F338751

General Info

Members Datasets Scaffolds Average Seq Length
226 179 226 143

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10001726|Ga0075433_100017266
Length 168
Sequence MSSRGAFLALWARKAPAAALIVALAXXXXASPVAAATPQTTINDVEDEVMCPICGTLLELAESPQAERERAFVKRLIAEGKSKAEVKDALVAQYGREVLALPGGSGFDLTAYLVPAIAFVTAAVGLAIGVRRWRNAGRTPPGSGRPPAGGPEGEDAERLRADLARYDL

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 1.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 7.96
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1001788 3300002074 Bacteria 2383
2 JGI24034J26672_10001174 3300002239 Bacteria 3428
3 Ga0070658_10022933 3300005327 Bacteria 5011
4 Ga0070683_100001951 3300005329 Bacteria 16161
5 Ga0070683_100149814 3300005329 Bacteria 2212
6 Ga0070680_100007887 3300005336 Bacteria 8120
7 Ga0068868_100009450 3300005338 Bacteria 7019
8 Ga0070660_100001409 3300005339 Bacteria 16383
9 Ga0070660_100021867 3300005339 Bacteria 4723
10 Ga0070691_10064731 3300005341 Bacteria 1764
11 Ga0070674_100000008 3300005356 Bacteria 143844
12 Ga0070659_100011329 3300005366 Bacteria 6594
13 Ga0070659_101220625 3300005366 Bacteria 665
14 Ga0070711_100004095 3300005439 Bacteria 8572
15 Ga0070711_100109877 3300005439 Bacteria 2022
16 Ga0070711_100307836 3300005439 Bacteria 1262
17 Ga0070694_100140014 3300005444 Bacteria 1756
18 Ga0070708_100560083 3300005445 Bacteria 1078
19 Ga0070678_100031795 3300005456 Bacteria 3646
20 Ga0070681_10010574 3300005458 Bacteria 9115
21 Ga0070681_10748864 3300005458 Bacteria 893
22 Ga0070707_100497499 3300005468 Unclassified 1181
23 Ga0070698_100767122 3300005471 Bacteria 908
24 Ga0070679_100007912 3300005530 Bacteria 9974
25 Ga0070679_100010396 3300005530 Bacteria 8828
26 Ga0070679_101010204 3300005530 Bacteria 776
27 Ga0070684_100001272 3300005535 Bacteria 18055
28 Ga0070684_100036184 3300005535 Bacteria 4230
29 Ga0070684_100985839 3300005535 Bacteria 791
30 Ga0070686_100036751 3300005544 Bacteria 3035
31 Ga0070696_100585330 3300005546 Bacteria 898
32 Ga0068855_100030809 3300005563 Bacteria 6413
33 Ga0068855_100059141 3300005563 Unclassified 4485
34 Ga0068857_100448941 3300005577 Bacteria 1205
35 Ga0068856_100863560 3300005614 Bacteria 924
36 Ga0068852_100000184 3300005616 Bacteria 42515
37 Ga0068864_100000045 3300005618 Bacteria 154739
38 Ga0068866_10000237 3300005718 Bacteria 25933
39 Ga0068858_100000091 3300005842 Bacteria 93802
40 Ga0070715_10127739 3300006163 Bacteria 1220
41 Ga0070716_100305593 3300006173 Bacteria 1108
42 Ga0075428_100147835 3300006844 Bacteria 2554
43 Ga0075428_101450411 3300006844 Bacteria 720
44 Ga0075430_100004041 3300006846 Bacteria 12381
45 Ga0075431_100045733 3300006847 Bacteria 4513
46 Ga0075431_100312021 3300006847 Bacteria 1587
47 Ga0075433_10001726 3300006852 Bacteria 16297
48 Ga0075433_10375645 3300006852 Bacteria 1255
49 Ga0075434_100054617 3300006871 Bacteria 3968
50 Ga0075429_100041633 3300006880 Bacteria 4001
51 Ga0075435_100003270 3300007076 Bacteria 10981
52 Ga0105240_10097231 3300009093 Bacteria 3588
53 Ga0111539_10016723 3300009094 Bacteria 9090
54 Ga0105245_11801168 3300009098 Bacteria 665
55 Ga0105247_10000393 3300009101 Bacteria 37140
56 Ga0114129_10824143 3300009147 Bacteria 1182
57 Ga0105243_10049067 3300009148 Bacteria 3330
58 Ga0105242_10001264 3300009176 Bacteria 19974
59 Ga0105242_10019660 3300009176 Bacteria 5293
60 Ga0105242_10045025 3300009176 Bacteria 3575
