035170 Bacteria 2516
114 Ga0373931_0070290 3300035691 Bacteria 1910
115 Ga0373935_0000671 3300035692 Bacteria 18055
116 Ga0373927_0006578 3300035695 Bacteria 7915
117 Ga0373927_0055231 3300035695 Bacteria 2568
118 Ga0373933_0000017 3300035724 Bacteria 100816
119 Ga0373947_0016610 3300035725 Bacteria 4229
120 Ga0373937_0119619 3300036401 Bacteria 2454
121 Ga0373925_0464868 3300037068 Bacteria 1037
122 Ga0395900_0009818 3300037418 Bacteria 9807
123 Ga0395900_0356072 3300037418 Bacteria 1436
124 Ga0395905_0227796 3300037471 Bacteria 1743
125 Ga0436361_0720337 3300039447 Bacteria 2338
126 Ga0436362_1022555 3300039453 Bacteria 3482
127 Ga0466969_0072306 3300044656 Bacteria 1657
128 Ga0466963_0231056 3300044694 Bacteria 1296
129 Ga0466959_0018208 3300045049 Bacteria 5156
130 Ga0495592_0004997 3300046454 Bacteria 9764
131 Ga0495603_0033633 3300046455 Bacteria 3084
132 Ga0495629_0015109 3300046459 Bacteria 5550
133 Ga0495638_0087629 3300046460 Bacteria 1880
134 Ga0495641_0041662 3300046461 Bacteria 2132
135 Ga0495651_0209344 3300046462 Bacteria 1358
136 Ga0495580_0018667 3300046472 Bacteria 5161
137 Ga0495639_0008174 3300046475 Bacteria 4493
138 Ga0495662_0001398 3300046476 Bacteria 11971
139 Ga0495662_0070787 3300046476 Bacteria 1690
140 Ga0495664_0008348 3300046477 Bacteria 5776
141 Ga0495664_0085811 3300046477 Bacteria 1890
142 Ga0495594_0032244 3300046499 Bacteria 2843
143 Ga0495618_0149176 3300046514 Bacteria 1494
144 Ga0495628_0110488 3300046516 Bacteria 2115
145 Ga0495630_0011377 3300046517 Bacteria 6443
146 Ga0495644_0006286 3300046523 Bacteria 4615
147 Ga0495648_0000649 3300046524 Bacteria 37131
148 Ga0495665_0029644 3300046531 Bacteria 2931
149 Ga0495640_0033205 3300046533 Bacteria 3668
150 Ga0495640_0097069 3300046533 Bacteria 1938
151 Ga0495598_0002857 3300046537 Bacteria 3608
152 Ga0495621_0007337 3300046539 Bacteria 3261
153 Ga0495645_0008632 3300046543 Bacteria 7115
154 Ga0495656_0008484 3300046615 Bacteria 3669
155 Ga0495634_0015154 3300046642 Bacteria 5542
156 Ga0495611_0011752 3300046648 Bacteria 3715
157 Ga0495611_0042349 3300046648 Bacteria 2033
158 Ga0495625_0151021 3300046660 Bacteria 1562
159 Ga0495659_0063347 3300046664 Bacteria 1370
160 Ga0495588_0007627 3300046674 Bacteria 4938
161 Ga0495588_0015664 3300046674 Bacteria 3654
162 Ga0495646_0023667 3300046680 Bacteria 3866
163 Ga0495647_0028410 3300046681 Bacteria 2062
164 Ga0495658_0036986 3300046683 Bacteria 2696
165 Ga0495669_0004907 3300046684 Bacteria 5551
166 Ga0495613_0021482 3300046689 Bacteria 4810
167 Ga0495624_0019160 3300046690 Bacteria 4571
168 Ga0495670_0044225 3300046691 Bacteria 2223
169 Ga0495660_0183971 3300046810 Bacteria 1009
170 Ga0495674_0001841 3300047319 Bacteria 20895
171 Ga0495676_0050020 3300047321 Bacteria 3355
172 Ga0495685_020649 3300047447 Bacteria 2264
173 Ga0495684_0181059 3300047471 Bacteria 1562
174 Ga0495593_0022999 3300047673 Bacteria 3467
175 Ga0496106_0452150 3300048909 Bacteria 1032
