F337406

General Info

Members Datasets Scaffolds Average Seq Length
225 159 198 209

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10037041|Ga0070658_100370412
Length 242
Sequence VSDKISERIPSSERREQILDAASRVFGERGYFGATTDQIAKAAGISQPYVVRMFGGKENLFLGVLSRCLDRLLVAFTETLEQWKAEGSPNEPLAGYATAAGAPAGTPGDLAAPTSAGGHGEIGRRLGLAYVSLVEDRGLLLVLMQAFSMGHDPTIGAQARAGFLTIYRLLRAEAGFTPEQTRAFLAEGMLLNTLLGLRLPDSYDEDEAARELLECTFRTKLDLVLHLAAEADHGRAAGAQRA

Samples

Sample ID Description Type Environment
1 2643221549 Agromyces sp. Root1464 Isolate Unclassified
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221575 Microbacterium sp. Root61 Isolate Unclassified
5 2643221613 Oerskovia sp. Root22 Isolate Unclassified
6 2643221616 Leifsonia sp. Root227 Isolate Unclassified
7 2643221619 Agromyces sp. Root81 Isolate Unclassified
8 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
9 2643221721 Oerskovia sp. Root918 Isolate Unclassified
10 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
11 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
12 2808606372 Agromyces sp. 23-23 Isolate Unclassified
13 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
14 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
15 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
16 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
17 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
18 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
19 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
20 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
21 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
22 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
23 2928153084 Leifsonia sp. 563 Isolate Unclassified
24 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
25 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
152 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
153 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
159 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.67
Metatranscriptomes 1.33
Isolates 12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.89
Nodule 0
Rhizoplane 11.11
Rhizosphere 54.22
Stem 0
Stem Tuber 0
Unclassified 17.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004355 3300001979 Bacteria 6095
2 JGI24735J21928_10002540 3300002067 Bacteria 6308
3 rootH2_10100994 3300003320 Bacteria 1527
4 rootL2_10257705 3300003322 Bacteria 1077
5 rootH1_10201175 3300003323 Bacteria 1007
6 Ga0006562J51391_1093522 3300003578 Bacteria 12369
7 Ga0006562J51391_1093523 3300003578 Bacteria 3850
8 Ga0055539_1000035 3300003752 Bacteria 217588
9 Ga0055533_1000001 3300003756 Bacteria 1863437
10 Ga0055525_1000531 3300003759 Bacteria 18376
11 Ga0055527_1000005 3300003760 Bacteria 504776
12 Ga0055542_1000006 3300003762 Bacteria 504776
13 Ga0055529_1000334 3300003763 Bacteria 52660
14 Ga0055529_1019877 3300003763 Bacteria 838
15 Ga0070658_10037041 3300005327 Bacteria 3931
16 Ga0070675_100862549 3300005354 Bacteria 829
17 Ga0070667_100975780 3300005367 Bacteria 790
18 Ga0070663_100105886 3300005455 Bacteria 2106
19 Ga0070672_100276058 3300005543 Bacteria 1420
20 Ga0068857_100393492 3300005577 Bacteria 1289
21 Ga0068864_100908503 3300005618 Bacteria 870
22 Ga0068870_10148559 3300005840 Bacteria 1378
23 Ga0075365_10009563 3300006038 Bacteria 5585
24 Ga0075365_10021025 3300006038 Bacteria 4062
25 Ga0075367_10168570 3300006178 Bacteria 1363
26 Ga0075369_10021665 3300006186 Bacteria 2644
27 Ga0111539_10559565 3300009094 Bacteria 1332
28 Ga0105243_10087181 3300009148 Bacteria 2562
29 Ga0105246_10684368 3300011119 Bacteria 897
30 Ga0157370_10208381 3300013104 Bacteria 1812
31 Ga0157370_10380653 3300013104 Bacteria 1300
32 Ga0157369_10182306 3300013105 Bacteria 2209
33 Ga0163162_10265356 3300013306 Bacteria 1849
34 Ga0157375_10934728 3300013308 Bacteria 1010
35 Ga0157375_11626159 3300013308 Bacteria 764
36 Ga0163163_11410689 3300014325 Bacteria 758
37 Ga0206353_10505610 3300020082 Bacteria 5497
38 Ga0209566_100055 3300025225 Bacteria 210307
39 Ga0209674_100001 3300025226 Bacteria 4013750
40 Ga0209672_100003 3300025228 Bacteria 1560476
