F337872

General Info

Members Datasets Scaffolds Average Seq Length
225 135 225 341

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10046131|Ga0207689_100461313
Length 362
Sequence MRAASSGLGATQSPVRFTALMSVLHLLGTAGEGGAETYFVDLATSLAQAGVSQAAALRGNANRQAALQAAGVPSAVCRFGGPLDFATRPQVAGFARKHEVKLALAWMNRAARHTPKGPWARIGRLGGYYNLKYYRGFDALVANTEDIADWIIAQGWPAGHVRYIPNFAAAPPDQAPAERAALATPAQAPLLLSMGRLHEAKGHDVSLQALAQLPDAYLWIAGVGPLEAKLKALAAALGVAERVRFLGWRTDAAALYRACDLVVFPSRYEPLGNVVIQSWAHGAPVAAAAAQGPAALIRDGEDGLLVPIDDPDALGQAIARALADPALRARLARNGQARVAAEFSRAAVIAQWRQLFSDYGAS

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
125 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
126 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
127 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
128 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
131 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
134 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
135 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.78
Nodule 0
Rhizoplane 4
Rhizosphere 75.11
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10002761 3300003794 Bacteria 11519
2 Ga0065165_1001058 3300005262 Bacteria 32976
3 Ga0070670_100000122 3300005331 Bacteria 72250
4 Ga0070670_100015504 3300005331 Bacteria 6545
5 Ga0070680_100003535 3300005336 Bacteria 11662
6 Ga0070691_10005952 3300005341 Bacteria 5564
7 Ga0070668_100000184 3300005347 Bacteria 40584
8 Ga0070668_100003415 3300005347 Bacteria 11723
9 Ga0070668_100167718 3300005347 Bacteria 1786
10 Ga0070659_100025051 3300005366 Bacteria 4579
11 Ga0070667_100000305 3300005367 Bacteria 54805
12 Ga0070667_100011666 3300005367 Bacteria 7264
13 Ga0070667_100145884 3300005367 Bacteria 2076
14 Ga0070681_10043945 3300005458 Bacteria 4472
15 Ga0070681_10064078 3300005458 Bacteria 3647
16 Ga0070679_100039801 3300005530 Bacteria 4673
17 Ga0070679_100297608 3300005530 Bacteria 1564
18 Ga0068853_100019393 3300005539 Bacteria 5637
19 Ga0070665_100000144 3300005548 Bacteria 132302
20 Ga0070665_100000342 3300005548 Bacteria 70496
21 Ga0070665_100000476 3300005548 Bacteria 57814
22 Ga0070665_100121064 3300005548 Bacteria 2618
23 Ga0068855_100032231 3300005563 Bacteria 6257
24 Ga0068855_100279990 3300005563 Bacteria 1852
25 Ga0068857_100073864 3300005577 Bacteria 3039
26 Ga0068859_100002564 3300005617 Bacteria 18451
27 Ga0068859_100179446 3300005617 Bacteria 2200
28 Ga0068864_100000209 3300005618 Bacteria 52622
29 Ga0068864_100001107 3300005618 Bacteria 22544
30 Ga0068861_100213845 3300005719 Bacteria 1625
31 Ga0068861_100315913 3300005719 Bacteria 1359
32 Ga0068863_100000061 3300005841 Bacteria 121811
33 Ga0068863_100000158 3300005841 Bacteria 71918
34 Ga0068863_100002175 3300005841 Bacteria 19429
35 Ga0068858_100000149 3300005842 Bacteria 73242
36 Ga0068858_100003015 3300005842 Bacteria 16890
37 Ga0068858_100038560 3300005842 Bacteria 4433
38 Ga0068858_100457377 3300005842 Bacteria 1230
39 Ga0068860_100000104 3300005843 Bacteria 138111
40 Ga0068860_100000123 3300005843 Bacteria 124700
41 Ga0068860_100018038 3300005843 Bacteria 6872
42 Ga0068862_100001072 3300005844 Bacteria 26218
43 Ga0075364_10004003 3300006051 Bacteria 8463
44 Ga0075362_10077689 3300006177 Bacteria 1526
45 Ga0075366_10012347 3300006195 Bacteria 4843
46 Ga0097620_100002563 3300006931 Bacteria 18451
47 Ga0097620_100179445 3300006931 Bacteria 2200
48 Ga0105240_10006131 3300009093 Bacteria 17731