176 Ga0496109_0050222 3300048912 Bacteria 3799
177 Ga0496110_0108115 3300048913 Bacteria 2497
178 Ga0496110_0294887 3300048913 Bacteria 1477
179 Ga0496112_0074401 3300048915 Bacteria 3359
180 Ga0496112_0262477 3300048915 Bacteria 1676
181 Ga0496115_0188511 3300048918 Bacteria 1704
182 Ga0496119_0053364 3300048922 Bacteria 2470
183 Ga0496121_0000473 3300048924 Bacteria 78228
184 Ga0496121_0073486 3300048924 Bacteria 2740
185 Ga0496121_0149557 3300048924 Bacteria 1720
186 Ga0496122_0040571 3300048925 Bacteria 3697
187 Ga0496124_0035464 3300048927 Bacteria 4364
188 Ga0496125_0037304 3300048928 Bacteria 4227
189 Ga0496126_0005846 3300048929 Bacteria 13893
190 Ga0496126_0008349 3300048929 Bacteria 11177
191 Ga0496126_0009950 3300048929 Bacteria 10041
192 Ga0496126_0060948 3300048929 Bacteria 3391
193 Ga0501047_0152848 3300049581 Bacteria 2183
194 Ga0501070_0013043 3300049586 Bacteria 7003
195 Ga0501074_0019898 3300049590 Bacteria 4876
196 Ga0501080_0027468 3300049742 Bacteria 5292
197 Ga0501044_0031224 3300049823 Bacteria 5608
198 nmdc:mga08y16_175776_c1 3300050511 Bacteria 2223
199 Ga0495612_0008800 3300053078 Bacteria 4093
200 Ga0500583_0084927 3300053092 Bacteria 1534
201 Ga0500566_0002691 3300053094 Bacteria 10590
202 Ga0500566_0066648 3300053094 Bacteria 2028
203 Ga0500640_004355 3300053095 Bacteria 5130
204 Ga0500572_000826 3300053111 Bacteria 9761
205 Ga0500591_008979 3300053115 Bacteria 4681
206 Ga0500595_000436 3300053119 Bacteria 25986
207 Ga0500608_043334 3300053122 Bacteria 2161
208 Ga0500614_003856 3300053123 Bacteria 3203
209 Ga0500561_0021088 3300053137 Bacteria 1532
210 Ga0500577_0062943 3300053142 Bacteria 1432
211 Ga0500603_000871 3300053150 Bacteria 7198
212 Ga0500634_0046218 3300053161 Bacteria 2353
213 Ga0500638_000804 3300053162 Bacteria 8637
214 Ga0500637_0000068 3300053178 Bacteria 37212
215 Ga0500637_0008117 3300053178 Bacteria 5281
216 Ga0500596_003136 3300053735 Bacteria 3178
217 Ga0500661_000406 3300055283 Bacteria 7980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046810 Ga0495660_0183971 Ga0495660_0183971_10_990 325
2 3300037068 Ga0373925_0464868 Ga0373925_0464868_32_1021 328
3 3300048909 Ga0496106_0452150 Ga0496106_0452150_13_1002 328
4 3300007788 Ga0099795_10029544 Ga0099795_100295443 345
5 3300046462 Ga0495651_0209344 Ga0495651_0209344_284_1324 345
6 3300039447 Ga0436361_0720337 Ga0436361_0720337_194_1381 375
7 3300053137 Ga0500561_0021088 Ga0500561_0021088_368_1501 376
8 3300048925 Ga0496122_0040571 Ga0496122_0040571_2085_3302 378
9 3300048929 Ga0496126_0008349 Ga0496126_0008349_4270_5487 378
10 3300006173 Ga0070716_100096399 Ga0070716_1000963992 382
11 3300025915 Ga0207693_10021310 Ga0207693_100213103 382
12 3300039453 Ga0436362_1022555 Ga0436362_1022555_1450_2637 382
13 3300048918 Ga0496115_0188511 Ga0496115_0188511_100_1251 382
14 3300048912 Ga0496109_0050222 Ga0496109_0050222_712_1866 383
15 3300048913 Ga0496110_0108115 Ga0496110_0108115_1169_2323 383
