F338190

General Info

Members Datasets Scaffolds Average Seq Length
225 170 217 259

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0133326|Ga0496121_0133326_838_1731
Length 297
Sequence LPVNRLPLKLGAARPSQARPVGLADGRRTDEEGNCMLPDEALKSMHVMIATPCYISAVSMNYVTSIFRFGMAANRFGLQTTLHMHSESLVTRGRNEMVRFFLEHEEFTHLLWIDSDIEFQPRDAFRLLLSDLDVVAGIYPIKNLNWPAEGISEAMTLDEYVVRHATFPFNPVGMWEEPIVPRLNADEFIEVAEAPTGFMCIKRDVIYRMMEHYPELNYMPEGAEKQAKKQFYWLFFDCMVEPETKRYLSEDYAFCKRWRDMGGKVHADFQSDLGHLGQYMYRGNLSRSIRRRDGLPY

Samples

Sample ID Description Type Environment
1 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
2 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
3 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
4 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
5 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
6 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
7 2909042592 Labrys sp. LIt4 Isolate Nodule
8 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.56
Nodule 3.11
Rhizoplane 11.11
Rhizosphere 63.11
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000313 3300002459 Bacteria 18157
2 JGI25151J46595_10000722 3300003187 Bacteria 27466
3 rootH2_10059801 3300003320 Bacteria 4389
4 rootH1_10133742 3300003323 Bacteria 5154
5 JGI25160J50197_1000292 3300003354 Bacteria 35891
6 Ga0055539_1000594 3300003752 Bacteria 10023
7 Ga0055537_1000173 3300003773 Bacteria 48030
8 Ga0055534_1000171 3300003784 Bacteria 48030
9 Ga0055528_1000304 3300003790 Bacteria 41760
10 Ga0065165_1000965 3300005262 Bacteria 36121
11 Ga0065165_1051734 3300005262 Bacteria 1163
12 Ga0070658_10063293 3300005327 Bacteria 3015
13 Ga0070690_100135217 3300005330 Unclassified 1669
14 Ga0070670_100000004 3300005331 Bacteria 392110
15 Ga0070670_100099784 3300005331 Bacteria 2498
16 Ga0070666_10169113 3300005335 Bacteria 1530
17 Ga0070668_100005451 3300005347 Bacteria 9444
18 Ga0070669_100000144 3300005353 Bacteria 63492
19 Ga0070671_100000030 3300005355 Bacteria 112182
20 Ga0070659_100195161 3300005366 Bacteria 1665
21 Ga0070667_100000175 3300005367 Bacteria 79433
22 Ga0068853_100654163 3300005539 Bacteria 1000
23 Ga0070665_100002458 3300005548 Bacteria 20427
24 Ga0070665_100096671 3300005548 Bacteria 2958
25 Ga0068855_100017757 3300005563 Bacteria 8552
26 Ga0068855_100024611 3300005563 Bacteria 7202
27 Ga0068857_100119247 3300005577 Bacteria 2375
28 Ga0068859_100054773 3300005617 Bacteria 4012
29 Ga0068864_100000082 3300005618 Bacteria 101182
30 Ga0068864_100342679 3300005618 Bacteria 1409
31 Ga0068863_100000597 3300005841 Bacteria 36664
32 Ga0068858_100007957 3300005842 Bacteria 10217
33 Ga0068858_100070236 3300005842 Bacteria 3246
34 Ga0068860_100007905 3300005843 Bacteria 10618
35 Ga0068860_100104260 3300005843 Bacteria 2707
36 Ga0068860_100183948 3300005843 Unclassified 2020
37 Ga0068862_100001244 3300005844 Bacteria 23990
38 Ga0075363_100090865 3300006048 Bacteria 1680
39 Ga0075364_10074773 3300006051 Bacteria 2235
40 Ga0075369_10007587 3300006186 Bacteria 4143
41 Ga0075369_10036484 3300006186 Bacteria 2092
42 Ga0075370_10005226 3300006353 Bacteria 6422
43 Ga0068865_100000097 3300006881 Bacteria 45492
44 Ga0097620_100054776 3300006931 Bacteria 4012
45 Ga0079104_1013711 3300006946 Unclassified 2483
46 Ga0099826_10016592 3300006948 Bacteria 5562
47 Ga0099794_10057672 3300007265 Bacteria 1882