61 Ga0105248_10000249 3300009177 Bacteria 62662
62 Ga0157370_10018219 3300013104 Bacteria 7066
63 Ga0157369_10201220 3300013105 Bacteria 2090
64 Ga0157378_10004828 3300013297 Bacteria 11815
65 Ga0157372_10261743 3300013307 Bacteria 2009
66 Ga0157372_10816617 3300013307 Bacteria 1083
67 Ga0157375_10002277 3300013308 Bacteria 16605
68 Ga0157380_10634148 3300014326 Bacteria 1063
69 Ga0197907_10946547 3300020069 Bacteria 3017
70 Ga0206356_10050462 3300020070 Bacteria 3245
71 Ga0206353_10287516 3300020082 Unclassified 1199
72 Ga0206353_10866168 3300020082 Bacteria 6983
73 Ga0207642_10000122 3300025899 Bacteria 21318
74 Ga0207710_10000195 3300025900 Bacteria 57216
75 Ga0207685_10045944 3300025905 Bacteria 1659
76 Ga0207705_10003887 3300025909 Bacteria 11365
77 Ga0207707_10008618 3300025912 Bacteria 8845
78 Ga0207707_10413479 3300025912 Bacteria 1157
79 Ga0207695_10130596 3300025913 Bacteria 2470
80 Ga0207693_10052588 3300025915 Bacteria 3195
81 Ga0207663_10002248 3300025916 Bacteria 9233
82 Ga0207663_10144265 3300025916 Bacteria 1662
83 Ga0207657_10002690 3300025919 Bacteria 19155
84 Ga0207657_10030105 3300025919 Bacteria 4932
85 Ga0207652_10019328 3300025921 Bacteria 5602
86 Ga0207652_10105354 3300025921 Bacteria 2495
87 Ga0207652_10663953 3300025921 Bacteria 932
88 Ga0207687_11505778 3300025927 Bacteria 578
89 Ga0207690_10016890 3300025932 Bacteria 4449
90 Ga0207686_10000033 3300025934 Bacteria 143602
91 Ga0207686_10005949 3300025934 Bacteria 6551
92 Ga0207686_10009391 3300025934 Bacteria 5306
93 Ga0207709_10142495 3300025935 Bacteria 1649
94 Ga0207670_11214071 3300025936 Bacteria 638
95 Ga0207669_10000004 3300025937 Bacteria 196828
96 Ga0207665_10120687 3300025939 Bacteria 1851
97 Ga0207665_10494890 3300025939 Bacteria 944
98 Ga0207711_10000020 3300025941 Bacteria 363325
99 Ga0207689_10212231 3300025942 Bacteria 1599
100 Ga0207661_10031614 3300025944 Bacteria 4092
101 Ga0207661_10102395 3300025944 Bacteria 2407
102 Ga0207667_10050181 3300025949 Bacteria 4403
103 Ga0207667_10424127 3300025949 Bacteria 1353
104 Ga0207677_10033491 3300026023 Bacteria 3317
105 Ga0207703_10000152 3300026035 Bacteria 79658
106 Ga0207702_10830902 3300026078 Bacteria 914
107 Ga0207676_10000016 3300026095 Bacteria 311561
108 Ga0207683_10041010 3300026121 Bacteria 4041
109 Ga0265322_10049905 3300028654 Bacteria 1188
110 Ga0265338_10029180 3300028800 Bacteria 5476
111 Ga0307511_10099173 3300030521 Bacteria 1924
112 Ga0265330_10204537 3300031235 Bacteria 834
113 Ga0265332_10137136 3300031238 Bacteria 1026
114 Ga0265339_10080141 3300031249 Unclassified 1727
115 Ga0265331_10140717 3300031250 Bacteria 1098
116 Ga0265327_10005614 3300031251 Bacteria 10390
117 Ga0265314_10239712 3300031711 Bacteria 1047
118 Ga0265342_10039024 3300031712 Bacteria 2888
119 Ga0307413_10079041 3300031824 Bacteria 2101
120 Ga0307410_10012437 3300031852 Bacteria 4923
121 Ga0307410_10154780 3300031852 Bacteria 1711
122 Ga0307406_10431184 3300031901 Bacteria 1053
123 Ga0307407_10069216 3300031903 Bacteria 2094
124 Ga0307416_101857990 3300032002 Bacteria 706
125 Ga0307414_10095370 3300032004 Bacteria 2223
126 Ga0373934_0264695 3300035086 Bacteria 711
127 Ga0373923_0068115 3300035111 Bacteria 1524
128 Ga0373953_0041763 3300035117 Bacteria 1826
129 Ga0373955_0042183 3300035172 Bacteria 2449
130 Ga0373924_0113538 3300035410 Bacteria 1172