16 3300048915 Ga0496112_0262477 Ga0496112_0262477_404_1558 383
17 3300049586 Ga0501070_0013043 Ga0501070_0013043_2731_3915 383
18 3300049590 Ga0501074_0019898 Ga0501074_0019898_1371_2555 383
19 3300049823 Ga0501044_0031224 Ga0501044_0031224_586_1770 383
20 3300028558 Ga0265326_10003400 Ga0265326_100034005 387
21 3300028563 Ga0265319_1016981 Ga0265319_10169812 387
22 3300028573 Ga0265334_10004112 Ga0265334_100041122 387
23 3300028654 Ga0265322_10015235 Ga0265322_100152351 387
24 3300028666 Ga0265336_10001567 Ga0265336_100015672 387
25 3300028800 Ga0265338_10000034 Ga0265338_10000034135 387
26 3300029957 Ga0265324_10006370 Ga0265324_100063701 387
27 3300037471 Ga0395905_0227796 Ga0395905_0227796_465_1649 387
28 3300048929 Ga0496126_0060948 Ga0496126_0060948_1178_2347 387
29 iso_pu_bacteria 2513237141 2513887925 390
30 iso_pu_bacteria 2524023210 2524466293 390
31 iso_pu_bacteria 2879110137 2879111966 390
32 iso_pu_bacteria 2885383462 2885387967 390
33 iso_pu_bacteria 2903768456 2903777336 390
34 iso_pu_bacteria 8056681323 8056686025 390
35 3300048913 Ga0496110_0294887 Ga0496110_0294887_104_1309 391
36 3300048915 Ga0496112_0074401 Ga0496112_0074401_833_2038 391
37 3300005329 Ga0070683_100270003 Ga0070683_1002700031 392
38 3300005455 Ga0070663_100052565 Ga0070663_1000525651 392
39 3300006028 Ga0070717_10011544 Ga0070717_100115443 392
40 3300037418 Ga0395900_0356072 Ga0395900_0356072_197_1381 392
41 3300005439 Ga0070711_100020857 Ga0070711_1000208573 393
42 3300005563 Ga0068855_100038944 Ga0068855_1000389444 393
43 3300009545 Ga0105237_10157940 Ga0105237_101579402 393
44 3300009551 Ga0105238_10027903 Ga0105238_100279036 393
45 3300010375 Ga0105239_10070172 Ga0105239_100701722 393
46 3300025939 Ga0207665_10087755 Ga0207665_100877552 393
47 3300046477 Ga0495664_0008348 Ga0495664_0008348_2092_3276 393
48 3300046543 Ga0495645_0008632 Ga0495645_0008632_3206_4390 393
49 3300048924 Ga0496121_0000473 Ga0496121_0000473_32892_34079 393
50 3300049742 Ga0501080_0027468 Ga0501080_0027468_1421_2605 393
51 3300053078 Ga0495612_0008800 Ga0495612_0008800_1153_2337 393
52 3300005329 Ga0070683_100051935 Ga0070683_1000519352 394
53 3300005330 Ga0070690_100049249 Ga0070690_1000492492 394
54 3300005333 Ga0070677_10040909 Ga0070677_100409092 394
55 3300005336 Ga0070680_100086325 Ga0070680_1000863252 394
56 3300005345 Ga0070692_10102385 Ga0070692_101023851 394
57 3300005347 Ga0070668_100017724 Ga0070668_1000177245 394
58 3300005347 Ga0070668_100178690 Ga0070668_1001786902 394
59 3300005364 Ga0070673_100143837 Ga0070673_1001438372 394
60 3300005436 Ga0070713_100001422 Ga0070713_1000014224 394
61 3300005436 Ga0070713_100016987 Ga0070713_1000169873 394
62 3300005436 Ga0070713_100092300 Ga0070713_1000923002 394
63 3300005455 Ga0070663_100182810 Ga0070663_1001828102 394
64 3300005458 Ga0070681_10042435 Ga0070681_100424354 394
65 3300005458 Ga0070681_10235057 Ga0070681_102350572 394