48 Ga0105251_10042198 3300009011 Bacteria 2216
49 Ga0105240_10074125 3300009093 Bacteria 4202
50 Ga0105240_10160395 3300009093 Bacteria 2672
51 Ga0105248_10029212 3300009177 Bacteria 6148
52 Ga0105248_10233433 3300009177 Unclassified 2071
53 Ga0105248_10674619 3300009177 Bacteria 1166
54 Ga0105237_10399703 3300009545 Bacteria 1379
55 Ga0105238_10043750 3300009551 Bacteria 4530
56 Ga0105238_10122566 3300009551 Bacteria 2579
57 Ga0105249_10000438 3300009553 Bacteria 39201
58 Ga0105249_10190879 3300009553 Unclassified 1999
59 Ga0105239_10209992 3300010375 Bacteria 2182
60 Ga0105239_10891478 3300010375 Bacteria 1021
61 Ga0163163_10133136 3300014325 Bacteria 2526
62 Ga0163163_10521922 3300014325 Bacteria 1250
63 Ga0157380_10238088 3300014326 Bacteria 1639
64 Ga0157379_10026295 3300014968 Bacteria 5181
65 Ga0157379_10249026 3300014968 Bacteria 1613
66 Ga0183361_10005 3300016635 Bacteria 413599
67 Ga0213872_10103618 3300021361 Bacteria 1267
68 Ga0209677_105985 3300025253 Bacteria 3010
69 Ga0209148_1026822 3300025254 Unclassified 891
70 Ga0209565_1000040 3300025263 Bacteria 266543
71 Ga0209673_1000353 3300025273 Bacteria 83670
72 Ga0209130_1001013 3300025284 Bacteria 21788
73 Ga0209130_1006143 3300025284 Bacteria 3964
74 Ga0209675_1000024 3300025291 Bacteria 312615
75 Ga0209025_1001472 3300025294 Bacteria 30658
76 Ga0209564_1002526 3300025295 Bacteria 14121
77 Ga0209758_1005796 3300025297 Bacteria 9258
78 Ga0207426_1000020 3300025302 Bacteria 558084
79 Ga0207426_1000451 3300025302 Bacteria 65459
80 Ga0207697_10063407 3300025315 Bacteria 1540
81 Ga0207680_10042296 3300025903 Bacteria 2664
82 Ga0207695_10070101 3300025913 Bacteria 3585
83 Ga0207681_10000146 3300025923 Bacteria 58869
84 Ga0207694_10053850 3300025924 Bacteria 3121
85 Ga0207650_10000118 3300025925 Bacteria 104112
86 Ga0207644_10000011 3300025931 Bacteria 223950
87 Ga0207644_10009872 3300025931 Bacteria 6280
88 Ga0207667_10002471 3300025949 Bacteria 23051
89 Ga0207667_10061463 3300025949 Bacteria 3929
90 Ga0207712_10157708 3300025961 Bacteria 1760
91 Ga0207668_10000464 3300025972 Bacteria 25530
92 Ga0207668_10180799 3300025972 Bacteria 1663
93 Ga0207668_10313444 3300025972 Bacteria 1299
94 Ga0207658_10000354 3300025986 Bacteria 45361
95 Ga0207703_10005512 3300026035 Bacteria 10169
96 Ga0207703_10043976 3300026035 Bacteria 3587
97 Ga0207641_10009868 3300026088 Bacteria 7858
98 Ga0207676_10000068 3300026095 Bacteria 104705
99 Ga0209282_1001873 3300027666 Bacteria 11847
100 Ga0268266_10003723 3300028379 Bacteria 15002
101 Ga0268266_10188439 3300028379 Unclassified 1882
102 Ga0268265_10003465 3300028380 Bacteria 11340
103 Ga0268264_10000032 3300028381 Bacteria 408337
104 Ga0268264_10049145 3300028381 Viruses 3508
105 Ga0268264_10157766 3300028381 Unclassified 2041
106 Ga0265313_10000312 3300031595 Bacteria 52824
107 Ga0307413_10055930 3300031824 Bacteria 2404
108 Ga0307411_10363624 3300032005 Bacteria 1184
109 Ga0395905_0000057 3300037471 Bacteria 203452
110 Ga0395905_0018435 3300037471 Bacteria 6625
111 Ga0395905_0195569 3300037471 Bacteria 1896
112 Ga0395905_0329179 3300037471 Bacteria 1418
113 Ga0436365_1328561 3300039437 Bacteria 4175
114 Ga0436360_0595691 3300039438 Bacteria 13315
115 Ga0436361_0280905 3300039447 Bacteria 1969
116 Ga0436361_0310433 3300039447 Bacteria 1215