49 Ga0105240_10028287 3300009093 Bacteria 7322
50 Ga0105248_10119585 3300009177 Bacteria 2971
51 Ga0105248_10214722 3300009177 Bacteria 2167
52 Ga0105248_10219017 3300009177 Bacteria 2143
53 Ga0105237_10070336 3300009545 Bacteria 3495
54 Ga0105238_10137587 3300009551 Bacteria 2420
55 Ga0105238_10198498 3300009551 Bacteria 1981
56 Ga0105238_10217039 3300009551 Bacteria 1889
57 Ga0105249_10002602 3300009553 Bacteria 15636
58 Ga0105249_10279947 3300009553 Bacteria 1665
59 Ga0105239_10297045 3300010375 Bacteria 1819
60 Ga0163162_10111797 3300013306 Bacteria 2830
61 Ga0163162_10235551 3300013306 Bacteria 1961
62 Ga0163163_10001426 3300014325 Bacteria 20233
63 Ga0163163_10009354 3300014325 Bacteria 8748
64 Ga0163163_10081025 3300014325 Bacteria 3247
65 Ga0163163_10302096 3300014325 Bacteria 1653
66 Ga0157379_10001376 3300014968 Bacteria 19905
67 Ga0157379_10015734 3300014968 Bacteria 6648
68 Ga0157379_10018796 3300014968 Bacteria 6095
69 Ga0209026_1001615 3300025250 Bacteria 9651
70 Ga0209758_1002891 3300025297 Bacteria 16602
71 Ga0209050_1000029 3300025298 Bacteria 465801
72 Ga0209257_1000152 3300025304 Bacteria 189432
73 Ga0209257_1001271 3300025304 Bacteria 30931
74 Ga0207707_10033275 3300025912 Bacteria 4512
75 Ga0207707_10177177 3300025912 Bacteria 1862
76 Ga0207695_10001763 3300025913 Bacteria 34269
77 Ga0207695_10004631 3300025913 Bacteria 18652
78 Ga0207695_10018131 3300025913 Bacteria 8147
79 Ga0207695_10366860 3300025913 Bacteria 1326
80 Ga0207660_10012001 3300025917 Bacteria 5658
81 Ga0207657_10003160 3300025919 Bacteria 17616
82 Ga0207652_10100415 3300025921 Bacteria 2554
83 Ga0207694_10116217 3300025924 Bacteria 2132
84 Ga0207650_10000031 3300025925 Bacteria 230128
85 Ga0207650_10026860 3300025925 Bacteria 4113
86 Ga0207650_10033529 3300025925 Bacteria 3720
87 Ga0207644_10000926 3300025931 Bacteria 18647
88 Ga0207690_10192406 3300025932 Bacteria 1543
89 Ga0207706_10035218 3300025933 Bacteria 4452
90 Ga0207711_10007505 3300025941 Bacteria 9119
91 Ga0207711_10020507 3300025941 Bacteria 5512
92 Ga0207711_10086442 3300025941 Bacteria 2749
93 Ga0207689_10046131 3300025942 Bacteria 3603
94 Ga0207679_10291405 3300025945 Bacteria 1403
95 Ga0207667_10474598 3300025949 Bacteria 1270
96 Ga0207712_10001543 3300025961 Bacteria 15578
97 Ga0207712_10048018 3300025961 Bacteria 2967
98 Ga0207668_10000087 3300025972 Bacteria 69565
99 Ga0207668_10000175 3300025972 Bacteria 43601
100 Ga0207668_10011926 3300025972 Bacteria 5302
101 Ga0207668_10034133 3300025972 Bacteria 3376
102 Ga0207668_10151162 3300025972 Bacteria 1797
103 Ga0207658_10000084 3300025986 Bacteria 104409
104 Ga0207658_10007826 3300025986 Bacteria 7280
105 Ga0207677_10096758 3300026023 Bacteria 2161
106 Ga0207703_10000050 3300026035 Bacteria 145849
107 Ga0207703_10003890 3300026035 Bacteria 12397
108 Ga0207703_10027908 3300026035 Bacteria 4445
109 Ga0207641_10000118 3300026088 Bacteria 117721
110 Ga0207641_10000558 3300026088 Bacteria 41636
111 Ga0207641_10005259 3300026088 Bacteria 11063
112 Ga0207676_10000312 3300026095 Bacteria 41651
113 Ga0207676_10001720 3300026095 Bacteria 16120
114 Ga0207676_10278783 3300026095 Bacteria 1517
115 Ga0207674_10055328 3300026116 Bacteria 4034
116 Ga0207675_100030320 3300026118 Bacteria 5037
117 Ga0268266_10000003 3300028379 Bacteria 1701703
118 Ga0268266_10003116 3300028379 Bacteria 16874
119 Ga0268266_10023839 3300028379 Bacteria 5207
