F337868

General Info

Members Datasets Scaffolds Average Seq Length
225 128 450 187

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10383562|Ga0207669_103835622
Length 214
Sequence MRLGGPIRAAEPQPAALVPVPFAVSFVFALERFVTSHRRVIVHIGTSADGYIARPDGDLDWLTSRPAPKGFYGMNAFMRSIDTKVLGRRTYEASLRLGARFDDGSRTFVFSGHPRPSDAPAGVEFVNGDISGFVNHLRAQSGKDIWLMGGGGIIASFLDAQAIDEFVISVAPVFIGDGIPLIARRYRHVPLQLLSVERFDDGLVQSRYGIESRR

Samples

Sample ID Description Type Environment
1 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
98 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
99 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
120 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.56
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 27.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207669_10383562 3300025937 Unclassified 1096
2 CNAas_1000583 3300000532 Bacteria 3528
3 Ga0065704_10077373 3300005289 Unclassified 4750
4 Ga0065704_10080299 3300005289 Bacteria 3973
5 Ga0065707_10036017 3300005295 Bacteria 769
6 Ga0065707_10097527 3300005295 Bacteria 3167
7 Ga0065707_10184034 3300005295 Bacteria 1400
8 Ga0065707_10226355 3300005295 Bacteria 1205
9 Ga0070670_100191985 3300005331 Unclassified 1774
10 Ga0068869_100651350 3300005334 Unclassified 894
11 Ga0070680_100655057 3300005336 Bacteria 903
12 Ga0070660_101297604 3300005339 Unclassified 618
13 Ga0070689_100277498 3300005340 Unclassified 1389
14 Ga0070661_100115605 3300005344 Bacteria 2006
15 Ga0070668_100000971 3300005347 Bacteria 20074
16 Ga0070668_100351820 3300005347 Bacteria 1247
17 Ga0070669_100152969 3300005353 Unclassified 1787
18 Ga0070669_100385587 3300005353 Bacteria 1144
19 Ga0070675_100452329 3300005354 Bacteria 1152
20 Ga0070675_100797205 3300005354 Bacteria 863
21 Ga0070671_100916895 3300005355 Unclassified 766
22 Ga0070703_10000060 3300005406 Bacteria 54329
23 Ga0070703_10157865 3300005406 Bacteria 858
24 Ga0070713_100267039 3300005436 Unclassified 1566
25 Ga0070701_10112405 3300005438 Bacteria 1524
26 Ga0070694_100001704 3300005444 Bacteria 12942
27 Ga0070694_100274738 3300005444 Bacteria 1283
28 Ga0070708_100000441 3300005445 Bacteria 31032
29 Ga0070708_100030229 3300005445 Unclassified 4682
30 Ga0070708_100708226 3300005445 Unclassified 947
31 Ga0070662_100000644 3300005457 Bacteria 21098
32 Ga0070706_100006494 3300005467 Bacteria 11039
33 Ga0070706_100006605 3300005467 Bacteria 10941
34 Ga0070706_100027949 3300005467 Bacteria 5188
35 Ga0070706_100163940 3300005467 Bacteria 2075
36 Ga0070706_100262874 3300005467 Bacteria 1611
37 Ga0070706_100704211 3300005467 Unclassified 937
38 Ga0070707_100004033 3300005468 Bacteria 13811
39 Ga0070707_100088500 3300005468 Bacteria 2996
40 Ga0070707_100177995 3300005468 Unclassified 2073
41 Ga0070707_100178442 3300005468 Bacteria 2070
42 Ga0070707_100326485 3300005468 Bacteria 1491
43 Ga0070707_100680480 3300005468 Unclassified 991
44 Ga0070698_100000103 3300005471 Bacteria 69790
45 Ga0070698_100000736 3300005471 Bacteria 35195
46 Ga0070698_100028440 3300005471 Bacteria 5806
47 Ga0070698_100209687 3300005471 Unclassified 1883
48 Ga0070698_100270827 3300005471 Unclassified 1630