117 Ga0436361_1005442 3300039447 Bacteria 4033
118 Ga0436362_0857493 3300039453 Bacteria 896
119 Ga0439431_0008429 3300041997 Bacteria 2318
120 Ga0466972_0018639 3300044658 Bacteria 3470
121 Ga0466982_0000013 3300044672 Bacteria 136227
122 Ga0466965_0001366 3300044683 Bacteria 9792
123 Ga0466965_0005119 3300044683 Bacteria 5886
124 Ga0466966_0021237 3300044684 Bacteria 4264
125 Ga0453684_0032968 3300044712 Bacteria 7233
126 Ga0466971_0004437 3300044719 Bacteria 6058
127 Ga0466968_0005688 3300044735 Bacteria 4671
128 Ga0466970_0045528 3300044765 Bacteria 2336
129 Ga0466957_0045567 3300044842 Bacteria 2660
130 Ga0466959_0000412 3300045049 Bacteria 25029
131 Ga0466959_0166652 3300045049 Bacteria 1547
132 Ga0466958_0046936 3300045836 Bacteria 2607
133 Ga0495580_0074410 3300046472 Bacteria 2370
134 Ga0495605_0027774 3300046474 Bacteria 2928
135 Ga0495583_0005590 3300046506 Bacteria 8478
136 Ga0495610_0062365 3300046512 Bacteria 1768
137 Ga0495648_0030186 3300046524 Bacteria 3588
138 Ga0495665_0077676 3300046531 Bacteria 1747
139 Ga0495621_0017559 3300046539 Bacteria 2315
140 Ga0495645_0288362 3300046543 Bacteria 1077
141 Ga0495622_0049228 3300046557 Bacteria 1956
142 Ga0495669_0225210 3300046684 Bacteria 899
143 Ga0495672_0036706 3300047320 Bacteria 3007
144 Ga0495672_0223845 3300047320 Bacteria 927
145 Ga0495673_0019536 3300047469 Bacteria 3392
146 Ga0495686_0001598 3300047472 Bacteria 23923
147 Ga0495593_0088694 3300047673 Bacteria 1594
148 Ga0495602_0044194 3300048088 Bacteria 4044
149 Ga0496100_0000689 3300048903 Bacteria 16122
150 Ga0496100_0031905 3300048903 Bacteria 3279
151 Ga0496100_0118229 3300048903 Bacteria 1851
152 Ga0496101_0000146 3300048904 Bacteria 61436
153 Ga0496101_0020956 3300048904 Bacteria 4485
154 Ga0496101_0352602 3300048904 Bacteria 1156
155 Ga0496102_0031371 3300048905 Bacteria 4766
156 Ga0496103_0000869 3300048906 Bacteria 21970
157 Ga0496103_0120185 3300048906 Bacteria 1673
158 Ga0496105_0062720 3300048908 Bacteria 3067
159 Ga0496105_0258299 3300048908 Bacteria 1409
160 Ga0496106_0016963 3300048909 Bacteria 5389
161 Ga0496107_0001068 3300048910 Bacteria 16437
162 Ga0496107_0091287 3300048910 Bacteria 2226
163 Ga0496107_0214154 3300048910 Bacteria 1433
164 Ga0496108_0286343 3300048911 Unclassified 1434
165 Ga0496109_0042085 3300048912 Bacteria 4137
166 Ga0496109_0320037 3300048912 Unclassified 1464
167 Ga0496110_0070239 3300048913 Bacteria 3102
168 Ga0496111_0077301 3300048914 Bacteria 2426
169 Ga0496112_0004106 3300048915 Bacteria 12240
170 Ga0496112_0092862 3300048915 Bacteria 2987
171 Ga0496113_0006874 3300048916 Bacteria 7258
172 Ga0496113_0015001 3300048916 Bacteria 5306
173 Ga0496115_0124016 3300048918 Bacteria 2127
174 Ga0496117_0006374 3300048920 Bacteria 11985
175 Ga0496118_0001443 3300048921 Bacteria 35769
176 Ga0496119_0143219 3300048922 Bacteria 1288
177 Ga0496121_0003136 3300048924 Bacteria 23852
178 Ga0496121_0010399 3300048924 Bacteria 10501
179 Ga0496121_0133326 3300048924 Bacteria 1855
180 Ga0496122_0029934 3300048925 Bacteria 4575
181 Ga0496123_0167786 3300048926 Bacteria 1162
182 Ga0496126_0011370 3300048929 Bacteria 9226
183 Ga0496126_0186089 3300048929 Bacteria 1761
184 Ga0495682_0031404 3300049460 Bacteria 1962
185 Ga0501033_0018070 3300049570 Bacteria 5327
186 Ga0501039_0056522 3300049575 Bacteria 3040
