F337590

General Info

Members Datasets Scaffolds Average Seq Length
225 167 224 108

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_101256502|Ga0068856_1012565022
Length 106
Sequence MPRKQKYKSEAHEAIHSAVEGMYRAGTIDKATMRGFDASCLTPPAIKPRQIKALRERHKVSQPVFARYLNTSESTVEKWETGAKKPSGMALKLLSVVQKHGLKMLA

Samples

Sample ID Description Type Environment
1 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
89 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
150 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
153 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
154 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
155 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
161 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
162 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
163 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
164 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
165 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
167 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.89
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.22
Nodule 0.44
Rhizoplane 4.44
Rhizosphere 59.11
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10031111 3300001989 Bacteria 1846
2 JGI25165J46597_1031500 3300003214 Bacteria 684
3 rootH2_10313087 3300003320 Bacteria 1342
4 rootL2_10156514 3300003322 Bacteria 1996
5 rootL2_10198319 3300003322 Bacteria 2140
6 rootH1_10113845 3300003323 Bacteria 2706
7 rootH1_10241137 3300003323 Bacteria 1551
8 rootH1_10371895 3300003323 Bacteria 1813
9 Ga0055526_1003703 3300003771 Bacteria 9550
10 Ga0055524_1002287 3300003775 Bacteria 9996
11 Ga0055528_1000185 3300003790 Bacteria 52750
12 Ga0070667_100007917 3300005367 Bacteria 8814
13 Ga0070662_100626597 3300005457 Bacteria 906
14 Ga0070679_100344144 3300005530 Bacteria 1439
15 Ga0068853_100061303 3300005539 Bacteria 3253
16 Ga0070665_100005535 3300005548 Bacteria 12990
17 Ga0068857_100730630 3300005577 Bacteria 942
18 Ga0068854_101841615 3300005578 Bacteria 555
19 Ga0068856_101256502 3300005614 Bacteria 756
20 Ga0068852_100571119 3300005616 Bacteria 1133
21 Ga0068859_101138533 3300005617 Bacteria 859
22 Ga0068851_10026860 3300005834 Bacteria 2832
23 Ga0068858_100013326 3300005842 Bacteria 7755
24 Ga0068860_100000187 3300005843 Bacteria 98756
25 Ga0068862_100043443 3300005844 Bacteria 3832
26 Ga0075368_10241512 3300006042 Bacteria 770
27 Ga0075363_100123779 3300006048 Bacteria 1446
28 Ga0075363_100373320 3300006048 Bacteria 835
29 Ga0075367_10308806 3300006178 Bacteria 996
30 Ga0075369_10229496 3300006186 Bacteria 860
31 Ga0075366_10008492 3300006195 Bacteria 5713
32 Ga0075366_10771135 3300006195 Bacteria 598
33 Ga0097621_100186881 3300006237 Bacteria 1793
34 Ga0075370_10261267 3300006353 Bacteria 1027
35 Ga0075370_10499860 3300006353 Bacteria 734
36 Ga0097620_101138675 3300006931 Bacteria 859
37 Ga0105248_11192500 3300009177 Bacteria 861
38 Ga0105249_10038620 3300009553 Bacteria 4332
39 Ga0157370_10000224 3300013104 Bacteria 71976
40 Ga0182008_10002859 3300014497 Bacteria 10697
41 Ga0157379_10998272 3300014968 Bacteria 798
42 Ga0157379_11418363 3300014968 Bacteria 674
43 Ga0182006_1000098 3300015261 Bacteria 101707
44 Ga0182007_10035280 3300015262 Bacteria 1686
45 Ga0182005_1005549 3300015265 Bacteria 3934
46 Ga0163161_10985516 3300017792 Bacteria 719
47 Ga0213873_10126688 3300021358 Bacteria 753
48 Ga0213872_10023421 3300021361 Bacteria 2841
49 Ga0213872_10047527 3300021361 Bacteria 1951
50 Ga0213872_10191763 3300021361 Bacteria 879
51 Ga0213872_10464634 3300021361 Bacteria 507
52 Ga0224712_10236921 3300022467 Bacteria 839
53 Ga0209233_1008005 3300025261 Bacteria 3304