120 Ga0268266_10088427 3300028379 Bacteria 2711
121 Ga0268265_10002030 3300028380 Bacteria 15880
122 Ga0268265_10002515 3300028380 Bacteria 13726
123 Ga0268265_10043714 3300028380 Bacteria 3332
124 Ga0268265_10116987 3300028380 Bacteria 2188
125 Ga0268264_10000008 3300028381 Bacteria 773387
126 Ga0268264_10000861 3300028381 Bacteria 32169
127 Ga0265318_10060183 3300028577 Bacteria 1415
128 Ga0307517_10001670 3300028786 Bacteria 36710
129 Ga0307517_10183289 3300028786 Bacteria 1346
130 Ga0265338_10071399 3300028800 Bacteria 2970
131 Ga0307511_10083173 3300030521 Bacteria 2232
132 Ga0265320_10001208 3300031240 Bacteria 18969
133 Ga0265320_10065377 3300031240 Bacteria 1726
134 Ga0265327_10002686 3300031251 Bacteria 18262
135 Ga0265327_10020078 3300031251 Bacteria 4085
136 Ga0307513_10000069 3300031456 Bacteria 140558
137 Ga0307513_10004456 3300031456 Bacteria 18698
138 Ga0307513_10011955 3300031456 Bacteria 10749
139 Ga0307513_10028705 3300031456 Bacteria 6355
140 Ga0265314_10004476 3300031711 Bacteria 12958
141 Ga0307516_10000001 3300031730 Bacteria 510338
142 Ga0307405_10177809 3300031731 Bacteria 1525
143 Ga0307510_10025518 3300033180 Bacteria 6813
144 Ga0373927_0000155 3300035695 Bacteria 53529
145 Ga0373925_0000032 3300037068 Bacteria 145357
146 Ga0395899_0002151 3300037312 Bacteria 16183
147 Ga0395899_0105834 3300037312 Bacteria 2026
148 Ga0395900_0004165 3300037418 Bacteria 15390
149 Ga0395900_0140704 3300037418 Bacteria 2471
150 Ga0395898_0022096 3300037466 Bacteria 6445
151 Ga0395898_0025900 3300037466 Bacteria 5905
152 Ga0395905_0003636 3300037471 Bacteria 16384
153 Ga0395905_0036780 3300037471 Bacteria 4599
154 Ga0395905_0247322 3300037471 Bacteria 1666
155 Ga0395905_0291374 3300037471 Bacteria 1519
156 Ga0395901_0000022 3300038443 Bacteria 296356
157 Ga0395901_0019772 3300038443 Bacteria 6886
158 Ga0395901_0162644 3300038443 Bacteria 2344
159 Ga0436365_0597037 3300039437 Bacteria 3401
160 Ga0453684_0000006 3300044712 Bacteria 1364191
161 Ga0453684_0000048 3300044712 Bacteria 559743
162 Ga0453684_0063484 3300044712 Bacteria 4724
163 Ga0453684_0095312 3300044712 Bacteria 3658
164 Ga0466957_0218131 3300044842 Bacteria 1259
165 Ga0495629_0049983 3300046459 Bacteria 2930
166 Ga0495606_0204822 3300046507 Bacteria 1122
167 Ga0495620_0081734 3300046515 Bacteria 1306
168 Ga0495628_0124225 3300046516 Bacteria 1978
169 Ga0495643_0159631 3300046522 Bacteria 1110
170 Ga0495642_0004055 3300046528 Bacteria 5717
171 Ga0495609_0017966 3300046538 Bacteria 3281
172 Ga0495597_0005154 3300046542 Bacteria 6963
173 Ga0495645_0126998 3300046543 Bacteria 1791
174 Ga0495622_0000427 3300046557 Bacteria 27809
175 Ga0495668_0165512 3300046616 Bacteria 1211
176 Ga0495611_0151014 3300046648 Bacteria 1084
177 Ga0495669_0000147 3300046684 Bacteria 45027
178 Ga0495669_0064105 3300046684 Bacteria 1667
179 Ga0495613_0000188 3300046689 Bacteria 60791
180 Ga0495636_0022178 3300047318 Bacteria 2566
181 Ga0495686_0003413 3300047472 Bacteria 13818
182 Ga0496102_0033652 3300048905 Bacteria 4607
183 Ga0496102_0228076 3300048905 Bacteria 1756
184 Ga0496106_0056130 3300048909 Bacteria 2977
185 Ga0496108_0147634 3300048911 Bacteria 2028
186 Ga0496109_0248654 3300048912 Bacteria 1674
187 Ga0496112_0140237 3300048915 Bacteria 2387
188 Ga0496115_0001272 3300048918 Bacteria 18065
189 Ga0496115_0009874 3300048918 Bacteria 7106
190 Ga0496115_0252654 3300048918 Bacteria 1451