49 Ga0070698_100430849 3300005471 Bacteria 1253
50 Ga0070699_100001317 3300005518 Bacteria 22888
51 Ga0070699_100212741 3300005518 Bacteria 1721
52 Ga0070699_100260173 3300005518 Unclassified 1552
53 Ga0070699_100301307 3300005518 Bacteria 1438
54 Ga0070699_100340508 3300005518 Bacteria 1350
55 Ga0070697_100016169 3300005536 Bacteria 5867
56 Ga0070695_100015248 3300005545 Bacteria 4637
57 Ga0070695_100736965 3300005545 Unclassified 785
58 Ga0070696_100007589 3300005546 Bacteria 7251
59 Ga0070696_100374958 3300005546 Bacteria 1107
60 Ga0070665_100277954 3300005548 Bacteria 1676
61 Ga0070704_100021145 3300005549 Bacteria 4212
62 Ga0070704_100075669 3300005549 Bacteria 2460
63 Ga0070704_100238356 3300005549 Bacteria 1487
64 Ga0070704_100243775 3300005549 Bacteria 1472
65 Ga0070704_100299378 3300005549 Unclassified 1339
66 Ga0070704_100837705 3300005549 Unclassified 824
67 Ga0068857_100238053 3300005577 Unclassified 1666
68 Ga0068854_100145464 3300005578 Bacteria 1823
69 Ga0068859_100054691 3300005617 Bacteria 4015
70 Ga0068859_100963868 3300005617 Bacteria 936
71 Ga0068864_100462951 3300005618 Bacteria 1214
72 Ga0068864_100630485 3300005618 Unclassified 1042
73 Ga0068861_100935658 3300005719 Bacteria 823
74 Ga0068870_10010234 3300005840 Unclassified 4299
75 Ga0068870_10291555 3300005840 Bacteria 1027
76 Ga0068858_100454217 3300005842 Unclassified 1235
77 Ga0068860_100124496 3300005843 Bacteria 2471
78 Ga0068862_100059187 3300005844 Bacteria 3289
79 Ga0068862_100086695 3300005844 Bacteria 2722
80 Ga0070712_100072252 3300006175 Bacteria 2471
81 Ga0070712_100616109 3300006175 Bacteria 920
82 Ga0075428_100043164 3300006844 Bacteria 4957
83 Ga0075428_100235421 3300006844 Unclassified 1976
84 Ga0075430_100028020 3300006846 Bacteria 4785
85 Ga0075430_100182717 3300006846 Bacteria 1744
86 Ga0075430_100703662 3300006846 Unclassified 833
87 Ga0075431_100184722 3300006847 Unclassified 2138
88 Ga0075431_100518995 3300006847 Bacteria 1181
89 Ga0075433_10010933 3300006852 Bacteria 7302
90 Ga0075433_10447370 3300006852 Bacteria 1139
91 Ga0075433_10481566 3300006852 Bacteria 1093
92 Ga0075433_11215540 3300006852 Bacteria 654
93 Ga0075434_100000684 3300006871 Bacteria 26399
94 Ga0075434_100032642 3300006871 Bacteria 5135
95 Ga0075434_101053538 3300006871 Bacteria 827
96 Ga0075429_100009207 3300006880 Bacteria 8574
97 Ga0075429_100087075 3300006880 Unclassified 2722
98 Ga0075429_100184263 3300006880 Unclassified 1829
99 Ga0075436_100071634 3300006914 Bacteria 2397
100 Ga0075436_100091679 3300006914 Bacteria 2113
101 Ga0097620_100054692 3300006931 Bacteria 4015
102 Ga0097620_100963966 3300006931 Bacteria 936
103 Ga0075435_100001296 3300007076 Bacteria 16074
104 Ga0075435_100546389 3300007076 Unclassified 1003
105 Ga0105240_10778785 3300009093 Unclassified 1038
106 Ga0114129_10026255 3300009147 Bacteria 8249
107 Ga0114129_10385655 3300009147 Bacteria 1849
108 Ga0114129_10397384 3300009147 Unclassified 1817
109 Ga0114129_10603908 3300009147 Bacteria 1421
110 Ga0114129_11042057 3300009147 Bacteria 1028
111 Ga0105243_10001869 3300009148 Bacteria 17972
112 Ga0105243_10798859 3300009148 Unclassified 930