54 Ga0209673_1000595 3300025273 Bacteria 56286
55 Ga0209676_1012054 3300025292 Bacteria 3432
56 Ga0209564_1001616 3300025295 Bacteria 21865
57 Ga0209050_1001381 3300025298 Bacteria 26455
58 Ga0209256_1000567 3300025299 Bacteria 52801
59 Ga0209051_1031521 3300025303 Bacteria 2038
60 Ga0209051_1132580 3300025303 Bacteria 613
61 Ga0209257_1078876 3300025304 Bacteria 850
62 Ga0207656_10009254 3300025321 Bacteria 3655
63 Ga0207647_10012205 3300025904 Bacteria 5989
64 Ga0207647_10755301 3300025904 Bacteria 526
65 Ga0207707_10100629 3300025912 Bacteria 2526
66 Ga0207681_10518080 3300025923 Bacteria 978
67 Ga0207694_10080158 3300025924 Bacteria 2562
68 Ga0207694_10567968 3300025924 Bacteria 953
69 Ga0207706_10033817 3300025933 Bacteria 4550
70 Ga0207711_10973595 3300025941 Bacteria 787
71 Ga0207712_10030651 3300025961 Bacteria 3617
72 Ga0207640_10745410 3300025981 Bacteria 844
73 Ga0207658_10002525 3300025986 Bacteria 13320
74 Ga0207703_10166606 3300026035 Bacteria 1934
75 Ga0207639_10033110 3300026041 Bacteria 3810
76 Ga0207702_10713278 3300026078 Bacteria 989
77 Ga0207702_11323969 3300026078 Bacteria 714
78 Ga0207674_10029975 3300026116 Bacteria 5723
79 Ga0207698_10542309 3300026142 Bacteria 1139
80 Ga0209813_10327921 3300027866 Bacteria 601
81 Ga0268266_10005063 3300028379 Bacteria 12434
82 Ga0268266_11894679 3300028379 Bacteria 570
83 Ga0268265_10031509 3300028380 Bacteria 3829
84 Ga0268264_10000040 3300028381 Bacteria 373714
85 Ga0307515_10005525 3300028794 Bacteria 25589
86 Ga0265762_1055452 3300030760 Bacteria 804
87 Ga0265328_10000188 3300031239 Bacteria 28670
88 Ga0265328_10000282 3300031239 Bacteria 23767
89 Ga0265328_10099705 3300031239 Unclassified 1075
90 Ga0265328_10455760 3300031239 Bacteria 506
91 Ga0265331_10002470 3300031250 Bacteria 12493
92 Ga0265331_10014779 3300031250 Bacteria 4143
93 Ga0265327_10010966 3300031251 Bacteria 6304
94 Ga0265327_10306088 3300031251 Unclassified 699
95 Ga0265316_10306054 3300031344 Bacteria 1157
96 Ga0307513_10388941 3300031456 Bacteria 1132
97 Ga0265314_10048539 3300031711 Bacteria 2978
98 Ga0265314_10382691 3300031711 Bacteria 765
99 Ga0265342_10023267 3300031712 Bacteria 3925
100 Ga0307412_10002443 3300031911 Bacteria 10338
101 Ga0307412_10003587 3300031911 Bacteria 8620
102 Ga0307412_10187019 3300031911 Bacteria 1563
103 Ga0307412_10663133 3300031911 Bacteria 891
104 Ga0307416_102811757 3300032002 Bacteria 582
105 Ga0307414_12215741 3300032004 Bacteria 513
106 Ga0307510_10002694 3300033180 Bacteria 20310
107 Ga0307510_10108242 3300033180 Bacteria 2534
108 Ga0395905_0002336 3300037471 Bacteria 21167
109 Ga0395905_0145515 3300037471 Bacteria 2230
110 Ga0436360_0480540 3300039438 Bacteria 591
111 Ga0436361_0220824 3300039447 Bacteria 3176
112 Ga0436361_0417596 3300039447 Bacteria 4315
113 Ga0436361_0907976 3300039447 Unclassified 579
114 Ga0436361_1169114 3300039447 Bacteria 5101
115 Ga0436362_1036965 3300039453 Bacteria 881
116 Ga0439436_0000003 3300041404 Bacteria 186684
117 Ga0451797_0013506 3300041453 Bacteria 956
118 Ga0451833_0173620 3300041491 Bacteria 639
119 Ga0451833_0595190 3300041491 Bacteria 1154
120 Ga0451843_0877456 3300041509 Bacteria 864
121 Ga0450923_151967 3300042125 Bacteria 561
122 Ga0439446_0230323 3300042156 Unclassified 634
123 Ga0439458_0037627 3300042157 Bacteria 1167
124 Ga0466968_0002442 3300044735 Bacteria 6815
125 Ga0466970_0196642 3300044765 Bacteria 1121
126 Ga0466960_0270248 3300044901 Bacteria 950
127 Ga0495617_000856 3300046452 Bacteria 14452
128 Ga0495627_098667 3300046453 Bacteria 835
129 Ga0495638_0029194 3300046460 Bacteria 3556
130 Ga0495580_0190242 3300046472 Bacteria 1415