131 Ga0373937_0041340 3300036401 Bacteria 4204
132 Ga0373937_0718668 3300036401 Bacteria 946
133 Ga0395900_1482041 3300037418 Bacteria 591
134 Ga0395898_0503659 3300037466 Bacteria 1152
135 Ga0466972_0318264 3300044658 Bacteria 727
136 Ga0466966_0101216 3300044684 Bacteria 1782
137 Ga0466963_0019696 3300044694 Bacteria 4236
138 Ga0466960_0200819 3300044901 Bacteria 1089
139 Ga0466959_0105612 3300045049 Bacteria 2014
140 Ga0466958_0070623 3300045836 Bacteria 2137
141 Ga0466967_0452948 3300045976 Bacteria 1254
142 Ga0495592_0052289 3300046454 Bacteria 3033
143 Ga0495603_0025345 3300046455 Bacteria 3586
144 Ga0495641_0031439 3300046461 Bacteria 2536
145 Ga0495641_0079043 3300046461 Bacteria 1474
146 Ga0495651_0467382 3300046462 Bacteria 812
147 Ga0495653_0046432 3300046463 Bacteria 3363
148 Ga0495580_0193286 3300046472 Bacteria 1403
149 Ga0495608_0002074 3300046511 Bacteria 14433
150 Ga0495628_0036080 3300046516 Bacteria 3971
151 Ga0495628_0566818 3300046516 Unclassified 814
152 Ga0495630_0000056 3300046517 Bacteria 91477
153 Ga0495630_0068853 3300046517 Bacteria 2662
154 Ga0495630_0421987 3300046517 Bacteria 1022
155 Ga0495652_0187504 3300046529 Bacteria 1581
156 Ga0495652_0194003 3300046529 Bacteria 1547
157 Ga0495640_0190264 3300046533 Bacteria 1305
158 Ga0495587_0003372 3300046536 Bacteria 10650
159 Ga0495587_0008535 3300046536 Bacteria 6581
160 Ga0495645_0106698 3300046543 Bacteria 1986
161 Ga0495667_0017632 3300046559 Bacteria 4822
162 Ga0495667_0303118 3300046559 Unclassified 1012
163 Ga0495634_0000018 3300046642 Bacteria 121323
164 Ga0495635_0024261 3300046663 Bacteria 4228
165 Ga0495635_0040867 3300046663 Bacteria 3204
166 Ga0495588_0292788 3300046674 Bacteria 858
167 Ga0495657_0003990 3300046675 Bacteria 11841
168 Ga0495599_0060018 3300046678 Bacteria 2378
169 Ga0495623_0111388 3300046679 Bacteria 1658
170 Ga0495646_0107569 3300046680 Bacteria 1591
171 Ga0495647_0000169 3300046681 Bacteria 17284
172 Ga0495613_0013203 3300046689 Bacteria 6138
173 Ga0495624_0000267 3300046690 Bacteria 41318
174 Ga0495600_0049507 3300046809 Bacteria 2742
175 Ga0495604_0019959 3300047317 Bacteria 5357
176 Ga0495674_0353548 3300047319 Bacteria 1192
177 Ga0495680_0005394 3300047322 Bacteria 12050
178 Ga0495675_0059959 3300047444 Bacteria 2412
179 Ga0495685_005972 3300047447 Bacteria 3977
180 Ga0495602_0452822 3300048088 Bacteria 905
181 Ga0496101_0006366 3300048904 Bacteria 7599
182 Ga0496102_0028706 3300048905 Bacteria 4972
183 Ga0496104_0000004 3300048907 Bacteria 641830
184 Ga0496104_0573363 3300048907 Bacteria 1039
185 Ga0496105_0000001 3300048908 Bacteria 1328178
186 Ga0496106_0000081 3300048909 Bacteria 76468
187 Ga0496106_0009901 3300048909 Bacteria 7038
188 Ga0496107_0008570 3300048910 Bacteria 7077
189 Ga0496108_0001172 3300048911 Bacteria 20452
190 Ga0496108_0038133 3300048911 Bacteria 4003
191 Ga0496109_0001311 3300048912 Bacteria 20538
192 Ga0496110_1311354 3300048913 Bacteria 633
193 Ga0496112_0020231 3300048915 Bacteria 6303
194 Ga0496112_0095212 3300048915 Bacteria 2948
195 Ga0496112_0263658 3300048915 Bacteria 1672
196 Ga0496114_0096295 3300048917 Bacteria 2520
197 Ga0496115_0064657 3300048918 Bacteria 2953
198 Ga0496115_0361941 3300048918 Bacteria 1182
199 Ga0496119_0031686 3300048922 Bacteria 3538
200 Ga0496120_0077157 3300048923 Bacteria 1814
201 Ga0501067_0481046 3300049583 Bacteria 694
202 Ga0501068_0068662 3300049584 Bacteria 2160