66 3300005459 Ga0068867_100081717 Ga0068867_1000817172 394
67 3300005467 Ga0070706_100279223 Ga0070706_1002792232 394
68 3300005468 Ga0070707_100263013 Ga0070707_1002630132 394
69 3300005530 Ga0070679_100055374 Ga0070679_1000553741 394
70 3300005530 Ga0070679_100136536 Ga0070679_1001365363 394
71 3300005530 Ga0070679_100142633 Ga0070679_1001426332 394
72 3300005535 Ga0070684_100334263 Ga0070684_1003342631 394
73 3300005536 Ga0070697_100172734 Ga0070697_1001727342 394
74 3300005547 Ga0070693_100041909 Ga0070693_1000419092 394
75 3300005548 Ga0070665_100051750 Ga0070665_1000517502 394
76 3300005548 Ga0070665_100134695 Ga0070665_1001346952 394
77 3300005578 Ga0068854_100039524 Ga0068854_1000395243 394
78 3300005719 Ga0068861_100039048 Ga0068861_1000390482 394
79 3300005719 Ga0068861_100127449 Ga0068861_1001274492 394
80 3300005840 Ga0068870_10060066 Ga0068870_100600662 394
81 3300005843 Ga0068860_100108000 Ga0068860_1001080002 394
82 3300005844 Ga0068862_100054794 Ga0068862_1000547942 394
83 3300005937 Ga0081455_10019742 Ga0081455_100197424 394
84 3300005983 Ga0081540_1057766 Ga0081540_10577661 394
85 3300006028 Ga0070717_10000329 Ga0070717_1000032928 394
86 3300006358 Ga0068871_100203784 Ga0068871_1002037842 394
87 3300006881 Ga0068865_100061465 Ga0068865_1000614652 394
88 3300007265 Ga0099794_10038225 Ga0099794_100382254 394
89 3300007265 Ga0099794_10062383 Ga0099794_100623832 394
90 3300007265 Ga0099794_10074951 Ga0099794_100749511 394
91 3300009093 Ga0105240_10004081 Ga0105240_100040819 394
92 3300009093 Ga0105240_10129425 Ga0105240_101294253 394
93 3300009148 Ga0105243_10025828 Ga0105243_100258282 394
94 3300009177 Ga0105248_10291575 Ga0105248_102915751 394
95 3300009551 Ga0105238_10195197 Ga0105238_101951972 394
96 3300013104 Ga0157370_10137978 Ga0157370_101379782 394
97 3300013105 Ga0157369_10004364 Ga0157369_100043642 394
98 3300013105 Ga0157369_10011444 Ga0157369_100114445 394
99 3300013306 Ga0163162_10178172 Ga0163162_101781722 394
100 3300013306 Ga0163162_10237893 Ga0163162_102378932 394
101 3300013307 Ga0157372_10365871 Ga0157372_103658711 394
102 3300017792 Ga0163161_10092182 Ga0163161_100921822 394
103 3300025907 Ga0207645_10016440 Ga0207645_100164404 394
104 3300025908 Ga0207643_10014727 Ga0207643_100147273 394
105 3300025910 Ga0207684_10044736 Ga0207684_100447363 394
106 3300025911 Ga0207654_10034890 Ga0207654_100348902 394
107 3300025912 Ga0207707_10001341 Ga0207707_1000134111 394
108 3300025912 Ga0207707_10048999 Ga0207707_100489992 394
109 3300025912 Ga0207707_10060291 Ga0207707_100602913 394
110 3300025912 Ga0207707_10061520 Ga0207707_100615203 394
111 3300025913 Ga0207695_10040362 Ga0207695_100403623 394
112 3300025917 Ga0207660_10023116 Ga0207660_100231164 394
113 3300025917 Ga0207660_10031222 Ga0207660_100312222 394
114 3300025921 Ga0207652_10019365 Ga0207652_100193655 394
115 3300025921 Ga0207652_10183914 Ga0207652_101839141 394