187 Ga0501040_0066072 3300049576 Bacteria 2492
188 Ga0501046_0315983 3300049580 Bacteria 1139
189 Ga0501047_0053977 3300049581 Bacteria 3888
190 Ga0501048_0076894 3300049582 Bacteria 2356
191 Ga0501048_0277830 3300049582 Unclassified 1191
192 Ga0501068_0177121 3300049584 Bacteria 1348
193 Ga0501069_0219831 3300049585 Bacteria 1104
194 Ga0501070_0177062 3300049586 Bacteria 1756
195 Ga0501071_0038759 3300049587 Bacteria 3406
196 Ga0501072_0087602 3300049588 Bacteria 2471
197 Ga0501074_0110503 3300049590 Bacteria 1967
198 Ga0501076_0036296 3300049592 Bacteria 3862
199 Ga0501076_0050827 3300049592 Bacteria 3280
200 Ga0501081_0216181 3300049743 Bacteria 1393
201 Ga0501035_0411583 3300049822 Bacteria 1124
202 Ga0501044_0011282 3300049823 Bacteria 9683
203 Ga0501044_0482134 3300049823 Bacteria 1143
204 Ga0501044_0566493 3300049823 Bacteria 1032
205 nmdc:mga03683_97808_c1 3300050489 Bacteria 1287
206 nmdc:mga00v17_57709_c1 3300050491 Bacteria 2375
207 nmdc:mga07m45_5701_c1 3300050496 Bacteria 6228
208 nmdc:mga0sz30_29056_c1 3300050516 Bacteria 2277
209 nmdc:mga0sz30_33220_c1 3300050516 Bacteria 2143
210 Ga0500635_0016942 3300053080 Bacteria 2175
211 Ga0500643_002418 3300053087 Bacteria 9674
212 Ga0500643_006301 3300053087 Bacteria 4977
213 Ga0500608_118244 3300053122 Bacteria 1205
214 Ga0500645_002514 3300053730 Bacteria 8107
215 Ga0501082_0102950 3300060353 Bacteria 2470
216 Ga0466962_0006800 3300061719 Bacteria 5488
217 Ga0530510_0079867 3300061734 Bacteria 2379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0001598 Ga0495686_0001598_13_675 216
2 3300049823 Ga0501044_0566493 Ga0501044_0566493_87_779 224
3 3300006946 Ga0079104_1013711 Ga0079104_10137111 225
4 3300049586 Ga0501070_0177062 Ga0501070_0177062_1015_1710 225
5 3300037471 Ga0395905_0018435 Ga0395905_0018435_5398_6096 231
6 iso_pu_bacteria 2903748898 2903754212 238
7 3300025254 Ga0209148_1026822 Ga0209148_10268221 239
8 3300049570 Ga0501033_0018070 Ga0501033_0018070_1545_2294 239
9 3300049823 Ga0501044_0011282 Ga0501044_0011282_5407_6156 239
10 3300005331 Ga0070670_100000004 Ga0070670_100000004201 240
11 3300005335 Ga0070666_10169113 Ga0070666_101691131 240
12 3300005347 Ga0070668_100005451 Ga0070668_1000054518 240
13 3300005367 Ga0070667_100000175 Ga0070667_10000017521 240
14 3300005548 Ga0070665_100002458 Ga0070665_10000245817 240
15 3300005563 Ga0068855_100017757 Ga0068855_1000177578 240
16 3300005618 Ga0068864_100000082 Ga0068864_10000008230 240
17 3300005841 Ga0068863_100000597 Ga0068863_10000059730 240
18 3300005842 Ga0068858_100007957 Ga0068858_1000079576 240
19 3300005843 Ga0068860_100007905 Ga0068860_10000790513 240
20 3300005844 Ga0068862_100001244 Ga0068862_1000012448 240
21 3300009011 Ga0105251_10042198 Ga0105251_100421983 240
22 3300009093 Ga0105240_10160395 Ga0105240_101603952 240
23 3300009551 Ga0105238_10122566 Ga0105238_101225664 240
24 3300009553 Ga0105249_10000438 Ga0105249_1000043826 240
25 3300014325 Ga0163163_10133136 Ga0163163_101331363 240
26 3300014326 Ga0157380_10238088 Ga0157380_102380883 240
27 3300014968 Ga0157379_10026295 Ga0157379_100262956 240
28 3300025903 Ga0207680_10042296 Ga0207680_100422962 240
29 3300025925 Ga0207650_10000118 Ga0207650_1000011872 240
30 3300025949 Ga0207667_10061463 Ga0207667_100614633 240
31 3300025961 Ga0207712_10157708 Ga0207712_101577082 240