131 Ga0495584_0026980 3300046491 Bacteria 2910
132 Ga0495585_0004268 3300046492 Bacteria 9309
133 Ga0495585_0048068 3300046492 Bacteria 2373
134 Ga0495585_0344140 3300046492 Bacteria 725
135 Ga0495585_0436186 3300046492 Bacteria 628
136 Ga0495606_0024437 3300046507 Bacteria 4354
137 Ga0495610_0014784 3300046512 Bacteria 4568
138 Ga0495648_0075283 3300046524 Bacteria 1942
139 Ga0495642_0167363 3300046528 Bacteria 954
140 Ga0495665_0012542 3300046531 Bacteria 4588
141 Ga0495609_0014006 3300046538 Bacteria 3777
142 Ga0495633_0010478 3300046558 Bacteria 5054
143 Ga0495656_0409708 3300046615 Bacteria 710
144 Ga0495625_0001011 3300046660 Bacteria 37097
145 Ga0495625_0001441 3300046660 Bacteria 28927
146 Ga0495625_0310428 3300046660 Bacteria 1007
147 Ga0495669_0257497 3300046684 Bacteria 838
148 Ga0495624_0396492 3300046690 Bacteria 829
149 Ga0495670_0001095 3300046691 Bacteria 13137
150 Ga0495649_0012276 3300046694 Bacteria 4992
151 Ga0495672_0092492 3300047320 Bacteria 1658
152 Ga0495681_0117132 3300047470 Bacteria 1147
153 Ga0495686_0159705 3300047472 Bacteria 1318
154 Ga0496100_0778130 3300048903 Unclassified 749
155 Ga0496101_0438841 3300048904 Bacteria 1030
156 Ga0496104_0076727 3300048907 Bacteria 3183
157 Ga0496104_0137392 3300048907 Bacteria 2348
158 Ga0496105_0004754 3300048908 Bacteria 10251
159 Ga0496105_0918048 3300048908 Bacteria 659
160 Ga0496105_1010883 3300048908 Bacteria 621
161 Ga0496110_0345140 3300048913 Bacteria 1356
162 Ga0496111_0092568 3300048914 Bacteria 2216
163 Ga0496118_0036827 3300048921 Bacteria 3949
164 Ga0496118_0270366 3300048921 Bacteria 953
165 Ga0496118_0323912 3300048921 Bacteria 835
166 Ga0496119_0022855 3300048922 Bacteria 4457
167 Ga0496120_0042081 3300048923 Bacteria 2670
168 Ga0496120_0065490 3300048923 Bacteria 2013
169 Ga0496121_0001151 3300048924 Bacteria 46359
170 Ga0496121_0169471 3300048924 Bacteria 1588
171 Ga0496121_0659930 3300048924 Bacteria 636
172 Ga0495682_0000332 3300049460 Bacteria 35082
173 Ga0501033_0006258 3300049570 Bacteria 9329
174 Ga0501034_0095617 3300049571 Bacteria 2967
175 Ga0501036_0004691 3300049572 Bacteria 11037
176 Ga0501037_0073009 3300049573 Bacteria 2495
177 Ga0501038_0008581 3300049574 Bacteria 9378
178 Ga0501039_0474466 3300049575 Bacteria 982
179 Ga0501043_0110694 3300049579 Bacteria 2156
180 Ga0501046_0053036 3300049580 Bacteria 3195
181 Ga0501046_1156095 3300049580 Bacteria 533
182 Ga0501047_0020297 3300049581 Bacteria 6381
183 Ga0501047_0048807 3300049581 Bacteria 4087
184 Ga0501047_1351220 3300049581 Bacteria 527
185 Ga0501070_0167119 3300049586 Bacteria 1813
186 Ga0501035_0018000 3300049822 Bacteria 6513
187 Ga0501035_0712616 3300049822 Bacteria 808
188 Ga0501044_0000718 3300049823 Bacteria 39965
189 nmdc:mga03n38_115227_c1 3300050490 Bacteria 1314
190 nmdc:mga03n38_732484_c1 3300050490 Bacteria 572
191 nmdc:mga0k408_11171_c1 3300050493 Bacteria 4882
192 nmdc:mga06z11_336875_c1 3300050494 Bacteria 901
193 nmdc:mga06z11_87972_c1 3300050494 Bacteria 1681
194 nmdc:mga04h51_365489_c1 3300050495 Bacteria 599
195 nmdc:mga07m45_19768_c2 3300050496 Bacteria 3287
196 nmdc:mga07m45_234212_c1 3300050496 Bacteria 1068
197 nmdc:mga0sz30_176576_c1 3300050516 Bacteria 947
198 nmdc:mga0sz30_232445_c1 3300050516 Bacteria 820
199 Ga0500578_0000025 3300053086 Bacteria 151485
200 Ga0500578_0193452 3300053086 Bacteria 1248
201 Ga0500643_000749 3300053087 Bacteria 21225
202 Ga0500643_005049 3300053087 Bacteria 5773
203 Ga0500643_052431 3300053087 Bacteria 1163
204 Ga0500646_0250671 3300053090 Bacteria 623
205 Ga0500566_0198293 3300053094 Bacteria 1016
206 Ga0500555_079745 3300053103 Bacteria 853
207 Ga0500562_016708 3300053108 Bacteria 1888