116 3300025924 Ga0207694_10226383 Ga0207694_102263831 394
117 3300025928 Ga0207700_10161583 Ga0207700_101615832 394
118 3300025938 Ga0207704_10109936 Ga0207704_101099361 394
119 3300025940 Ga0207691_10049732 Ga0207691_100497322 394
120 3300025942 Ga0207689_10030856 Ga0207689_100308562 394
121 3300025944 Ga0207661_10000159 Ga0207661_1000015935 394
122 3300025949 Ga0207667_10254120 Ga0207667_102541201 394
123 3300025960 Ga0207651_10033668 Ga0207651_100336682 394
124 3300025961 Ga0207712_10197468 Ga0207712_101974682 394
125 3300025961 Ga0207712_10237808 Ga0207712_102378082 394
126 3300025972 Ga0207668_10121113 Ga0207668_101211132 394
127 3300025981 Ga0207640_10044261 Ga0207640_100442612 394
128 3300026041 Ga0207639_10218149 Ga0207639_102181492 394
129 3300026067 Ga0207678_10104561 Ga0207678_101045612 394
130 3300026067 Ga0207678_10220930 Ga0207678_102209302 394
131 3300026089 Ga0207648_10020359 Ga0207648_100203592 394
132 3300026118 Ga0207675_100135112 Ga0207675_1001351122 394
133 3300027512 Ga0209179_1011838 Ga0209179_10118381 394
134 3300028379 Ga0268266_10035062 Ga0268266_100350624 394
135 3300028379 Ga0268266_10065619 Ga0268266_100656192 394
136 3300028380 Ga0268265_10034107 Ga0268265_100341074 394
137 3300028380 Ga0268265_10077993 Ga0268265_100779932 394
138 3300028794 Ga0307515_10228605 Ga0307515_102286052 394
139 3300031616 Ga0307508_10099482 Ga0307508_100994822 394
140 3300031730 Ga0307516_10039342 Ga0307516_100393422 394
141 3300032126 Ga0307415_100261978 Ga0307415_1002619782 394
142 3300035113 Ga0373936_0003181 Ga0373936_0003181_1247_2434 394
143 3300035170 Ga0373943_0031508 Ga0373943_0031508_251_1438 394
144 3300035691 Ga0373931_0070290 Ga0373931_0070290_329_1516 394
145 3300035692 Ga0373935_0000671 Ga0373935_0000671_186_1373 394
146 3300035695 Ga0373927_0006578 Ga0373927_0006578_1866_3053 394
147 3300035695 Ga0373927_0055231 Ga0373927_0055231_865_2052 394
148 3300035724 Ga0373933_0000017 Ga0373933_0000017_27097_28287 394
149 3300035725 Ga0373947_0016610 Ga0373947_0016610_1154_2341 394
150 3300036401 Ga0373937_0119619 Ga0373937_0119619_1088_2275 394
151 3300037418 Ga0395900_0009818 Ga0395900_0009818_358_1545 394
152 3300044656 Ga0466969_0072306 Ga0466969_0072306_406_1593 394
153 3300045049 Ga0466959_0018208 Ga0466959_0018208_2934_4121 394
154 3300046454 Ga0495592_0004997 Ga0495592_0004997_7968_9155 394
155 3300046455 Ga0495603_0033633 Ga0495603_0033633_253_1440 394
156 3300046459 Ga0495629_0015109 Ga0495629_0015109_180_1367 394
157 3300046460 Ga0495638_0087629 Ga0495638_0087629_415_1602 394
158 3300046461 Ga0495641_0041662 Ga0495641_0041662_662_1849 394
159 3300046472 Ga0495580_0018667 Ga0495580_0018667_1457_2644 394
160 3300046475 Ga0495639_0008174 Ga0495639_0008174_154_1341 394
161 3300046476 Ga0495662_0001398 Ga0495662_0001398_4165_5352 394
162 3300046476 Ga0495662_0070787 Ga0495662_0070787_347_1534 394
163 3300046477 Ga0495664_0085811 Ga0495664_0085811_309_1496 394