113 Ga0105241_10232085 3300009174 Unclassified 1556
114 Ga0105242_10000404 3300009176 Bacteria 34316
115 Ga0105242_10117473 3300009176 Unclassified 2277
116 Ga0105248_10354364 3300009177 Unclassified 1652
117 Ga0105248_10617703 3300009177 Bacteria 1223
118 Ga0105249_10000156 3300009553 Bacteria 83676
119 Ga0105249_10034019 3300009553 Bacteria 4616
120 Ga0105249_10150313 3300009553 Bacteria 2242
121 Ga0105239_10618432 3300010375 Bacteria 1236
122 Ga0105246_10282065 3300011119 Unclassified 1333
123 Ga0157374_10089890 3300013296 Bacteria 2927
124 Ga0157378_10141673 3300013297 Bacteria 2233
125 Ga0163162_10000009 3300013306 Bacteria 316099
126 Ga0163162_10355222 3300013306 Bacteria 1598
127 Ga0163162_10514663 3300013306 Bacteria 1327
128 Ga0163162_11727022 3300013306 Bacteria 715
129 Ga0157375_10088020 3300013308 Bacteria 3159
130 Ga0157375_10195258 3300013308 Unclassified 2179
131 Ga0157375_10259310 3300013308 Bacteria 1900
132 Ga0163163_10038715 3300014325 Bacteria 4648
133 Ga0163163_10067729 3300014325 Bacteria 3550
134 Ga0163163_10545287 3300014325 Bacteria 1222
135 Ga0157380_10002187 3300014326 Bacteria 13136
136 Ga0157380_10022427 3300014326 Unclassified 4753
137 Ga0157380_10083055 3300014326 Bacteria 2623
138 Ga0163161_10007313 3300017792 Bacteria 7619
139 Ga0207647_10144011 3300025904 Unclassified 1396
140 Ga0207684_10013917 3300025910 Bacteria 6950
141 Ga0207684_10046335 3300025910 Bacteria 3689
142 Ga0207684_10994203 3300025910 Unclassified 702
143 Ga0207693_10520233 3300025915 Bacteria 928
144 Ga0207660_10453277 3300025917 Bacteria 1037
145 Ga0207662_10641701 3300025918 Unclassified 741
146 Ga0207646_10003517 3300025922 Bacteria 17649
147 Ga0207646_10033050 3300025922 Bacteria 4680
148 Ga0207646_10065431 3300025922 Bacteria 3246
149 Ga0207646_10113160 3300025922 Bacteria 2436
150 Ga0207646_10723222 3300025922 Unclassified 889
151 Ga0207646_10943060 3300025922 Bacteria 764
152 Ga0207681_10290882 3300025923 Bacteria 1289
153 Ga0207650_10510855 3300025925 Bacteria 1005
154 Ga0207659_10702383 3300025926 Bacteria 866
155 Ga0207706_10078359 3300025933 Bacteria 2906
156 Ga0207686_10000009 3300025934 Bacteria 241706
157 Ga0207709_10000048 3300025935 Bacteria 238474
158 Ga0207711_10371055 3300025941 Bacteria 1327
159 Ga0207711_10379310 3300025941 Unclassified 1312
160 Ga0207689_10023336 3300025942 Bacteria 5193
161 Ga0207712_10000123 3300025961 Bacteria 83597
162 Ga0207712_10357554 3300025961 Bacteria 1216
163 Ga0207668_10005929 3300025972 Bacteria 7199
164 Ga0207708_10081885 3300026075 Bacteria 2481
165 Ga0207641_10394505 3300026088 Bacteria 1328
166 Ga0207641_10508531 3300026088 Bacteria 1171
167 Ga0207676_10244262 3300026095 Unclassified 1612
168 Ga0207674_10132005 3300026116 Bacteria 2460
169 Ga0207675_100027117 3300026118 Bacteria 5334
170 Ga0268266_10232117 3300028379 Bacteria 1700
171 Ga0268265_10036768 3300028380 Bacteria 3589
172 Ga0307408_100001142 3300031548 Bacteria 20201
173 Ga0307410_10200059 3300031852 Unclassified 1525
174 Ga0307409_101650321 3300031995 Bacteria 669
175 Ga0307416_100061562 3300032002 Bacteria 3064
176 Ga0307416_100441947 3300032002 Unclassified 1351
177 Ga0307414_10715175 3300032004 Bacteria 908