203 Ga0501069_0108061 3300049585 Bacteria 1583
204 Ga0501070_0040499 3300049586 Bacteria 3884
205 Ga0501071_0187139 3300049587 Bacteria 1552
206 Ga0501072_0072266 3300049588 Bacteria 2726
207 Ga0501073_0706721 3300049589 Bacteria 695
208 Ga0501074_0097584 3300049590 Bacteria 2103
209 Ga0501080_0088261 3300049742 Bacteria 2881
210 nmdc:mga05p37_351401_c1 3300050507 Bacteria 1736
211 nmdc:mga09592_98026_c1 3300050508 Bacteria 2509
212 nmdc:mga0qj67_446_c1 3300050509 Bacteria 28226
213 nmdc:mga06r32_139487_c1 3300050510 Bacteria 2400
214 nmdc:mga06r32_18055_c1 3300050510 Bacteria 6451
215 nmdc:mga08y16_39870_c1 3300050511 Bacteria 4926
216 nmdc:mga0n895_47778_c1 3300050512 Bacteria 4186
217 nmdc:mga0rr50_177218_c1 3300050513 Bacteria 1741
218 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
219 nmdc:mga0a205_376199_c1 3300050515 Bacteria 1286
220 nmdc:mga0a205_540_c1 3300050515 Bacteria 29856
221 Ga0495601_1021487 3300053077 Bacteria 519
222 Ga0495655_0000001 3300053083 Bacteria 419518
223 Ga0495595_0027989 3300053084 Bacteria 2514
224 Ga0495619_0000025 3300053085 Bacteria 167905
225 Ga0500628_000010 3300053129 Bacteria 122210
226 Ga0466962_0125000 3300061719 Bacteria 1242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0263658 Ga0496112_0263658_821_1276 98
2 3300005439 Ga0070711_100109877 Ga0070711_1001098773 99
3 3300005439 Ga0070711_100307836 Ga0070711_1003078363 99
4 3300025916 Ga0207663_10144265 Ga0207663_101442652 99
5 3300028654 Ga0265322_10049905 Ga0265322_100499052 99
6 3300031250 Ga0265331_10140717 Ga0265331_101407172 99
7 3300031711 Ga0265314_10239712 Ga0265314_102397122 99
8 3300005327 Ga0070658_10022933 Ga0070658_100229337 100
9 3300005329 Ga0070683_100001951 Ga0070683_10000195117 100
10 3300005336 Ga0070680_100007887 Ga0070680_10000788712 100
11 3300005339 Ga0070660_100021867 Ga0070660_1000218673 100
12 3300005458 Ga0070681_10010574 Ga0070681_100105748 100
13 3300005530 Ga0070679_100007912 Ga0070679_10000791210 100
14 3300005535 Ga0070684_100036184 Ga0070684_1000361846 100
15 3300005563 Ga0068855_100030809 Ga0068855_1000308098 100
16 3300005577 Ga0068857_100448941 Ga0068857_1004489413 100
17 3300005614 Ga0068856_100863560 Ga0068856_1008635602 100
18 3300009093 Ga0105240_10097231 Ga0105240_100972313 100
19 3300013104 Ga0157370_10018219 Ga0157370_100182195 100
20 3300013307 Ga0157372_10261743 Ga0157372_102617432 100
21 3300020069 Ga0197907_10946547 Ga0197907_109465474 100
22 3300020070 Ga0206356_10050462 Ga0206356_100504622 100
23 3300020082 Ga0206353_10866168 Ga0206353_108661685 100
24 3300025909 Ga0207705_10003887 Ga0207705_1000388710 100
25 3300025912 Ga0207707_10008618 Ga0207707_100086189 100
26 3300025913 Ga0207695_10130596 Ga0207695_101305963 100
27 3300025919 Ga0207657_10002690 Ga0207657_1000269013 100
28 3300025921 Ga0207652_10019328 Ga0207652_100193285 100
29 3300025944 Ga0207661_10102395 Ga0207661_101023953 100
30 3300025949 Ga0207667_10050181 Ga0207667_100501813 100
31 3300026078 Ga0207702_10830902 Ga0207702_108309022 100
32 3300013297 Ga0157378_10004828 Ga0157378_100048284 102
33 3300035086 Ga0373934_0264695 Ga0373934_0264695_144_584 102
34 3300035111 Ga0373923_0068115 Ga0373923_0068115_827_1267 102
35 3300035117 Ga0373953_0041763 Ga0373953_0041763_722_1162 102
36 3300035172 Ga0373955_0042183 Ga0373955_0042183_473_913 102
37 3300035410 Ga0373924_0113538 Ga0373924_0113538_604_1044 102