164 3300046499 Ga0495594_0032244 Ga0495594_0032244_1271_2473 394
165 3300046514 Ga0495618_0149176 Ga0495618_0149176_276_1463 394
166 3300046516 Ga0495628_0110488 Ga0495628_0110488_272_1459 394
167 3300046517 Ga0495630_0011377 Ga0495630_0011377_4955_6142 394
168 3300046523 Ga0495644_0006286 Ga0495644_0006286_865_2052 394
169 3300046524 Ga0495648_0000649 Ga0495648_0000649_25556_26743 394
170 3300046531 Ga0495665_0029644 Ga0495665_0029644_1602_2789 394
171 3300046533 Ga0495640_0033205 Ga0495640_0033205_326_1513 394
172 3300046533 Ga0495640_0097069 Ga0495640_0097069_131_1318 394
173 3300046537 Ga0495598_0002857 Ga0495598_0002857_607_1794 394
174 3300046539 Ga0495621_0007337 Ga0495621_0007337_1807_2994 394
175 3300046615 Ga0495656_0008484 Ga0495656_0008484_495_1682 394
176 3300046642 Ga0495634_0015154 Ga0495634_0015154_2101_3288 394
177 3300046648 Ga0495611_0011752 Ga0495611_0011752_1751_2938 394
178 3300046648 Ga0495611_0042349 Ga0495611_0042349_250_1437 394
179 3300046660 Ga0495625_0151021 Ga0495625_0151021_291_1478 394
180 3300046664 Ga0495659_0063347 Ga0495659_0063347_122_1309 394
181 3300046674 Ga0495588_0007627 Ga0495588_0007627_758_1945 394
182 3300046674 Ga0495588_0015664 Ga0495588_0015664_1963_3150 394
183 3300046680 Ga0495646_0023667 Ga0495646_0023667_2216_3403 394
184 3300046681 Ga0495647_0028410 Ga0495647_0028410_595_1782 394
185 3300046683 Ga0495658_0036986 Ga0495658_0036986_566_1753 394
186 3300046684 Ga0495669_0004907 Ga0495669_0004907_1862_3049 394
187 3300046689 Ga0495613_0021482 Ga0495613_0021482_1990_3177 394
188 3300046690 Ga0495624_0019160 Ga0495624_0019160_2417_3604 394
189 3300046691 Ga0495670_0044225 Ga0495670_0044225_281_1468 394
190 3300047319 Ga0495674_0001841 Ga0495674_0001841_182_1369 394
191 3300047321 Ga0495676_0050020 Ga0495676_0050020_2150_3337 394
192 3300047447 Ga0495685_020649 Ga0495685_020649_92_1279 394
193 3300047471 Ga0495684_0181059 Ga0495684_0181059_281_1468 394
194 3300047673 Ga0495593_0022999 Ga0495593_0022999_865_2052 394
195 3300048922 Ga0496119_0053364 Ga0496119_0053364_1189_2376 394
196 3300048924 Ga0496121_0073486 Ga0496121_0073486_484_1671 394
197 3300048924 Ga0496121_0149557 Ga0496121_0149557_109_1296 394
198 3300048927 Ga0496124_0035464 Ga0496124_0035464_2345_3532 394
199 3300048928 Ga0496125_0037304 Ga0496125_0037304_843_2030 394
200 3300048929 Ga0496126_0005846 Ga0496126_0005846_6512_7696 394
201 3300048929 Ga0496126_0009950 Ga0496126_0009950_1487_2674 394
202 3300049581 Ga0501047_0152848 Ga0501047_0152848_555_1742 394
203 3300050511 nmdc:mga08y16_175776_c1 nmdc:mga08y16_175776_c1_598_1785 394
204 3300053092 Ga0500583_0084927 Ga0500583_0084927_190_1377 394
205 3300053094 Ga0500566_0002691 Ga0500566_0002691_6106_7293 394
206 3300053094 Ga0500566_0066648 Ga0500566_0066648_151_1338 394
207 3300053095 Ga0500640_004355 Ga0500640_004355_1944_3131 394
208 3300053111 Ga0500572_000826 Ga0500572_000826_5289_6476 394
209 3300053115 Ga0500591_008979 Ga0500591_008979_1964_3151 394