208 Ga0500572_127944 3300053111 Unclassified 824
209 Ga0500594_0001502 3300053118 Bacteria 5077
210 Ga0500595_008693 3300053119 Bacteria 4138
211 Ga0500607_002075 3300053121 Bacteria 16769
212 Ga0500618_000081 3300053125 Bacteria 77777
213 Ga0500618_016980 3300053125 Bacteria 1815
214 Ga0500655_006200 3300053133 Bacteria 2154
215 Ga0500559_0001517 3300053136 Bacteria 13017
216 Ga0500559_0197207 3300053136 Bacteria 949
217 Ga0500577_0003809 3300053142 Bacteria 3940
218 Ga0500604_0007009 3300053151 Bacteria 2984
219 Ga0500627_0020770 3300053158 Bacteria 2638
220 Ga0500627_0082329 3300053158 Bacteria 1436
221 Ga0500639_120556 3300053163 Unclassified 1259
222 Ga0500639_343980 3300053163 Bacteria 532
223 Ga0500636_0001765 3300053177 Bacteria 11844
224 Ga0500552_006340 3300053733 Unclassified 1324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2906354277 2906354963 103
2 3300005367 Ga0070667_100007917 Ga0070667_1000079174 106
3 3300005548 Ga0070665_100005535 Ga0070665_1000055358 106
4 3300005614 Ga0068856_101256502 Ga0068856_1012565022 106
5 3300005617 Ga0068859_101138533 Ga0068859_1011385331 106
6 3300005842 Ga0068858_100013326 Ga0068858_1000133263 106
7 3300005843 Ga0068860_100000187 Ga0068860_10000018752 106
8 3300005844 Ga0068862_100043443 Ga0068862_1000434432 106
9 3300006931 Ga0097620_101138675 Ga0097620_1011386751 106
10 3300009177 Ga0105248_11192500 Ga0105248_111925002 106
11 3300014968 Ga0157379_11418363 Ga0157379_114183631 106
12 3300025923 Ga0207681_10518080 Ga0207681_105180801 106
13 3300025986 Ga0207658_10002525 Ga0207658_100025255 106
14 3300026035 Ga0207703_10166606 Ga0207703_101666062 106
15 3300026078 Ga0207702_11323969 Ga0207702_113239692 106
16 3300028379 Ga0268266_10005063 Ga0268266_100050636 106
17 3300028380 Ga0268265_10031509 Ga0268265_100315093 106
18 3300028381 Ga0268264_10000040 Ga0268264_10000040320 106
19 3300033180 Ga0307510_10002694 Ga0307510_1000269410 106
20 3300037471 Ga0395905_0002336 Ga0395905_0002336_14746_15066 106
21 3300037471 Ga0395905_0145515 Ga0395905_0145515_1840_2160 106
22 3300046472 Ga0495580_0190242 Ga0495580_0190242_707_1027 106
23 3300046524 Ga0495648_0075283 Ga0495648_0075283_930_1250 106
24 3300046531 Ga0495665_0012542 Ga0495665_0012542_1787_2107 106
25 3300046690 Ga0495624_0396492 Ga0495624_0396492_44_364 106
26 3300048907 Ga0496104_0076727 Ga0496104_0076727_2023_2343 106
27 3300048908 Ga0496105_0004754 Ga0496105_0004754_3611_3931 106
28 3300048913 Ga0496110_0345140 Ga0496110_0345140_929_1249 106
29 3300048914 Ga0496111_0092568 Ga0496111_0092568_489_809 106
30 3300048921 Ga0496118_0323912 Ga0496118_0323912_382_702 106
31 3300048923 Ga0496120_0042081 Ga0496120_0042081_1196_1516 106
32 3300053090 Ga0500646_0250671 Ga0500646_0250671_112_432 106
33 3300053103 Ga0500555_079745 Ga0500555_079745_468_788 106
34 3300053133 Ga0500655_006200 Ga0500655_006200_1403_1723 106
35 3300053136 Ga0500559_0001517 Ga0500559_0001517_1787_2107 106
36 3300053136 Ga0500559_0197207 Ga0500559_0197207_225_545 106
37 3300053142 Ga0500577_0003809 Ga0500577_0003809_2425_2745 106
38 3300053163 Ga0500639_343980 Ga0500639_343980_24_344 106
39 3300053177 Ga0500636_0001765 Ga0500636_0001765_5000_5320 106
40 3300001989 JGI24739J22299_10031111 JGI24739J22299_100311112 107
41 3300003214 JGI25165J46597_1031500 JGI25165J46597_10315002 107
42 3300003320 rootH2_10313087 rootH2_103130872 107
43 3300003322 rootL2_10156514 rootL2_101565143 107
44 3300003322 rootL2_10198319 rootL2_101983191 107
45 3300003323 rootH1_10113845 rootH1_101138453 107
46 3300003323 rootH1_10241137 rootH1_102411371 107
47 3300003323 rootH1_10371895 rootH1_103718951 107
48 3300003771 Ga0055526_1003703 Ga0055526_10037031 107