191 Ga0496116_0143040 3300048919 Bacteria 1342
192 Ga0496117_0042115 3300048920 Bacteria 3337
193 Ga0496118_0000977 3300048921 Bacteria 44572
194 Ga0496119_0022184 3300048922 Bacteria 4557
195 Ga0496121_0000059 3300048924 Bacteria 278177
196 Ga0501031_0051299 3300049568 Unclassified 2687
197 Ga0501034_0019586 3300049571 Bacteria 6919
198 Ga0501037_0062987 3300049573 Bacteria 2704
199 Ga0501047_0004809 3300049581 Bacteria 12701
200 Ga0501047_0040984 3300049581 Bacteria 4477
201 Ga0501047_0208628 3300049581 Bacteria 1812
202 Ga0501035_0027230 3300049822 Bacteria 5225
203 Ga0501044_0028646 3300049823 Bacteria 5878
204 nmdc:mga00v17_1117_c2 3300050491 Bacteria 10891
205 nmdc:mga0k408_10486_c1 3300050493 Bacteria 5012
206 nmdc:mga07m45_72382_c1 3300050496 Bacteria 1962
207 nmdc:mga07m45_91638_c1 3300050496 Bacteria 1742
208 Ga0500651_0051896 3300053093 Bacteria 2572
209 Ga0500641_0111894 3300053096 Bacteria 1175
210 Ga0500555_019045 3300053103 Bacteria 1977
211 Ga0500562_000622 3300053108 Bacteria 8550
212 Ga0500562_001955 3300053108 Bacteria 5169
213 Ga0500572_000253 3300053111 Bacteria 19177
214 Ga0500572_023858 3300053111 Bacteria 1646
215 Ga0500595_002552 3300053119 Bacteria 8919
216 Ga0500608_010425 3300053122 Bacteria 3989
217 Ga0500614_002966 3300053123 Bacteria 3703
218 Ga0500559_0000001 3300053136 Bacteria 325464
219 Ga0500559_0013421 3300053136 Bacteria 3469
220 Ga0500590_002644 3300053148 Bacteria 8043
221 Ga0500636_0029571 3300053177 Bacteria 3237
222 Ga0500636_0182818 3300053177 Bacteria 1124
223 Ga0500637_0014266 3300053178 Bacteria 4188
224 Ga0500625_032055 3300053729 Bacteria 2494
225 Ga0500596_004686 3300053735 Bacteria 2484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0182818 Ga0500636_0182818_193_1080 275
2 3300053111 Ga0500572_023858 Ga0500572_023858_716_1636 306
3 3300053136 Ga0500559_0000001 Ga0500559_0000001_205266_206291 307
4 3300053111 Ga0500572_000253 Ga0500572_000253_11829_12854 308
5 3300046689 Ga0495613_0000188 Ga0495613_0000188_38780_39805 328
6 3300037312 Ga0395899_0105834 Ga0395899_0105834_750_1775 331
7 3300037418 Ga0395900_0140704 Ga0395900_0140704_1147_2172 331
8 3300038443 Ga0395901_0019772 Ga0395901_0019772_4992_6017 331
9 3300031251 Ga0265327_10020078 Ga0265327_100200782 332
10 3300049581 Ga0501047_0004809 Ga0501047_0004809_3420_4448 333
11 3300048909 Ga0496106_0056130 Ga0496106_0056130_634_1659 334
12 3300048918 Ga0496115_0252654 Ga0496115_0252654_17_1042 334
13 3300049568 Ga0501031_0051299 Ga0501031_0051299_309_1343 334
14 3300049571 Ga0501034_0019586 Ga0501034_0019586_5129_6163 334
15 3300049823 Ga0501044_0028646 Ga0501044_0028646_896_1930 334
16 3300053108 Ga0500562_001955 Ga0500562_001955_3029_4057 334
17 3300044712 Ga0453684_0063484 Ga0453684_0063484_572_1600 340
18 3300028577 Ga0265318_10060183 Ga0265318_100601832 341
19 3300028800 Ga0265338_10071399 Ga0265338_100713992 341
20 3300031240 Ga0265320_10001208 Ga0265320_100012087 341
21 3300031240 Ga0265320_10065377 Ga0265320_100653772 341
22 3300031711 Ga0265314_10004476 Ga0265314_100044762 341
23 3300044712 Ga0453684_0000006 Ga0453684_0000006_1348244_1349275 341
24 3300044712 Ga0453684_0000048 Ga0453684_0000048_315790_316821 341
25 3300044712 Ga0453684_0095312 Ga0453684_0095312_926_1954 341
26 3300003794 Ga0055531_10002761 Ga0055531_100027611 342
27 3300005262 Ga0065165_1001058 Ga0065165_10010582 342