32 3300025972 Ga0207668_10000464 Ga0207668_100004647 240
33 3300025986 Ga0207658_10000354 Ga0207658_100003549 240
34 3300026035 Ga0207703_10005512 Ga0207703_1000551210 240
35 3300026088 Ga0207641_10009868 Ga0207641_100098688 240
36 3300026095 Ga0207676_10000068 Ga0207676_1000006813 240
37 3300028379 Ga0268266_10003723 Ga0268266_1000372316 240
38 3300028380 Ga0268265_10003465 Ga0268265_1000346510 240
39 3300028381 Ga0268264_10000032 Ga0268264_10000032214 240
40 3300048906 Ga0496103_0120185 Ga0496103_0120185_865_1608 240
41 3300005327 Ga0070658_10063293 Ga0070658_100632934 241
42 3300005366 Ga0070659_100195161 Ga0070659_1001951612 241
43 3300006881 Ga0068865_100000097 Ga0068865_10000009725 241
44 3300014325 Ga0163163_10521922 Ga0163163_105219221 241
45 3300039437 Ga0436365_1328561 Ga0436365_1328561_73_819 241
46 3300039447 Ga0436361_0310433 Ga0436361_0310433_132_914 241
47 3300046543 Ga0495645_0288362 Ga0495645_0288362_121_867 241
48 3300049822 Ga0501035_0411583 Ga0501035_0411583_59_850 241
49 3300053080 Ga0500635_0016942 Ga0500635_0016942_674_1420 241
50 3300053122 Ga0500608_118244 Ga0500608_118244_249_995 241
51 3300037471 Ga0395905_0195569 Ga0395905_0195569_677_1420 242
52 3300044712 Ga0453684_0032968 Ga0453684_0032968_571_1335 242
53 3300049581 Ga0501047_0053977 Ga0501047_0053977_100_849 242
54 3300031595 Ga0265313_10000312 Ga0265313_1000031247 243
55 3300046474 Ga0495605_0027774 Ga0495605_0027774_979_1725 243
56 3300048903 Ga0496100_0118229 Ga0496100_0118229_27_773 243
57 3300048918 Ga0496115_0124016 Ga0496115_0124016_1166_1912 243
58 3300031824 Ga0307413_10055930 Ga0307413_100559303 244
59 3300032005 Ga0307411_10363624 Ga0307411_103636242 244
60 3300053087 Ga0500643_002418 Ga0500643_002418_4206_4958 244
61 3300053730 Ga0500645_002514 Ga0500645_002514_5187_5933 244
62 3300006048 Ga0075363_100090865 Ga0075363_1000908652 245
63 3300009551 Ga0105238_10043750 Ga0105238_100437506 245
64 3300014968 Ga0157379_10249026 Ga0157379_102490262 245
65 3300025924 Ga0207694_10053850 Ga0207694_100538502 245
66 3300037471 Ga0395905_0329179 Ga0395905_0329179_271_1041 245
67 3300046539 Ga0495621_0017559 Ga0495621_0017559_1530_2300 245
68 3300050489 nmdc:mga03683_97808_c1 nmdc:mga03683_97808_c1_424_1194 245
69 3300053087 Ga0500643_006301 Ga0500643_006301_3235_3999 245
70 3300005539 Ga0068853_100654163 Ga0068853_1006541631 246
71 3300047320 Ga0495672_0223845 Ga0495672_0223845_86_847 246
72 3300037471 Ga0395905_0000057 Ga0395905_0000057_30133_30894 248
73 3300046472 Ga0495580_0074410 Ga0495580_0074410_1562_2323 248
74 3300046506 Ga0495583_0005590 Ga0495583_0005590_1830_2591 248
75 3300046524 Ga0495648_0030186 Ga0495648_0030186_2346_3107 248
76 3300046531 Ga0495665_0077676 Ga0495665_0077676_317_1078 248
77 3300046557 Ga0495622_0049228 Ga0495622_0049228_873_1634 248
78 3300047469 Ga0495673_0019536 Ga0495673_0019536_866_1627 248
79 3300048904 Ga0496101_0352602 Ga0496101_0352602_134_895 248
80 3300048908 Ga0496105_0258299 Ga0496105_0258299_515_1276 248
81 3300048910 Ga0496107_0091287 Ga0496107_0091287_272_1033 248
82 3300048915 Ga0496112_0004106 Ga0496112_0004106_7006_7767 248
83 3300048916 Ga0496113_0006874 Ga0496113_0006874_6041_6802 248
84 3300048924 Ga0496121_0003136 Ga0496121_0003136_16682_17443 248
85 3300049460 Ga0495682_0031404 Ga0495682_0031404_744_1505 248