49 3300003775 Ga0055524_1002287 Ga0055524_10022878 107
50 3300003790 Ga0055528_1000185 Ga0055528_100018533 107
51 3300005457 Ga0070662_100626597 Ga0070662_1006265972 107
52 3300005530 Ga0070679_100344144 Ga0070679_1003441443 107
53 3300005539 Ga0068853_100061303 Ga0068853_1000613035 107
54 3300005577 Ga0068857_100730630 Ga0068857_1007306303 107
55 3300005578 Ga0068854_101841615 Ga0068854_1018416152 107
56 3300005616 Ga0068852_100571119 Ga0068852_1005711192 107
57 3300005834 Ga0068851_10026860 Ga0068851_100268604 107
58 3300006042 Ga0075368_10241512 Ga0075368_102415122 107
59 3300006048 Ga0075363_100123779 Ga0075363_1001237792 107
60 3300006048 Ga0075363_100373320 Ga0075363_1003733202 107
61 3300006178 Ga0075367_10308806 Ga0075367_103088062 107
62 3300006186 Ga0075369_10229496 Ga0075369_102294962 107
63 3300006195 Ga0075366_10008492 Ga0075366_100084922 107
64 3300006195 Ga0075366_10771135 Ga0075366_107711352 107
65 3300006237 Ga0097621_100186881 Ga0097621_1001868812 107
66 3300006353 Ga0075370_10261267 Ga0075370_102612673 107
67 3300006353 Ga0075370_10499860 Ga0075370_104998602 107
68 3300009553 Ga0105249_10038620 Ga0105249_100386205 107
69 3300013104 Ga0157370_10000224 Ga0157370_1000022412 107
70 3300014497 Ga0182008_10002859 Ga0182008_100028597 107
71 3300014968 Ga0157379_10998272 Ga0157379_109982721 107
72 3300015261 Ga0182006_1000098 Ga0182006_10000988 107
73 3300015262 Ga0182007_10035280 Ga0182007_100352802 107
74 3300015265 Ga0182005_1005549 Ga0182005_10055493 107
75 3300017792 Ga0163161_10985516 Ga0163161_109855162 107
76 3300021358 Ga0213873_10126688 Ga0213873_101266882 107
77 3300021361 Ga0213872_10023421 Ga0213872_100234214 107
78 3300021361 Ga0213872_10047527 Ga0213872_100475272 107
79 3300021361 Ga0213872_10191763 Ga0213872_101917633 107
80 3300021361 Ga0213872_10464634 Ga0213872_104646341 107
81 3300022467 Ga0224712_10236921 Ga0224712_102369212 107
82 3300025261 Ga0209233_1008005 Ga0209233_10080057 107
83 3300025273 Ga0209673_1000595 Ga0209673_100059537 107
84 3300025292 Ga0209676_1012054 Ga0209676_10120547 107
85 3300025295 Ga0209564_1001616 Ga0209564_100161610 107
86 3300025298 Ga0209050_1001381 Ga0209050_100138121 107
87 3300025299 Ga0209256_1000567 Ga0209256_100056737 107
88 3300025303 Ga0209051_1031521 Ga0209051_10315212 107
89 3300025303 Ga0209051_1132580 Ga0209051_11325802 107
90 3300025304 Ga0209257_1078876 Ga0209257_10788762 107
91 3300025321 Ga0207656_10009254 Ga0207656_100092544 107
92 3300025904 Ga0207647_10012205 Ga0207647_100122056 107
93 3300025904 Ga0207647_10755301 Ga0207647_107553012 107
94 3300025912 Ga0207707_10100629 Ga0207707_101006293 107
95 3300025924 Ga0207694_10080158 Ga0207694_100801584 107
96 3300025924 Ga0207694_10567968 Ga0207694_105679682 107
97 3300025933 Ga0207706_10033817 Ga0207706_100338171 107
98 3300025941 Ga0207711_10973595 Ga0207711_109735951 107
99 3300025961 Ga0207712_10030651 Ga0207712_100306513 107
100 3300025981 Ga0207640_10745410 Ga0207640_107454101 107
101 3300026041 Ga0207639_10033110 Ga0207639_100331101 107
102 3300026078 Ga0207702_10713278 Ga0207702_107132782 107
103 3300026116 Ga0207674_10029975 Ga0207674_100299751 107
104 3300026142 Ga0207698_10542309 Ga0207698_105423092 107
105 3300027866 Ga0209813_10327921 Ga0209813_103279212 107
106 3300028379 Ga0268266_11894679 Ga0268266_118946792 107
107 3300028794 Ga0307515_10005525 Ga0307515_1000552517 107
108 3300030760 Ga0265762_1055452 Ga0265762_10554521 107
109 3300031239 Ga0265328_10000188 Ga0265328_1000018819 107
110 3300031239 Ga0265328_10000282 Ga0265328_100002825 107
111 3300031239 Ga0265328_10099705 Ga0265328_100997053 107