38 3300036401 Ga0373937_0041340 Ga0373937_0041340_2180_2620 102
39 3300037418 Ga0395900_1482041 Ga0395900_1482041_19_480 102
40 3300037466 Ga0395898_0503659 Ga0395898_0503659_561_1022 102
41 3300046454 Ga0495592_0052289 Ga0495592_0052289_1399_1839 102
42 3300046461 Ga0495641_0079043 Ga0495641_0079043_605_1045 102
43 3300046462 Ga0495651_0467382 Ga0495651_0467382_92_532 102
44 3300046463 Ga0495653_0046432 Ga0495653_0046432_1565_2005 102
45 3300046511 Ga0495608_0002074 Ga0495608_0002074_4714_5154 102
46 3300046516 Ga0495628_0036080 Ga0495628_0036080_554_994 102
47 3300046517 Ga0495630_0068853 Ga0495630_0068853_1496_1936 102
48 3300046529 Ga0495652_0187504 Ga0495652_0187504_87_527 102
49 3300046529 Ga0495652_0194003 Ga0495652_0194003_709_1149 102
50 3300046533 Ga0495640_0190264 Ga0495640_0190264_658_1098 102
51 3300046536 Ga0495587_0003372 Ga0495587_0003372_2963_3403 102
52 3300046543 Ga0495645_0106698 Ga0495645_0106698_1244_1684 102
53 3300046559 Ga0495667_0017632 Ga0495667_0017632_3679_4119 102
54 3300046663 Ga0495635_0024261 Ga0495635_0024261_1896_2336 102
55 3300046675 Ga0495657_0003990 Ga0495657_0003990_9568_10008 102
56 3300046678 Ga0495599_0060018 Ga0495599_0060018_1245_1685 102
57 3300046679 Ga0495623_0111388 Ga0495623_0111388_580_1020 102
58 3300046680 Ga0495646_0107569 Ga0495646_0107569_346_786 102
59 3300046809 Ga0495600_0049507 Ga0495600_0049507_794_1234 102
60 3300047317 Ga0495604_0019959 Ga0495604_0019959_3552_3992 102
61 3300047319 Ga0495674_0353548 Ga0495674_0353548_35_475 102
62 3300047322 Ga0495680_0005394 Ga0495680_0005394_3402_3842 102
63 3300047444 Ga0495675_0059959 Ga0495675_0059959_700_1140 102
64 3300048088 Ga0495602_0452822 Ga0495602_0452822_423_863 102
65 3300048907 Ga0496104_0573363 Ga0496104_0573363_357_797 102
66 3300048917 Ga0496114_0096295 Ga0496114_0096295_1149_1589 102
67 3300048918 Ga0496115_0064657 Ga0496115_0064657_498_938 102
68 3300053077 Ga0495601_1021487 Ga0495601_1021487_38_478 102
69 3300053084 Ga0495595_0027989 Ga0495595_0027989_931_1371 102
70 3300006852 Ga0075433_10375645 Ga0075433_103756452 103
71 3300006871 Ga0075434_100054617 Ga0075434_1000546174 103
72 3300007076 Ga0075435_100003270 Ga0075435_10000327016 103
73 3300028800 Ga0265338_10029180 Ga0265338_100291805 103
74 3300031235 Ga0265330_10204537 Ga0265330_102045372 103
75 3300031238 Ga0265332_10137136 Ga0265332_101371362 103
76 3300031249 Ga0265339_10080141 Ga0265339_100801412 103
77 3300031251 Ga0265327_10005614 Ga0265327_1000561415 103
78 3300031712 Ga0265342_10039024 Ga0265342_100390242 103
79 3300048907 Ga0496104_0000004 Ga0496104_0000004_159600_160079 103
80 3300048908 Ga0496105_0000001 Ga0496105_0000001_481752_482231 103
81 3300048922 Ga0496119_0031686 Ga0496119_0031686_2302_2781 103
82 3300048923 Ga0496120_0077157 Ga0496120_0077157_881_1360 103
83 3300050512 nmdc:mga0n895_47778_c1 nmdc:mga0n895_47778_c1_783_1244 103
84 3300050513 nmdc:mga0rr50_177218_c1 nmdc:mga0rr50_177218_c1_606_1067 103
85 3300050515 nmdc:mga0a205_376199_c1 nmdc:mga0a205_376199_c1_380_841 103
86 3300005445 Ga0070708_100560083 Ga0070708_1005600832 104
87 3300005471 Ga0070698_100767122 Ga0070698_1007671222 104
88 3300046472 Ga0495580_0193286 Ga0495580_0193286_81_536 104
89 3300049583 Ga0501067_0481046 Ga0501067_0481046_143_628 104
90 3300049586 Ga0501070_0040499 Ga0501070_0040499_2263_2748 104
91 3300049587 Ga0501071_0187139 Ga0501071_0187139_773_1258 104