86 3300025931 Ga0207644_10009872 Ga0207644_100098725 249
87 3300021361 Ga0213872_10103618 Ga0213872_101036182 250
88 3300049590 Ga0501074_0110503 Ga0501074_0110503_199_1026 253
89 iso_pu_bacteria 2513237166 2514049552 253
90 iso_pu_bacteria 2562617112 2563063454 253
91 iso_pu_bacteria 2711768613 2713474329 253
92 iso_pu_bacteria 2921643360 2921653276 253
93 iso_pu_bacteria 2909042592 2909046443 255
94 3300003320 rootH2_10059801 rootH2_100598015 257
95 3300003323 rootH1_10133742 rootH1_101337423 257
96 3300003354 JGI25160J50197_1000292 JGI25160J50197_100029211 257
97 3300005262 Ga0065165_1000965 Ga0065165_100096531 257
98 3300009093 Ga0105240_10074125 Ga0105240_100741253 257
99 3300016635 Ga0183361_10005 Ga0183361_10005337 257
100 3300025284 Ga0209130_1006143 Ga0209130_10061433 257
101 3300025295 Ga0209564_1002526 Ga0209564_10025266 257
102 3300025302 Ga0207426_1000020 Ga0207426_100002090 257
103 3300025913 Ga0207695_10070101 Ga0207695_100701013 257
104 3300047673 Ga0495593_0088694 Ga0495593_0088694_760_1548 257
105 3300048088 Ga0495602_0044194 Ga0495602_0044194_110_898 257
106 3300048903 Ga0496100_0000689 Ga0496100_0000689_7108_7896 257
107 3300048904 Ga0496101_0000146 Ga0496101_0000146_52456_53244 257
108 3300048905 Ga0496102_0031371 Ga0496102_0031371_1241_2029 257
109 3300048906 Ga0496103_0000869 Ga0496103_0000869_12414_13202 257
110 3300048920 Ga0496117_0006374 Ga0496117_0006374_3177_3965 257
111 3300048921 Ga0496118_0001443 Ga0496118_0001443_8025_8813 257
112 3300048922 Ga0496119_0143219 Ga0496119_0143219_377_1165 257
113 3300048924 Ga0496121_0010399 Ga0496121_0010399_3380_4168 257
114 3300048925 Ga0496122_0029934 Ga0496122_0029934_2016_2804 257
115 3300048926 Ga0496123_0167786 Ga0496123_0167786_105_893 257
116 3300048929 Ga0496126_0186089 Ga0496126_0186089_662_1450 257
117 3300010375 Ga0105239_10891478 Ga0105239_108914782 258
118 iso_pu_bacteria 2821443989 2821446874 258
119 iso_pu_bacteria 2844533157 2844538000 258
120 3300003752 Ga0055539_1000594 Ga0055539_10005947 259
121 3300006186 Ga0075369_10007587 Ga0075369_100075874 259
122 3300009545 Ga0105237_10399703 Ga0105237_103997032 259
123 3300010375 Ga0105239_10209992 Ga0105239_102099923 259
124 3300025253 Ga0209677_105985 Ga0209677_1059854 259
125 3300039438 Ga0436360_0595691 Ga0436360_0595691_10803_11582 259
126 3300039447 Ga0436361_0280905 Ga0436361_0280905_639_1418 259
127 3300039447 Ga0436361_1005442 Ga0436361_1005442_204_983 259
128 3300039453 Ga0436362_0857493 Ga0436362_0857493_59_838 259
129 3300046684 Ga0495669_0225210 Ga0495669_0225210_39_818 259
130 3300050516 nmdc:mga0sz30_29056_c1 nmdc:mga0sz30_29056_c1_26_913 259
131 3300007265 Ga0099794_10057672 Ga0099794_100576722 260
132 3300045049 Ga0466959_0166652 Ga0466959_0166652_341_1141 260
133 3300003773 Ga0055537_1000173 Ga0055537_100017364 261
134 3300003784 Ga0055534_1000171 Ga0055534_10001719 261
135 3300003790 Ga0055528_1000304 Ga0055528_100030454 261
136 3300006051 Ga0075364_10074773 Ga0075364_100747732 261
137 3300006186 Ga0075369_10036484 Ga0075369_100364841 261
138 3300006353 Ga0075370_10005226 Ga0075370_100052263 261
139 3300006948 Ga0099826_10016592 Ga0099826_100165924 261
140 3300025263 Ga0209565_1000040 Ga0209565_1000040259 261
141 3300025273 Ga0209673_1000353 Ga0209673_100035398 261
142 3300025291 Ga0209675_1000024 Ga0209675_10000249 261