178 Ga0373943_0094065 3300035170 Unclassified 1557
179 Ga0373947_0098069 3300035725 Bacteria 1838
180 Ga0373925_0245905 3300037068 Unclassified 1434
181 Ga0436365_0119232 3300039437 Bacteria 7631
182 Ga0439433_0048753 3300041999 Bacteria 996
183 Ga0439450_099206 3300042008 Bacteria 738
184 Ga0439462_0028209 3300042015 Bacteria 1484
185 Ga0439434_0045795 3300042435 Bacteria 1350
186 Ga0451577_0220562 3300042876 Unclassified 1714
187 Ga0451577_0252867 3300042876 Bacteria 1595
188 Ga0453683_0001765 3300044673 Bacteria 17936
189 Ga0453684_1240401 3300044712 Unclassified 781
190 Ga0451576_1728894 3300045051 Bacteria 647
191 Ga0495580_0075423 3300046472 Bacteria 2353
192 Ga0495586_0216021 3300046535 Unclassified 1089
193 Ga0495625_0551679 3300046660 Bacteria 698
194 Ga0495658_0157450 3300046683 Unclassified 1399
195 Ga0495669_0042395 3300046684 Bacteria 2023
196 Ga0496100_0238896 3300048903 Unclassified 1340
197 Ga0496101_0208086 3300048904 Unclassified 1515
198 Ga0496106_0409984 3300048909 Bacteria 1089
199 Ga0496108_0332040 3300048911 Unclassified 1326
200 Ga0496109_1066010 3300048912 Bacteria 745
201 Ga0496110_0245949 3300048913 Bacteria 1628
202 Ga0496113_0049663 3300048916 Bacteria 3125
203 Ga0496115_0149039 3300048918 Bacteria 1931
204 Ga0496119_0193883 3300048922 Unclassified 1057
205 Ga0501250_013877 3300049680 Bacteria 972
206 Ga0501261_009330 3300049690 Unclassified 1279
207 nmdc:mga05p37_64364_c1 3300050507 Bacteria 4512
208 nmdc:mga09592_15472_c1 3300050508 Bacteria 6235
209 nmdc:mga09592_17038_c1 3300050508 Bacteria 5947
210 nmdc:mga09592_264922_c1 3300050508 Bacteria 1490
211 nmdc:mga0qj67_10486_c1 3300050509 Bacteria 6921
212 nmdc:mga0qj67_121725_c1 3300050509 Bacteria 2111
213 nmdc:mga06r32_34911_c1 3300050510 Bacteria 4744
214 nmdc:mga06r32_532264_c1 3300050510 Unclassified 1150
215 nmdc:mga06r32_73065_c1 3300050510 Bacteria 3321
216 nmdc:mga0n895_1418_c1 3300050512 Bacteria 17912
217 nmdc:mga0n895_1580_c1 3300050512 Bacteria 17139
218 nmdc:mga0n895_24441_c1 3300050512 Bacteria 5694
219 nmdc:mga0n895_57617_c1 3300050512 Bacteria 3830
220 nmdc:mga0rr50_20542_c1 3300050513 Unclassified 4490
221 nmdc:mga0rr50_504043_c1 3300050513 Unclassified 1029
222 nmdc:mga08x19_1566_c1 3300050514 Bacteria 14190
223 nmdc:mga08x19_179446_c1 3300050514 Unclassified 1445
224 nmdc:mga0a205_1607_c1 3300050515 Bacteria 19427
225 nmdc:mga0a205_280695_c1 3300050515 Bacteria 1541
226 Ga0207669_10383562
227 CNAas_1000583
228 Ga0065704_10077373
229 Ga0065704_10080299
230 Ga0065707_10036017
231 Ga0065707_10097527
232 Ga0065707_10184034
233 Ga0065707_10226355
234 Ga0070670_100191985
235 Ga0068869_100651350
236 Ga0070680_100655057
237 Ga0070660_101297604
238 Ga0070689_100277498
239 Ga0070661_100115605
240 Ga0070668_100000971
241 Ga0070668_100351820
242 Ga0070669_100152969
243 Ga0070669_100385587
244 Ga0070675_100452329
245 Ga0070675_100797205
246 Ga0070671_100916895
247 Ga0070703_10000060
248 Ga0070703_10157865
249 Ga0070713_100267039
250 Ga0070701_10112405
251 Ga0070694_100001704
252 Ga0070694_100274738
253 Ga0070708_100000441
254 Ga0070708_100030229
255 Ga0070708_100708226