92 3300049589 Ga0501073_0706721 Ga0501073_0706721_130_615 104
93 3300049590 Ga0501074_0097584 Ga0501074_0097584_424_909 104
94 3300049742 Ga0501080_0088261 Ga0501080_0088261_471_956 104
95 3300005339 Ga0070660_100001409 Ga0070660_10000140910 106
96 3300005366 Ga0070659_101220625 Ga0070659_1012206251 106
97 3300005530 Ga0070679_101010204 Ga0070679_1010102042 106
98 3300005535 Ga0070684_100985839 Ga0070684_1009858391 106
99 3300025919 Ga0207657_10030105 Ga0207657_100301057 106
100 3300025921 Ga0207652_10663953 Ga0207652_106639532 106
101 3300005366 Ga0070659_100011329 Ga0070659_1000113296 107
102 3300025932 Ga0207690_10016890 Ga0207690_100168906 107
103 3300046536 Ga0495587_0008535 Ga0495587_0008535_3020_3475 107
104 3300049584 Ga0501068_0068662 Ga0501068_0068662_667_1122 108
105 3300005618 Ga0068864_100000045 Ga0068864_100000045135 109
106 3300026095 Ga0207676_10000016 Ga0207676_1000001629 109
107 3300045049 Ga0466959_0105612 Ga0466959_0105612_647_1093 109
108 3300046516 Ga0495628_0566818 Ga0495628_0566818_266_691 109
109 3300005842 Ga0068858_100000091 Ga0068858_10000009110 110
110 3300026035 Ga0207703_10000152 Ga0207703_1000015212 110
111 3300044658 Ga0466972_0318264 Ga0466972_0318264_165_611 110
112 3300044901 Ga0466960_0200819 Ga0466960_0200819_365_811 110
113 3300025934 Ga0207686_10009391 Ga0207686_100093913 111
114 3300006844 Ga0075428_100147835 Ga0075428_1001478353 113
115 3300006844 Ga0075428_101450411 Ga0075428_1014504112 113
116 3300006846 Ga0075430_100004041 Ga0075430_1000040415 113
117 3300006847 Ga0075431_100045733 Ga0075431_1000457333 113
118 3300006880 Ga0075429_100041633 Ga0075429_1000416333 113
119 3300009094 Ga0111539_10016723 Ga0111539_1001672310 113
120 3300050507 nmdc:mga05p37_351401_c1 nmdc:mga05p37_351401_c1_437_865 113
121 3300050508 nmdc:mga09592_98026_c1 nmdc:mga09592_98026_c1_1836_2321 113
122 3300050509 nmdc:mga0qj67_446_c1 nmdc:mga0qj67_446_c1_15197_15682 113
123 3300050510 nmdc:mga06r32_18055_c1 nmdc:mga06r32_18055_c1_2474_2959 113
124 3300050511 nmdc:mga08y16_39870_c1 nmdc:mga08y16_39870_c1_15_443 113
125 3300046642 Ga0495634_0000018 Ga0495634_0000018_47222_47662 114
126 3300009101 Ga0105247_10000393 Ga0105247_1000039335 116
127 3300009176 Ga0105242_10019660 Ga0105242_100196603 116
128 3300025900 Ga0207710_10000195 Ga0207710_1000019519 116
129 3300048911 Ga0496108_0001172 Ga0496108_0001172_7907_8359 116
130 3300048912 Ga0496109_0001311 Ga0496109_0001311_7982_8434 116
131 3300005444 Ga0070694_100140014 Ga0070694_1001400142 117
132 3300005458 Ga0070681_10748864 Ga0070681_107488642 117
133 3300005468 Ga0070707_100497499 Ga0070707_1004974991 117
134 3300005530 Ga0070679_100010396 Ga0070679_10001039610 117
135 3300005563 Ga0068855_100059141 Ga0068855_1000591412 117
136 3300006163 Ga0070715_10127739 Ga0070715_101277392 117
137 3300013105 Ga0157369_10201220 Ga0157369_102012202 117
138 3300013307 Ga0157372_10816617 Ga0157372_108166172 117
139 3300020082 Ga0206353_10287516 Ga0206353_102875162 117
140 3300025905 Ga0207685_10045944 Ga0207685_100459442 117
141 3300025912 Ga0207707_10413479 Ga0207707_104134792 117
142 3300025915 Ga0207693_10052588 Ga0207693_100525886 117
143 3300025921 Ga0207652_10105354 Ga0207652_101053542 117
144 3300025939 Ga0207665_10494890 Ga0207665_104948902 117
145 3300025949 Ga0207667_10424127 Ga0207667_104241272 117