28 3300005331 Ga0070670_100000122 Ga0070670_10000012243 342
29 3300005331 Ga0070670_100015504 Ga0070670_1000155043 342
30 3300005336 Ga0070680_100003535 Ga0070680_10000353517 342
31 3300005341 Ga0070691_10005952 Ga0070691_100059522 342
32 3300005347 Ga0070668_100000184 Ga0070668_10000018420 342
33 3300005347 Ga0070668_100003415 Ga0070668_1000034152 342
34 3300005347 Ga0070668_100167718 Ga0070668_1001677182 342
35 3300005366 Ga0070659_100025051 Ga0070659_1000250512 342
36 3300005367 Ga0070667_100000305 Ga0070667_10000030528 342
37 3300005367 Ga0070667_100011666 Ga0070667_1000116667 342
38 3300005367 Ga0070667_100145884 Ga0070667_1001458842 342
39 3300005458 Ga0070681_10043945 Ga0070681_100439454 342
40 3300005458 Ga0070681_10064078 Ga0070681_100640782 342
41 3300005530 Ga0070679_100039801 Ga0070679_1000398014 342
42 3300005530 Ga0070679_100297608 Ga0070679_1002976082 342
43 3300005539 Ga0068853_100019393 Ga0068853_1000193933 342
44 3300005548 Ga0070665_100000144 Ga0070665_10000014494 342
45 3300005548 Ga0070665_100000342 Ga0070665_1000003422 342
46 3300005548 Ga0070665_100000476 Ga0070665_10000047624 342
47 3300005548 Ga0070665_100121064 Ga0070665_1001210644 342
48 3300005563 Ga0068855_100032231 Ga0068855_1000322312 342
49 3300005563 Ga0068855_100279990 Ga0068855_1002799902 342
50 3300005577 Ga0068857_100073864 Ga0068857_1000738643 342
51 3300005617 Ga0068859_100002564 Ga0068859_10000256414 342
52 3300005617 Ga0068859_100179446 Ga0068859_1001794462 342
53 3300005618 Ga0068864_100000209 Ga0068864_10000020919 342
54 3300005618 Ga0068864_100001107 Ga0068864_1000011075 342
55 3300005719 Ga0068861_100213845 Ga0068861_1002138452 342
56 3300005719 Ga0068861_100315913 Ga0068861_1003159132 342
57 3300005841 Ga0068863_100000061 Ga0068863_10000006121 342
58 3300005841 Ga0068863_100000158 Ga0068863_10000015819 342
59 3300005841 Ga0068863_100002175 Ga0068863_1000021752 342
60 3300005842 Ga0068858_100000149 Ga0068858_10000014930 342
61 3300005842 Ga0068858_100003015 Ga0068858_1000030153 342
62 3300005842 Ga0068858_100038560 Ga0068858_1000385602 342
63 3300005842 Ga0068858_100457377 Ga0068858_1004573771 342
64 3300005843 Ga0068860_100000104 Ga0068860_10000010492 342
65 3300005843 Ga0068860_100000123 Ga0068860_10000012398 342
66 3300005843 Ga0068860_100018038 Ga0068860_1000180384 342
67 3300005844 Ga0068862_100001072 Ga0068862_10000107220 342
68 3300006051 Ga0075364_10004003 Ga0075364_100040033 342
69 3300006177 Ga0075362_10077689 Ga0075362_100776892 342
70 3300006195 Ga0075366_10012347 Ga0075366_100123472 342
71 3300006931 Ga0097620_100002563 Ga0097620_10000256314 342
72 3300006931 Ga0097620_100179445 Ga0097620_1001794452 342
73 3300009093 Ga0105240_10006131 Ga0105240_100061312 342
74 3300009093 Ga0105240_10028287 Ga0105240_100282875 342
75 3300009177 Ga0105248_10119585 Ga0105248_101195854 342
76 3300009177 Ga0105248_10214722 Ga0105248_102147221 342
77 3300009177 Ga0105248_10219017 Ga0105248_102190172 342
78 3300009545 Ga0105237_10070336 Ga0105237_100703362 342
79 3300009551 Ga0105238_10137587 Ga0105238_101375872 342
80 3300009551 Ga0105238_10198498 Ga0105238_101984982 342
81 3300009551 Ga0105238_10217039 Ga0105238_102170392 342
82 3300009553 Ga0105249_10002602 Ga0105249_1000260214 342
83 3300009553 Ga0105249_10279947 Ga0105249_102799472 342
84 3300010375 Ga0105239_10297045 Ga0105239_102970451 342
85 3300013306 Ga0163162_10111797 Ga0163162_101117972 342