256 Ga0070662_100000644
257 Ga0070706_100006494
258 Ga0070706_100006605
259 Ga0070706_100027949
260 Ga0070706_100163940
261 Ga0070706_100262874
262 Ga0070706_100704211
263 Ga0070707_100004033
264 Ga0070707_100088500
265 Ga0070707_100177995
266 Ga0070707_100178442
267 Ga0070707_100326485
268 Ga0070707_100680480
269 Ga0070698_100000103
270 Ga0070698_100000736
271 Ga0070698_100028440
272 Ga0070698_100209687
273 Ga0070698_100270827
274 Ga0070698_100430849
275 Ga0070699_100001317
276 Ga0070699_100212741
277 Ga0070699_100260173
278 Ga0070699_100301307
279 Ga0070699_100340508
280 Ga0070697_100016169
281 Ga0070695_100015248
282 Ga0070695_100736965
283 Ga0070696_100007589
284 Ga0070696_100374958
285 Ga0070665_100277954
286 Ga0070704_100021145
287 Ga0070704_100075669
288 Ga0070704_100238356
289 Ga0070704_100243775
290 Ga0070704_100299378
291 Ga0070704_100837705
292 Ga0068857_100238053
293 Ga0068854_100145464
294 Ga0068859_100054691
295 Ga0068859_100963868
296 Ga0068864_100462951
297 Ga0068864_100630485
298 Ga0068861_100935658
299 Ga0068870_10010234
300 Ga0068870_10291555
301 Ga0068858_100454217
302 Ga0068860_100124496
303 Ga0068862_100059187
304 Ga0068862_100086695
305 Ga0070712_100072252
306 Ga0070712_100616109
307 Ga0075428_100043164
308 Ga0075428_100235421
309 Ga0075430_100028020
310 Ga0075430_100182717
311 Ga0075430_100703662
312 Ga0075431_100184722
313 Ga0075431_100518995
314 Ga0075433_10010933
315 Ga0075433_10447370
316 Ga0075433_10481566
317 Ga0075433_11215540
318 Ga0075434_100000684
319 Ga0075434_100032642
320 Ga0075434_101053538
321 Ga0075429_100009207
322 Ga0075429_100087075
323 Ga0075429_100184263
324 Ga0075436_100071634
325 Ga0075436_100091679
326 Ga0097620_100054692
327 Ga0097620_100963966
328 Ga0075435_100001296
329 Ga0075435_100546389
330 Ga0105240_10778785
331 Ga0114129_10026255
332 Ga0114129_10385655
333 Ga0114129_10397384
334 Ga0114129_10603908
335 Ga0114129_11042057
336 Ga0105243_10001869
337 Ga0105243_10798859
338 Ga0105241_10232085
339 Ga0105242_10000404
340 Ga0105242_10117473
341 Ga0105248_10354364
342 Ga0105248_10617703
343 Ga0105249_10000156
344 Ga0105249_10034019
345 Ga0105249_10150313
346 Ga0105239_10618432
347 Ga0105246_10282065
348 Ga0157374_10089890
349 Ga0157378_10141673
350 Ga0163162_10000009
351 Ga0163162_10355222
352 Ga0163162_10514663
353 Ga0163162_11727022
354 Ga0157375_10088020
355 Ga0157375_10195258
356 Ga0157375_10259310
357 Ga0163163_10038715
358 Ga0163163_10067729
359 Ga0163163_10545287
360 Ga0157380_10002187
361 Ga0157380_10022427
362 Ga0157380_10083055
363 Ga0163161_10007313
364 Ga0207647_10144011
365 Ga0207684_10013917
366 Ga0207684_10046335
367 Ga0207684_10994203
368 Ga0207693_10520233
369 Ga0207660_10453277
370 Ga0207662_10641701
371 Ga0207646_10003517
372 Ga0207646_10033050
373 Ga0207646_10065431
374 Ga0207646_10113160
375 Ga0207646_10723222
376 Ga0207646_10943060
377 Ga0207681_10290882
378 Ga0207650_10510855
379 Ga0207659_10702383
380 Ga0207706_10078359
381 Ga0207686_10000009
382 Ga0207709_10000048
383 Ga0207711_10371055
384 Ga0207711_10379310
385 Ga0207689_10023336
386 Ga0207712_10000123
387 Ga0207712_10357554
388 Ga0207668_10005929
389 Ga0207708_10081885