146 3300036401 Ga0373937_0718668 Ga0373937_0718668_290_739 117
147 3300044684 Ga0466966_0101216 Ga0466966_0101216_1081_1527 117
148 3300045836 Ga0466958_0070623 Ga0466958_0070623_16_462 117
149 3300046517 Ga0495630_0421987 Ga0495630_0421987_260_709 117
150 3300046559 Ga0495667_0303118 Ga0495667_0303118_204_662 117
151 3300048904 Ga0496101_0006366 Ga0496101_0006366_4620_5078 117
152 3300048905 Ga0496102_0028706 Ga0496102_0028706_1897_2352 117
153 3300048909 Ga0496106_0000081 Ga0496106_0000081_69577_70035 117
154 3300048909 Ga0496106_0009901 Ga0496106_0009901_5959_6417 117
155 3300048910 Ga0496107_0008570 Ga0496107_0008570_654_1112 117
156 3300048913 Ga0496110_1311354 Ga0496110_1311354_47_502 117
157 3300048915 Ga0496112_0020231 Ga0496112_0020231_1075_1530 117
158 3300048915 Ga0496112_0095212 Ga0496112_0095212_1729_2184 117
159 3300048918 Ga0496115_0361941 Ga0496115_0361941_515_973 117
160 3300061719 Ga0466962_0125000 Ga0466962_0125000_602_1048 117
161 3300005329 Ga0070683_100149814 Ga0070683_1001498143 118
162 3300005535 Ga0070684_100001272 Ga0070684_10000127214 118
163 3300025944 Ga0207661_10031614 Ga0207661_100316143 118
164 3300050515 nmdc:mga0a205_24_c2 nmdc:mga0a205_24_c2_15840_16292 118
165 3300005546 Ga0070696_100585330 Ga0070696_1005853302 119
166 3300006847 Ga0075431_100312021 Ga0075431_1003120212 119
167 3300009098 Ga0105245_11801168 Ga0105245_118011682 119
168 3300009147 Ga0114129_10824143 Ga0114129_108241432 119
169 3300025927 Ga0207687_11505778 Ga0207687_115057781 119
170 3300049585 Ga0501069_0108061 Ga0501069_0108061_22_507 119
171 3300049588 Ga0501072_0072266 Ga0501072_0072266_2059_2544 119
172 3300050510 nmdc:mga06r32_139487_c1 nmdc:mga06r32_139487_c1_220_675 119
173 3300014326 Ga0157380_10634148 Ga0157380_106341482 120
174 3300025936 Ga0207670_11214071 Ga0207670_112140711 120
175 3300031824 Ga0307413_10079041 Ga0307413_100790412 120
176 3300031852 Ga0307410_10012437 Ga0307410_100124373 120
177 3300031852 Ga0307410_10154780 Ga0307410_101547802 120
178 3300031901 Ga0307406_10431184 Ga0307406_104311842 120
179 3300031903 Ga0307407_10069216 Ga0307407_100692163 120
180 3300032002 Ga0307416_101857990 Ga0307416_1018579902 120
181 3300032004 Ga0307414_10095370 Ga0307414_100953704 120
182 3300044694 Ga0466963_0019696 Ga0466963_0019696_2028_2501 120
183 3300045976 Ga0466967_0452948 Ga0466967_0452948_201_674 120
184 3300005338 Ga0068868_100009450 Ga0068868_1000094503 121
185 3300005456 Ga0070678_100031795 Ga0070678_1000317954 121
186 3300005544 Ga0070686_100036751 Ga0070686_1000367512 121
187 3300026023 Ga0207677_10033491 Ga0207677_100334912 121
188 3300026121 Ga0207683_10041010 Ga0207683_100410103 121
189 3300046455 Ga0495603_0025345 Ga0495603_0025345_475_930 121
190 3300046461 Ga0495641_0031439 Ga0495641_0031439_890_1357 121
191 3300046517 Ga0495630_0000056 Ga0495630_0000056_44065_44532 121
192 3300046674 Ga0495588_0292788 Ga0495588_0292788_113_568 121
193 3300046681 Ga0495647_0000169 Ga0495647_0000169_3887_4354 121
194 3300046690 Ga0495624_0000267 Ga0495624_0000267_24117_24584 121
195 3300047447 Ga0495685_005972 Ga0495685_005972_1642_2103 121
196 3300005341 Ga0070691_10064731 Ga0070691_100647312 122
197 3300005356 Ga0070674_100000008 Ga0070674_10000000825 123
198 3300005616 Ga0068852_100000184 Ga0068852_10000018416 123
199 3300005718 Ga0068866_10000237 Ga0068866_100002377 123
200 3300009148 Ga0105243_10049067 Ga0105243_100490675 123