112 3300031239 Ga0265328_10455760 Ga0265328_104557601 107
113 3300031250 Ga0265331_10002470 Ga0265331_1000247014 107
114 3300031250 Ga0265331_10014779 Ga0265331_100147795 107
115 3300031251 Ga0265327_10010966 Ga0265327_100109667 107
116 3300031251 Ga0265327_10306088 Ga0265327_103060881 107
117 3300031344 Ga0265316_10306054 Ga0265316_103060542 107
118 3300031456 Ga0307513_10388941 Ga0307513_103889412 107
119 3300031711 Ga0265314_10048539 Ga0265314_100485393 107
120 3300031711 Ga0265314_10382691 Ga0265314_103826912 107
121 3300031712 Ga0265342_10023267 Ga0265342_100232677 107
122 3300031911 Ga0307412_10002443 Ga0307412_100024437 107
123 3300031911 Ga0307412_10003587 Ga0307412_100035871 107
124 3300031911 Ga0307412_10187019 Ga0307412_101870192 107
125 3300031911 Ga0307412_10663133 Ga0307412_106631332 107
126 3300032002 Ga0307416_102811757 Ga0307416_1028117572 107
127 3300032004 Ga0307414_12215741 Ga0307414_122157412 107
128 3300033180 Ga0307510_10108242 Ga0307510_101082423 107
129 3300039438 Ga0436360_0480540 Ga0436360_0480540_236_559 107
130 3300039447 Ga0436361_0220824 Ga0436361_0220824_2168_2491 107
131 3300039447 Ga0436361_0417596 Ga0436361_0417596_3848_4171 107
132 3300039447 Ga0436361_0907976 Ga0436361_0907976_89_412 107
133 3300039447 Ga0436361_1169114 Ga0436361_1169114_4329_4652 107
134 3300039453 Ga0436362_1036965 Ga0436362_1036965_229_552 107
135 3300041404 Ga0439436_0000003 Ga0439436_0000003_82959_83282 107
136 3300041453 Ga0451797_0013506 Ga0451797_0013506_428_751 107
137 3300041491 Ga0451833_0173620 Ga0451833_0173620_29_418 107
138 3300041491 Ga0451833_0595190 Ga0451833_0595190_607_996 107
139 3300041509 Ga0451843_0877456 Ga0451843_0877456_215_604 107
140 3300042125 Ga0450923_151967 Ga0450923_151967_46_369 107
141 3300042156 Ga0439446_0230323 Ga0439446_0230323_70_393 107
142 3300042157 Ga0439458_0037627 Ga0439458_0037627_423_746 107
143 3300044735 Ga0466968_0002442 Ga0466968_0002442_3873_4196 107
144 3300044765 Ga0466970_0196642 Ga0466970_0196642_662_985 107
145 3300044901 Ga0466960_0270248 Ga0466960_0270248_506_829 107
146 3300046452 Ga0495617_000856 Ga0495617_000856_4065_4388 107
147 3300046453 Ga0495627_098667 Ga0495627_098667_240_563 107
148 3300046460 Ga0495638_0029194 Ga0495638_0029194_1766_2089 107
149 3300046491 Ga0495584_0026980 Ga0495584_0026980_2247_2570 107
150 3300046492 Ga0495585_0004268 Ga0495585_0004268_1296_1619 107
151 3300046492 Ga0495585_0048068 Ga0495585_0048068_1484_1807 107
152 3300046492 Ga0495585_0344140 Ga0495585_0344140_53_376 107
153 3300046492 Ga0495585_0436186 Ga0495585_0436186_133_612 107
154 3300046507 Ga0495606_0024437 Ga0495606_0024437_2297_2629 107
155 3300046512 Ga0495610_0014784 Ga0495610_0014784_3119_3442 107
156 3300046528 Ga0495642_0167363 Ga0495642_0167363_575_898 107
157 3300046538 Ga0495609_0014006 Ga0495609_0014006_3097_3420 107
158 3300046558 Ga0495633_0010478 Ga0495633_0010478_329_652 107
159 3300046615 Ga0495656_0409708 Ga0495656_0409708_204_593 107
160 3300046660 Ga0495625_0001011 Ga0495625_0001011_4166_4489 107
161 3300046660 Ga0495625_0001441 Ga0495625_0001441_14115_14438 107
162 3300046660 Ga0495625_0310428 Ga0495625_0310428_204_593 107
163 3300046684 Ga0495669_0257497 Ga0495669_0257497_164_487 107
164 3300046691 Ga0495670_0001095 Ga0495670_0001095_4183_4506 107
165 3300046694 Ga0495649_0012276 Ga0495649_0012276_168_491 107
166 3300047320 Ga0495672_0092492 Ga0495672_0092492_833_1156 107
167 3300047470 Ga0495681_0117132 Ga0495681_0117132_378_701 107
168 3300047472 Ga0495686_0159705 Ga0495686_0159705_35_358 107
169 3300048903 Ga0496100_0778130 Ga0496100_0778130_21_353 107
170 3300048904 Ga0496101_0438841 Ga0496101_0438841_479_811 107