86 3300013306 Ga0163162_10235551 Ga0163162_102355512 342
87 3300014325 Ga0163163_10001426 Ga0163163_100014262 342
88 3300014325 Ga0163163_10009354 Ga0163163_100093545 342
89 3300014325 Ga0163163_10081025 Ga0163163_100810255 342
90 3300014325 Ga0163163_10302096 Ga0163163_103020962 342
91 3300014968 Ga0157379_10001376 Ga0157379_1000137614 342
92 3300014968 Ga0157379_10015734 Ga0157379_100157342 342
93 3300014968 Ga0157379_10018796 Ga0157379_100187965 342
94 3300025250 Ga0209026_1001615 Ga0209026_100161512 342
95 3300025297 Ga0209758_1002891 Ga0209758_100289123 342
96 3300025298 Ga0209050_1000029 Ga0209050_1000029288 342
97 3300025304 Ga0209257_1000152 Ga0209257_100015228 342
98 3300025304 Ga0209257_1001271 Ga0209257_100127115 342
99 3300025912 Ga0207707_10033275 Ga0207707_100332752 342
100 3300025912 Ga0207707_10177177 Ga0207707_101771772 342
101 3300025913 Ga0207695_10001763 Ga0207695_1000176322 342
102 3300025913 Ga0207695_10004631 Ga0207695_1000463113 342
103 3300025913 Ga0207695_10018131 Ga0207695_100181315 342
104 3300025913 Ga0207695_10366860 Ga0207695_103668601 342
105 3300025917 Ga0207660_10012001 Ga0207660_100120013 342
106 3300025919 Ga0207657_10003160 Ga0207657_1000316017 342
107 3300025921 Ga0207652_10100415 Ga0207652_101004151 342
108 3300025924 Ga0207694_10116217 Ga0207694_101162172 342
109 3300025925 Ga0207650_10000031 Ga0207650_1000003127 342
110 3300025925 Ga0207650_10026860 Ga0207650_100268603 342
111 3300025925 Ga0207650_10033529 Ga0207650_100335293 342
112 3300025931 Ga0207644_10000926 Ga0207644_1000092610 342
113 3300025932 Ga0207690_10192406 Ga0207690_101924061 342
114 3300025933 Ga0207706_10035218 Ga0207706_100352182 342
115 3300025941 Ga0207711_10007505 Ga0207711_100075055 342
116 3300025941 Ga0207711_10020507 Ga0207711_100205076 342
117 3300025941 Ga0207711_10086442 Ga0207711_100864422 342
118 3300025942 Ga0207689_10046131 Ga0207689_100461313 342
119 3300025945 Ga0207679_10291405 Ga0207679_102914051 342
120 3300025949 Ga0207667_10474598 Ga0207667_104745982 342
121 3300025961 Ga0207712_10001543 Ga0207712_100015438 342
122 3300025961 Ga0207712_10048018 Ga0207712_100480182 342
123 3300025972 Ga0207668_10000087 Ga0207668_1000008750 342
124 3300025972 Ga0207668_10000175 Ga0207668_1000017520 342
125 3300025972 Ga0207668_10011926 Ga0207668_100119262 342
126 3300025972 Ga0207668_10034133 Ga0207668_100341332 342
127 3300025972 Ga0207668_10151162 Ga0207668_101511622 342
128 3300025986 Ga0207658_10000084 Ga0207658_1000008464 342
129 3300025986 Ga0207658_10007826 Ga0207658_100078262 342
130 3300026023 Ga0207677_10096758 Ga0207677_100967582 342
131 3300026035 Ga0207703_10000050 Ga0207703_1000005044 342
132 3300026035 Ga0207703_10003890 Ga0207703_100038904 342
133 3300026035 Ga0207703_10027908 Ga0207703_100279082 342
134 3300026088 Ga0207641_10000118 Ga0207641_1000011898 342
135 3300026088 Ga0207641_10000558 Ga0207641_1000055838 342
136 3300026088 Ga0207641_10005259 Ga0207641_100052592 342
137 3300026095 Ga0207676_10000312 Ga0207676_1000031218 342
138 3300026095 Ga0207676_10001720 Ga0207676_1000172014 342
139 3300026095 Ga0207676_10278783 Ga0207676_102787832 342
140 3300026116 Ga0207674_10055328 Ga0207674_100553282 342
141 3300026118 Ga0207675_100030320 Ga0207675_1000303203 342
142 3300028379 Ga0268266_10000003 Ga0268266_10000003386 342
143 3300028379 Ga0268266_10003116 Ga0268266_100031167 342
144 3300028379 Ga0268266_10023839 Ga0268266_100238394 342