201 3300009176 Ga0105242_10045025 Ga0105242_100450255 123
202 3300009177 Ga0105248_10000249 Ga0105248_1000024965 123
203 3300025899 Ga0207642_10000122 Ga0207642_1000012211 123
204 3300025934 Ga0207686_10005949 Ga0207686_100059493 123
205 3300025935 Ga0207709_10142495 Ga0207709_101424951 123
206 3300025937 Ga0207669_10000004 Ga0207669_10000004183 123
207 3300025941 Ga0207711_10000020 Ga0207711_100000205 123
208 3300046689 Ga0495613_0013203 Ga0495613_0013203_990_1457 123
209 3300053083 Ga0495655_0000001 Ga0495655_0000001_149007_149492 123
210 3300053129 Ga0500628_000010 Ga0500628_000010_23208_23693 123
211 3300005439 Ga0070711_100004095 Ga0070711_1000040956 124
212 3300009176 Ga0105242_10001264 Ga0105242_100012646 124
213 3300013308 Ga0157375_10002277 Ga0157375_1000227710 124
214 3300025916 Ga0207663_10002248 Ga0207663_100022487 124
215 3300025934 Ga0207686_10000033 Ga0207686_1000003360 124
216 3300046663 Ga0495635_0040867 Ga0495635_0040867_188_685 128
217 3300048911 Ga0496108_0038133 Ga0496108_0038133_1369_1872 128
218 3300006173 Ga0070716_100305593 Ga0070716_1003055932 134
219 3300025939 Ga0207665_10120687 Ga0207665_101206872 134
220 3300025942 Ga0207689_10212231 Ga0207689_102122312 134
221 3300030521 Ga0307511_10099173 Ga0307511_100991732 134
222 3300053085 Ga0495619_0000025 Ga0495619_0000025_4965_5465 134
223 3300006852 Ga0075433_10001726 Ga0075433_100017266 135
224 3300050515 nmdc:mga0a205_540_c1 nmdc:mga0a205_540_c1_14179_14685 135
225 3300002074 JGI24748J21848_1001788 JGI24748J21848_10017882 136
226 3300002239 JGI24034J26672_10001174 JGI24034J26672_100011746 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03918

CcmH

Cytochrome C biogenesis protein

9

163

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j98-assembly1.cif.gz_C crystal structure of slow bee paralysis virus at 2.6a resolution 0.8355 63 88
2hl7-assembly1.cif.gz_A crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa 0.815 43 101
2kw0-assembly1.cif.gz_A solution structure of n-terminal domain of ccmh from escherichia.coli 0.7597 43 103
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.6019 59 95
2hl7-assembly1.cif.gz_A crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa 0.5998 43 101
ID Description Score Start End Superfamily
af_P0ABM9_18_102_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.9354 43 103 1.10.8.640
af_C6SYH8_3_82_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.9156 43 103 1.10.8.640
af_P32711_19_102_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.8652 43 107 1.10.8.640
4u7bG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.8341 64 99 1.10.10.1450
2hl7A00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.815 43 101 1.10.8.640
ID Description Score Start End GO Terms
AF-A0A381ZAV8-F1-model_v4 CcmH/CycL/Ccl2/NrfF N-terminal domain-containing protein 0.9396 43 100 GO:0046872
AF-A0A0R0CSC8-F1-model_v4 Cytochrome c-type biogenesis protein 0.8935 43 105 GO:0005886
GO:0017004
GO:0046872
AF-F7XU42-F1-model_v4 Cytochrome c-type biogenesis protein 0.87 43 106 GO:0005886
GO:0017004
GO:0046872
AF-A0A5D2UWM3-F1-model_v4 Cytochrome c-type biogenesis protein 0.8351 43 110 GO:0005743
GO:0046872
AF-A0A0S3T7V2-F1-model_v4 Cytochrome c-type biogenesis protein 0.7513 43 114 GO:0005743
GO:0046872

Feature Viewer

pLDDT pTM Quality
73.94 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map