171 3300048907 Ga0496104_0137392 Ga0496104_0137392_1310_1633 107
172 3300048908 Ga0496105_0918048 Ga0496105_0918048_16_348 107
173 3300048908 Ga0496105_1010883 Ga0496105_1010883_59_382 107
174 3300048921 Ga0496118_0036827 Ga0496118_0036827_1300_1623 107
175 3300048921 Ga0496118_0270366 Ga0496118_0270366_354_677 107
176 3300048922 Ga0496119_0022855 Ga0496119_0022855_1333_1656 107
177 3300048923 Ga0496120_0065490 Ga0496120_0065490_1545_1868 107
178 3300048924 Ga0496121_0001151 Ga0496121_0001151_10208_10531 107
179 3300048924 Ga0496121_0169471 Ga0496121_0169471_817_1140 107
180 3300048924 Ga0496121_0659930 Ga0496121_0659930_56_379 107
181 3300049460 Ga0495682_0000332 Ga0495682_0000332_6927_7250 107
182 3300049570 Ga0501033_0006258 Ga0501033_0006258_7284_7607 107
183 3300049571 Ga0501034_0095617 Ga0501034_0095617_434_757 107
184 3300049572 Ga0501036_0004691 Ga0501036_0004691_2270_2593 107
185 3300049573 Ga0501037_0073009 Ga0501037_0073009_1261_1584 107
186 3300049574 Ga0501038_0008581 Ga0501038_0008581_3987_4310 107
187 3300049575 Ga0501039_0474466 Ga0501039_0474466_208_531 107
188 3300049579 Ga0501043_0110694 Ga0501043_0110694_567_890 107
189 3300049580 Ga0501046_0053036 Ga0501046_0053036_2260_2583 107
190 3300049580 Ga0501046_1156095 Ga0501046_1156095_156_479 107
191 3300049581 Ga0501047_0020297 Ga0501047_0020297_3106_3429 107
192 3300049581 Ga0501047_0048807 Ga0501047_0048807_637_960 107
193 3300049581 Ga0501047_1351220 Ga0501047_1351220_176_499 107
194 3300049586 Ga0501070_0167119 Ga0501070_0167119_112_435 107
195 3300049822 Ga0501035_0018000 Ga0501035_0018000_3543_3866 107
196 3300049822 Ga0501035_0712616 Ga0501035_0712616_117_440 107
197 3300049823 Ga0501044_0000718 Ga0501044_0000718_7424_7747 107
198 3300050490 nmdc:mga03n38_115227_c1 nmdc:mga03n38_115227_c1_483_806 107
199 3300050490 nmdc:mga03n38_732484_c1 nmdc:mga03n38_732484_c1_135_458 107
200 3300050493 nmdc:mga0k408_11171_c1 nmdc:mga0k408_11171_c1_2349_2672 107
201 3300050494 nmdc:mga06z11_336875_c1 nmdc:mga06z11_336875_c1_384_707 107
202 3300050494 nmdc:mga06z11_87972_c1 nmdc:mga06z11_87972_c1_700_1023 107
203 3300050495 nmdc:mga04h51_365489_c1 nmdc:mga04h51_365489_c1_45_368 107
204 3300050496 nmdc:mga07m45_19768_c2 nmdc:mga07m45_19768_c2_313_636 107
205 3300050496 nmdc:mga07m45_234212_c1 nmdc:mga07m45_234212_c1_176_499 107
206 3300050516 nmdc:mga0sz30_176576_c1 nmdc:mga0sz30_176576_c1_489_812 107
207 3300050516 nmdc:mga0sz30_232445_c1 nmdc:mga0sz30_232445_c1_339_662 107
208 3300053086 Ga0500578_0000025 Ga0500578_0000025_119758_120081 107
209 3300053086 Ga0500578_0193452 Ga0500578_0193452_112_435 107
210 3300053087 Ga0500643_000749 Ga0500643_000749_20094_20420 107
211 3300053087 Ga0500643_005049 Ga0500643_005049_2804_3127 107
212 3300053087 Ga0500643_052431 Ga0500643_052431_667_990 107
213 3300053094 Ga0500566_0198293 Ga0500566_0198293_70_393 107
214 3300053108 Ga0500562_016708 Ga0500562_016708_371_694 107
215 3300053111 Ga0500572_127944 Ga0500572_127944_349_672 107
216 3300053118 Ga0500594_0001502 Ga0500594_0001502_2301_2624 107
217 3300053119 Ga0500595_008693 Ga0500595_008693_158_481 107
218 3300053121 Ga0500607_002075 Ga0500607_002075_1651_1974 107
219 3300053125 Ga0500618_000081 Ga0500618_000081_43293_43616 107
220 3300053125 Ga0500618_016980 Ga0500618_016980_573_896 107
221 3300053151 Ga0500604_0007009 Ga0500604_0007009_2071_2394 107
222 3300053158 Ga0500627_0020770 Ga0500627_0020770_2051_2374 107
223 3300053158 Ga0500627_0082329 Ga0500627_0082329_525_848 107
224 3300053163 Ga0500639_120556 Ga0500639_120556_432_755 107
225 3300053733 Ga0500552_006340 Ga0500552_006340_524_847 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