145 3300028379 Ga0268266_10088427 Ga0268266_100884272 342
146 3300028380 Ga0268265_10002030 Ga0268265_100020309 342
147 3300028380 Ga0268265_10002515 Ga0268265_1000251511 342
148 3300028380 Ga0268265_10043714 Ga0268265_100437143 342
149 3300028380 Ga0268265_10116987 Ga0268265_101169872 342
150 3300028381 Ga0268264_10000008 Ga0268264_10000008394 342
151 3300028381 Ga0268264_10000861 Ga0268264_1000086127 342
152 3300028786 Ga0307517_10001670 Ga0307517_1000167039 342
153 3300028786 Ga0307517_10183289 Ga0307517_101832891 342
154 3300030521 Ga0307511_10083173 Ga0307511_100831732 342
155 3300031251 Ga0265327_10002686 Ga0265327_100026861 342
156 3300031456 Ga0307513_10000069 Ga0307513_1000006980 342
157 3300031456 Ga0307513_10004456 Ga0307513_1000445625 342
158 3300031456 Ga0307513_10011955 Ga0307513_100119553 342
159 3300031456 Ga0307513_10028705 Ga0307513_100287057 342
160 3300031730 Ga0307516_10000001 Ga0307516_1000000169 342
161 3300031731 Ga0307405_10177809 Ga0307405_101778092 342
162 3300033180 Ga0307510_10025518 Ga0307510_100255185 342
163 3300035695 Ga0373927_0000155 Ga0373927_0000155_52037_53065 342
164 3300037068 Ga0373925_0000032 Ga0373925_0000032_9244_10272 342
165 3300037312 Ga0395899_0002151 Ga0395899_0002151_6181_7209 342
166 3300037418 Ga0395900_0004165 Ga0395900_0004165_3002_4030 342
167 3300037466 Ga0395898_0022096 Ga0395898_0022096_1491_2519 342
168 3300037466 Ga0395898_0025900 Ga0395898_0025900_1133_2167 342
169 3300037471 Ga0395905_0003636 Ga0395905_0003636_5048_6076 342
170 3300037471 Ga0395905_0036780 Ga0395905_0036780_401_1435 342
171 3300037471 Ga0395905_0247322 Ga0395905_0247322_323_1354 342
172 3300037471 Ga0395905_0291374 Ga0395905_0291374_311_1339 342
173 3300038443 Ga0395901_0000022 Ga0395901_0000022_8102_9130 342
174 3300038443 Ga0395901_0162644 Ga0395901_0162644_1154_2188 342
175 3300039437 Ga0436365_0597037 Ga0436365_0597037_1189_2217 342
176 3300044842 Ga0466957_0218131 Ga0466957_0218131_118_1146 342
177 3300046459 Ga0495629_0049983 Ga0495629_0049983_1600_2628 342
178 3300046507 Ga0495606_0204822 Ga0495606_0204822_38_1066 342
179 3300046515 Ga0495620_0081734 Ga0495620_0081734_44_1072 342
180 3300046516 Ga0495628_0124225 Ga0495628_0124225_668_1696 342
181 3300046522 Ga0495643_0159631 Ga0495643_0159631_43_1071 342
182 3300046528 Ga0495642_0004055 Ga0495642_0004055_4278_5306 342
183 3300046538 Ga0495609_0017966 Ga0495609_0017966_1139_2167 342
184 3300046542 Ga0495597_0005154 Ga0495597_0005154_5600_6628 342
185 3300046543 Ga0495645_0126998 Ga0495645_0126998_46_1074 342
186 3300046557 Ga0495622_0000427 Ga0495622_0000427_4129_5157 342
187 3300046616 Ga0495668_0165512 Ga0495668_0165512_75_1103 342
188 3300046648 Ga0495611_0151014 Ga0495611_0151014_17_1045 342
189 3300046684 Ga0495669_0000147 Ga0495669_0000147_22876_23904 342
190 3300046684 Ga0495669_0064105 Ga0495669_0064105_21_1049 342
191 3300047318 Ga0495636_0022178 Ga0495636_0022178_984_2012 342
192 3300047472 Ga0495686_0003413 Ga0495686_0003413_2569_3597 342
193 3300048905 Ga0496102_0033652 Ga0496102_0033652_2469_3497 342
194 3300048905 Ga0496102_0228076 Ga0496102_0228076_519_1547 342
195 3300048911 Ga0496108_0147634 Ga0496108_0147634_32_1060 342
196 3300048912 Ga0496109_0248654 Ga0496109_0248654_548_1576 342
197 3300048915 Ga0496112_0140237 Ga0496112_0140237_411_1439 342
198 3300048918 Ga0496115_0001272 Ga0496115_0001272_11292_12320 342