390 Ga0207641_10394505
391 Ga0207641_10508531
392 Ga0207676_10244262
393 Ga0207674_10132005
394 Ga0207675_100027117
395 Ga0268266_10232117
396 Ga0268265_10036768
397 Ga0307408_100001142
398 Ga0307410_10200059
399 Ga0307409_101650321
400 Ga0307416_100061562
401 Ga0307416_100441947
402 Ga0307414_10715175
403 Ga0373943_0094065
404 Ga0373947_0098069
405 Ga0373925_0245905
406 Ga0436365_0119232
407 Ga0439433_0048753
408 Ga0439450_099206
409 Ga0439462_0028209
410 Ga0439434_0045795
411 Ga0451577_0220562
412 Ga0451577_0252867
413 Ga0453683_0001765
414 Ga0453684_1240401
415 Ga0451576_1728894
416 Ga0495580_0075423
417 Ga0495586_0216021
418 Ga0495625_0551679
419 Ga0495658_0157450
420 Ga0495669_0042395
421 Ga0496100_0238896
422 Ga0496101_0208086
423 Ga0496106_0409984
424 Ga0496108_0332040
425 Ga0496109_1066010
426 Ga0496110_0245949
427 Ga0496113_0049663
428 Ga0496115_0149039
429 Ga0496119_0193883
430 Ga0501250_013877
431 Ga0501261_009330
432 nmdc:mga05p37_64364_c1
433 nmdc:mga09592_15472_c1
434 nmdc:mga09592_17038_c1
435 nmdc:mga09592_264922_c1
436 nmdc:mga0qj67_10486_c1
437 nmdc:mga0qj67_121725_c1
438 nmdc:mga06r32_34911_c1
439 nmdc:mga06r32_532264_c1
440 nmdc:mga06r32_73065_c1
441 nmdc:mga0n895_1418_c1
442 nmdc:mga0n895_1580_c1
443 nmdc:mga0n895_24441_c1
444 nmdc:mga0n895_57617_c1
445 nmdc:mga0rr50_20542_c1
446 nmdc:mga0rr50_504043_c1
447 nmdc:mga08x19_1566_c1
448 nmdc:mga08x19_179446_c1
449 nmdc:mga0a205_1607_c1
450 nmdc:mga0a205_280695_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

38

205

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kp7-assembly1.cif.gz_A quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with b12154 0.8061 47 135
6a2m-assembly1.cif.gz_A crystal structure of wild type plasmodium falciparum dhfr-ts complexed with bt2, nadph, and dump 0.8044 47 135
7ctz-assembly1.cif.gz_A wild-type plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with fragment 148, nadph, and dump 0.8013 47 135
7f3z-assembly1.cif.gz_B double mutant plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts-k1, c59r+s108n) complexed with trimethoprim (top), nadph and dump 0.7961 47 135
6kpr-assembly1.cif.gz_B quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with b12155 inhibitor 0.796 47 135
ID Description Score Start End Superfamily
af_Q54IP6_330_397_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7075 156 182 3.30.300.20
1ludA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6082 4 135 3.40.430.10
af_Q06417_60_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6049 44 118 3.40.50.720
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6029 2 176 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6027 1 176 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6I4VRN8-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.8375 39 132 GO:0008703
GO:0009231
AF-A0A537IYY0-F1-model_v4 Dihydrofolate reductase 0.782 1 135 GO:0008703
GO:0009231
AF-A0A7C0UKX8-F1-model_v4 Dihydrofolate reductase 0.7736 4 135 GO:0008703
GO:0009231
AF-A0A818LD37-F1-model_v4 Dihydrofolate reductase 0.7697 3 139 GO:0008703
GO:0009231
AF-A0A7G7GCT7-F1-model_v4 Dihydrofolate reductase 0.7666 1 127

Map