210 3300053119 Ga0500595_000436 Ga0500595_000436_17321_18508 394
211 3300053122 Ga0500608_043334 Ga0500608_043334_692_1879 394
212 3300053123 Ga0500614_003856 Ga0500614_003856_717_1904 394
213 3300053142 Ga0500577_0062943 Ga0500577_0062943_169_1356 394
214 3300053150 Ga0500603_000871 Ga0500603_000871_2754_3941 394
215 3300053161 Ga0500634_0046218 Ga0500634_0046218_935_2122 394
216 3300053162 Ga0500638_000804 Ga0500638_000804_4119_5306 394
217 3300053178 Ga0500637_0000068 Ga0500637_0000068_23302_24489 394
218 3300053178 Ga0500637_0008117 Ga0500637_0008117_2393_3580 394
219 3300053735 Ga0500596_003136 Ga0500596_003136_32_1219 394
220 3300055283 Ga0500661_000406 Ga0500661_000406_2457_3644 394
221 iso_pu_bacteria 2513237098 2513678473 394
222 iso_pu_bacteria 2876808645 2876808698 394
223 iso_pu_bacteria 8006984368 8006989944 394
224 3300003323 rootH1_10036200 rootH1_100362002 398
225 3300009551 Ga0105238_10046731 Ga0105238_100467312 398
226 3300044694 Ga0466963_0231056 Ga0466963_0231056_38_1237 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01757

Acyl_transf_3

Acyltransferase family

21

387

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c03-assembly1.cif.gz_A structure of slc40/ferroportin in complex with vamifeport and synthetic nanobody sy12 in outward-facing conformation 0.2513 19 390
1xwm-assembly1.cif.gz_A-2 the crystal structure of phou (phosphate uptake regulator), structural genomics 0.2449 56 325
8c03-assembly1.cif.gz_A structure of slc40/ferroportin in complex with vamifeport and synthetic nanobody sy12 in outward-facing conformation 0.2388 19 390
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.2382 8 378
1xwm-assembly1.cif.gz_A-2 the crystal structure of phou (phosphate uptake regulator), structural genomics 0.2371 56 325
ID Description Score Start End Superfamily
af_Q4DVR4_17_534_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3724 191 375 1.20.1250.20
af_D3Z9X5_173_361_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3647 184 397 1.20.1250.20
af_D3Z9X5_173_361_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3578 184 397 1.20.1250.20
af_Q54K81_1900_2062_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.3477 258 395 1.20.1420.10
af_Q54K81_1148_1297_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.3362 255 398 1.20.1420.10
ID Description Score Start End GO Terms
AF-A0A1H1TL33-F1-model_v4 Acyltransferase family protein 0.9368 17 398 GO:0016020
GO:0016747
AF-A0A0Q6ZCC3-F1-model_v4 Acyltransferase 0.9279 17 398 GO:0016020
GO:0016747
AF-A0A1H1TL33-F1-model_v4 Acyltransferase family protein 0.9249 17 398 GO:0016020
GO:0016747
AF-A0A0Q6ZCC3-F1-model_v4 Acyltransferase 0.9184 17 398 GO:0016020
GO:0016747
AF-A0A7W6SWS3-F1-model_v4 Surface polysaccharide O-acyltransferase-like enzyme 0.9178 1 398 GO:0016020
GO:0016747

Feature Viewer

pLDDT pTM Quality
81 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map