143 3300027666 Ga0209282_1001873 Ga0209282_100187310 261
144 3300050491 nmdc:mga00v17_57709_c1 nmdc:mga00v17_57709_c1_1183_1977 261
145 3300050496 nmdc:mga07m45_5701_c1 nmdc:mga07m45_5701_c1_802_1596 261
146 3300050516 nmdc:mga0sz30_33220_c1 nmdc:mga0sz30_33220_c1_123_908 261
147 3300002459 JGI24751J29686_10000313 JGI24751J29686_100003134 262
148 3300003187 JGI25151J46595_10000722 JGI25151J46595_1000072221 262
149 3300005262 Ga0065165_1051734 Ga0065165_10517342 262
150 3300005330 Ga0070690_100135217 Ga0070690_1001352171 262
151 3300005331 Ga0070670_100099784 Ga0070670_1000997842 262
152 3300005353 Ga0070669_100000144 Ga0070669_1000001442 262
153 3300005355 Ga0070671_100000030 Ga0070671_10000003040 262
154 3300005548 Ga0070665_100096671 Ga0070665_1000966712 262
155 3300005563 Ga0068855_100024611 Ga0068855_1000246112 262
156 3300005577 Ga0068857_100119247 Ga0068857_1001192472 262
157 3300005617 Ga0068859_100054773 Ga0068859_1000547732 262
158 3300005618 Ga0068864_100342679 Ga0068864_1003426792 262
159 3300005842 Ga0068858_100070236 Ga0068858_1000702362 262
160 3300005843 Ga0068860_100104260 Ga0068860_1001042602 262
161 3300005843 Ga0068860_100183948 Ga0068860_1001839482 262
162 3300006931 Ga0097620_100054776 Ga0097620_1000547762 262
163 3300009177 Ga0105248_10029212 Ga0105248_100292125 262
164 3300009177 Ga0105248_10233433 Ga0105248_102334331 262
165 3300009177 Ga0105248_10674619 Ga0105248_106746192 262
166 3300009553 Ga0105249_10190879 Ga0105249_101908792 262
167 3300025284 Ga0209130_1001013 Ga0209130_10010135 262
168 3300025294 Ga0209025_1001472 Ga0209025_10014725 262
169 3300025297 Ga0209758_1005796 Ga0209758_10057965 262
170 3300025302 Ga0207426_1000451 Ga0207426_10004515 262
171 3300025315 Ga0207697_10063407 Ga0207697_100634071 262
172 3300025923 Ga0207681_10000146 Ga0207681_100001462 262
173 3300025931 Ga0207644_10000011 Ga0207644_10000011138 262
174 3300025949 Ga0207667_10002471 Ga0207667_1000247118 262
175 3300025972 Ga0207668_10180799 Ga0207668_101807992 262
176 3300025972 Ga0207668_10313444 Ga0207668_103134442 262
177 3300026035 Ga0207703_10043976 Ga0207703_100439761 262
178 3300028379 Ga0268266_10188439 Ga0268266_101884392 262
179 3300028381 Ga0268264_10049145 Ga0268264_100491453 262
180 3300028381 Ga0268264_10157766 Ga0268264_101577661 262
181 3300041997 Ga0439431_0008429 Ga0439431_0008429_1268_2065 262
182 3300044658 Ga0466972_0018639 Ga0466972_0018639_1168_1986 262
183 3300044672 Ga0466982_0000013 Ga0466982_0000013_5822_6640 262
184 3300044683 Ga0466965_0001366 Ga0466965_0001366_1198_2016 262
185 3300044683 Ga0466965_0005119 Ga0466965_0005119_1821_2648 262
186 3300044684 Ga0466966_0021237 Ga0466966_0021237_1251_2078 262
187 3300044719 Ga0466971_0004437 Ga0466971_0004437_4642_5460 262
188 3300044735 Ga0466968_0005688 Ga0466968_0005688_2995_3813 262
189 3300044765 Ga0466970_0045528 Ga0466970_0045528_936_1763 262
190 3300044842 Ga0466957_0045567 Ga0466957_0045567_197_1015 262
191 3300045049 Ga0466959_0000412 Ga0466959_0000412_5197_6036 262
192 3300045836 Ga0466958_0046936 Ga0466958_0046936_1525_2343 262
193 3300046512 Ga0495610_0062365 Ga0495610_0062365_311_1114 262
194 3300047320 Ga0495672_0036706 Ga0495672_0036706_1221_2075 262
195 3300048903 Ga0496100_0031905 Ga0496100_0031905_2123_2911 262
196 3300048904 Ga0496101_0020956 Ga0496101_0020956_1145_1933 262