51

97

0.96

PF13560

HTH_31

Helix-turn-helix domain

49

97

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zz8-assembly2.cif.gz_C crystal structure of feii hppe in complex with substrate form 2 0.9566 49 83
5j9i-assembly1.cif.gz_B crystal structure of the higa2 antitoxin c-terminal domain 0.955 46 106
3mlf-assembly2.cif.gz_C putative transcriptional regulator from staphylococcus aureus. 0.9198 52 100
5j9i-assembly2.cif.gz_C crystal structure of the higa2 antitoxin c-terminal domain 0.9188 46 106
5j9i-assembly4.cif.gz_G crystal structure of the higa2 antitoxin c-terminal domain 0.9145 47 106
ID Description Score Start End Superfamily
af_Q2FY91_1_87_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9115 52 100 1.10.260.40
3mlfA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9069 52 96 1.10.260.40
af_Q58006_80_170_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9027 49 103 1.10.260.40
1x57A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8981 49 96 1.10.260.40
af_P76196_1_118_1.10.3100.10 Mainly Alpha;Orthogonal Bundle;Putative cytoplasmic protein;Putative cytoplasmic protein 0.8908 47 100 1.10.3100.10
ID Description Score Start End GO Terms
AF-A0A522WGW8-F1-model_v4 Helix-turn-helix domain-containing protein 1.01 47 100 GO:0003677
GO:0035438
AF-A0A2V9FV95-F1-model_v4 Transcriptional regulator 0.9972 46 107 GO:0003677
AF-A0A661EKS6-F1-model_v4 Transcriptional regulator 0.9938 46 107 GO:0003677
AF-A0A0F9T683-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9921 48 102 GO:0003677
AF-A0A1F8XCM7-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9919 44 100 GO:0003677
GO:0035438

Feature Viewer

pLDDT pTM Quality
84.47 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map