199 3300048918 Ga0496115_0009874 Ga0496115_0009874_1822_2850 342
200 3300048919 Ga0496116_0143040 Ga0496116_0143040_162_1190 342
201 3300048920 Ga0496117_0042115 Ga0496117_0042115_1990_3018 342
202 3300048921 Ga0496118_0000977 Ga0496118_0000977_40782_41810 342
203 3300048922 Ga0496119_0022184 Ga0496119_0022184_806_1834 342
204 3300048924 Ga0496121_0000059 Ga0496121_0000059_165331_166359 342
205 3300049573 Ga0501037_0062987 Ga0501037_0062987_463_1491 342
206 3300049581 Ga0501047_0040984 Ga0501047_0040984_453_1484 342
207 3300049581 Ga0501047_0208628 Ga0501047_0208628_455_1483 342
208 3300049822 Ga0501035_0027230 Ga0501035_0027230_1991_3019 342
209 3300050491 nmdc:mga00v17_1117_c2 nmdc:mga00v17_1117_c2_620_1648 342
210 3300050493 nmdc:mga0k408_10486_c1 nmdc:mga0k408_10486_c1_3378_4406 342
211 3300050496 nmdc:mga07m45_72382_c1 nmdc:mga07m45_72382_c1_34_1062 342
212 3300050496 nmdc:mga07m45_91638_c1 nmdc:mga07m45_91638_c1_681_1709 342
213 3300053093 Ga0500651_0051896 Ga0500651_0051896_129_1157 342
214 3300053096 Ga0500641_0111894 Ga0500641_0111894_67_1095 342
215 3300053103 Ga0500555_019045 Ga0500555_019045_208_1236 342
216 3300053108 Ga0500562_000622 Ga0500562_000622_4472_5515 342
217 3300053119 Ga0500595_002552 Ga0500595_002552_710_1738 342
218 3300053122 Ga0500608_010425 Ga0500608_010425_2786_3814 342
219 3300053123 Ga0500614_002966 Ga0500614_002966_2351_3379 342
220 3300053136 Ga0500559_0013421 Ga0500559_0013421_2384_3412 342
221 3300053148 Ga0500590_002644 Ga0500590_002644_6928_7956 342
222 3300053177 Ga0500636_0029571 Ga0500636_0029571_124_1152 342
223 3300053178 Ga0500637_0014266 Ga0500637_0014266_1245_2273 342
224 3300053729 Ga0500625_032055 Ga0500625_032055_714_1742 342
225 3300053735 Ga0500596_004686 Ga0500596_004686_1271_2299 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

174

338

0.97

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

188

324

0.95

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

32

168

0.83

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

148

352

0.8

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

205

354

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8798 169 321
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8744 169 321
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.8645 167 321
3mbo-assembly3.cif.gz_E crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.8596 1 339
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.858 169 321
ID Description Score Start End Superfamily
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9713 168 319 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9675 159 320 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9637 159 323 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.95 173 320 3.40.50.2000
af_Q2G0L2_318_480_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9485 168 321 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7U1HUC2-F1-model_v4 deleted 0.9512 151 342
AF-A0A2V6SF54-F1-model_v4 Uncharacterized protein 0.9297 118 339 GO:0016757
AF-A0A0B8PIZ3-F1-model_v4 deleted 0.9295 171 338
AF-A0A3D4G0I6-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9249 116 341 GO:0016757
GO:0071793
AF-A0A0S7X6Y7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9249 157 338 GO:0016757

Feature Viewer

pLDDT pTM Quality
94.17 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map