197 3300048908 Ga0496105_0062720 Ga0496105_0062720_456_1244 262
198 3300048909 Ga0496106_0016963 Ga0496106_0016963_3243_4031 262
199 3300048910 Ga0496107_0001068 Ga0496107_0001068_3220_4008 262
200 3300048910 Ga0496107_0214154 Ga0496107_0214154_132_920 262
201 3300048911 Ga0496108_0286343 Ga0496108_0286343_98_886 262
202 3300048912 Ga0496109_0042085 Ga0496109_0042085_406_1194 262
203 3300048912 Ga0496109_0320037 Ga0496109_0320037_25_813 262
204 3300048913 Ga0496110_0070239 Ga0496110_0070239_1853_2641 262
205 3300048914 Ga0496111_0077301 Ga0496111_0077301_899_1687 262
206 3300048915 Ga0496112_0092862 Ga0496112_0092862_1120_1908 262
207 3300048916 Ga0496113_0015001 Ga0496113_0015001_1923_2711 262
208 3300048924 Ga0496121_0133326 Ga0496121_0133326_838_1731 262
209 3300048929 Ga0496126_0011370 Ga0496126_0011370_5813_6601 262
210 3300049575 Ga0501039_0056522 Ga0501039_0056522_109_963 262
211 3300049576 Ga0501040_0066072 Ga0501040_0066072_403_1347 262
212 3300049580 Ga0501046_0315983 Ga0501046_0315983_33_881 262
213 3300049582 Ga0501048_0076894 Ga0501048_0076894_515_1369 262
214 3300049582 Ga0501048_0277830 Ga0501048_0277830_206_1000 262
215 3300049584 Ga0501068_0177121 Ga0501068_0177121_395_1249 262
216 3300049585 Ga0501069_0219831 Ga0501069_0219831_86_940 262
217 3300049587 Ga0501071_0038759 Ga0501071_0038759_937_1785 262
218 3300049588 Ga0501072_0087602 Ga0501072_0087602_1292_2146 262
219 3300049592 Ga0501076_0036296 Ga0501076_0036296_2942_3790 262
220 3300049592 Ga0501076_0050827 Ga0501076_0050827_1855_2709 262
221 3300049743 Ga0501081_0216181 Ga0501081_0216181_488_1336 262
222 3300049823 Ga0501044_0482134 Ga0501044_0482134_124_912 262
223 3300060353 Ga0501082_0102950 Ga0501082_0102950_1234_2088 262
224 3300061719 Ga0466962_0006800 Ga0466962_0006800_1853_2671 262
225 3300061734 Ga0530510_0079867 Ga0530510_0079867_69_917 262

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qei-assembly1.cif.gz_A structure of human mthfd2l in complex with th7299 0.8004 10 75
6ecr-assembly1.cif.gz_A the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp 0.7993 9 75
6ecq-assembly1.cif.gz_A the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp and inhibitor ly345899 0.7936 9 75
3brq-assembly1.cif.gz_A crystal structure of the escherichia coli transcriptional repressor ascg 0.7922 10 75
6s4a-assembly1.cif.gz_A structure of human mthfd2 in complex with th9028 0.7821 10 75
ID Description Score Start End Superfamily
1a4iA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.7848 9 80 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.7768 9 72 3.40.50.10860
af_Q54VK0_115_197_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.7741 9 79 3.40.50.10860
af_P43340_1_196_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7685 9 49 3.40.50.360
4kq9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7596 9 79 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Q7B3L4-F1-model_v4 Glycosyl transferase 0.9836 1 259
AF-B9TQ46-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9832 9 101
AF-A0A382KMY8-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9819 9 98
AF-A0A4Q5V6C8-F1-model_v4 deleted 0.9791 1 96
AF-A0A1Q7B3L4-F1-model_v4 Glycosyl transferase 0.9723 1 259

Feature Viewer

pLDDT pTM Quality
94.01 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map