41 Ga0209147_103577 3300025229 Bacteria 2946
42 Ga0209563_100001 3300025230 Bacteria 4013775
43 Ga0209563_100923 3300025230 Bacteria 8661
44 Ga0209677_100001 3300025253 Bacteria 4013787
45 Ga0209677_100720 3300025253 Bacteria 16852
46 Ga0209148_1000004 3300025254 Bacteria 1844481
47 Ga0209455_1000022 3300025272 Bacteria 688910
48 Ga0209455_1019403 3300025272 Bacteria 1375
49 Ga0207688_10025333 3300025901 Bacteria 3257
50 Ga0207647_10029466 3300025904 Bacteria 3553
51 Ga0207643_10027041 3300025908 Bacteria 3180
52 Ga0207705_10030344 3300025909 Bacteria 3858
53 Ga0207659_10246485 3300025926 Bacteria 1448
54 Ga0207709_10245818 3300025935 Bacteria 1304
55 Ga0207712_10636673 3300025961 Unclassified 925
56 Ga0207658_10718378 3300025986 Bacteria 904
57 Ga0207678_10282112 3300026067 Bacteria 1426
58 Ga0207676_10563214 3300026095 Bacteria 1090
59 Ga0207674_10150291 3300026116 Bacteria 2286
60 Ga0207683_10147724 3300026121 Bacteria 2121
61 Ga0307513_10427071 3300031456 Bacteria 1054
62 Ga0307407_10618388 3300031903 Bacteria 808
63 Ga0307416_100294071 3300032002 Bacteria 1610
64 Ga0307416_100458468 3300032002 Bacteria 1329
65 Ga0307414_10239686 3300032004 Bacteria 1501
66 Ga0307414_10292567 3300032004 Bacteria 1374
67 Ga0307414_10511893 3300032004 Bacteria 1064
68 Ga0307414_10771500 3300032004 Bacteria 875
69 Ga0307414_11268876 3300032004 Bacteria 683
70 Ga0307415_101009973 3300032126 Bacteria 774
71 Ga0395900_0045020 3300037418 Bacteria 4545
72 Ga0395900_0080023 3300037418 Bacteria 3358
73 Ga0395900_0248813 3300037418 Bacteria 1780
74 Ga0395900_0388150 3300037418 Bacteria 1363
75 Ga0395898_0000246 3300037466 Bacteria 135487
76 Ga0395901_0564909 3300038443 Bacteria 1151
77 Ga0439465_0108667 3300041413 Bacteria 963
78 Ga0451797_0206934 3300041453 Bacteria 900
79 Ga0451802_1036890 3300041460 Bacteria 1857
80 Ga0451853_4052207 3300041512 Bacteria 1018
81 Ga0466972_0028710 3300044658 Bacteria 2742
82 Ga0466972_0034728 3300044658 Bacteria 2469
83 Ga0466972_0206846 3300044658 Bacteria 919
84 Ga0466965_0000007 3300044683 Bacteria 131940
85 Ga0466965_0009352 3300044683 Plasmid 4554
86 Ga0466965_0016275 3300044683 Bacteria 3537
87 Ga0466965_0051075 3300044683 Bacteria 2051
88 Ga0466965_0074310 3300044683 Bacteria 1712
89 Ga0466966_0030561 3300044684 Bacteria 3496
90 Ga0466966_0171926 3300044684 Bacteria 1316
91 Ga0466966_0201059 3300044684 Bacteria 1206
92 Ga0466961_0063155 3300044693 Bacteria 2353
93 Ga0466961_0320886 3300044693 Bacteria 944
94 Ga0466964_0169038 3300044706 Bacteria 1028
95 Ga0466971_0298931 3300044719 Bacteria 773
96 Ga0466968_0005408 3300044735 Bacteria 4784
97 Ga0466968_0030768 3300044735 Bacteria 2225
98 Ga0466968_0034452 3300044735 Bacteria 2113
99 Ga0466970_0000322 3300044765 Bacteria 23272
100 Ga0466970_0018882 3300044765 Bacteria 3571
101 Ga0466970_0024474 3300044765 Bacteria 3157
102 Ga0466970_0048373 3300044765 Bacteria 2267
103 Ga0466970_0268717 3300044765 Bacteria 958
104 Ga0466957_0028694 3300044842 Bacteria 3314
105 Ga0466957_0029115 3300044842 Bacteria 3292
106 Ga0466960_0345609 3300044901 Bacteria 847
107 Ga0466958_0091920 3300045836 Bacteria 1878
108 Ga0466967_0483351 3300045976 Bacteria 1214
109 Ga0466967_0527000 3300045976 Bacteria 1161
110 Ga0466967_0966654 3300045976 Bacteria 848
111 Ga0495627_000852 3300046453 Bacteria 21820
112 Ga0495590_0000122 3300046457 Bacteria 46108
113 Ga0495632_0284484 3300046519 Bacteria 736
114 Ga0495625_0126482 3300046660 Bacteria 1735
115 Ga0495661_0399963 3300046665 Bacteria 668
116 Ga0495670_0474341 3300046691 Bacteria 679
117 Ga0495672_0185505 3300047320 Bacteria 1050
118 Ga0495686_0097919 3300047472 Bacteria 1773
119 Ga0495686_0104853 3300047472 Bacteria 1701
120 Ga0495686_0110178 3300047472 Bacteria 1652
121 Ga0496100_0612397 3300048903 Bacteria 846
122 Ga0496101_0010845 3300048904 Bacteria 6028
123 Ga0496102_0075009 3300048905 Bacteria 3109
124 Ga0496102_0468715 3300048905 Bacteria 1180
125 Ga0496102_0661225 3300048905 Bacteria 968
126 Ga0496104_0093298 3300048907 Bacteria 2879
127 Ga0496104_0933777 3300048907 Bacteria 772
128 Ga0496105_0135664 3300048908 Bacteria 2027
129 Ga0496105_0171011 3300048908 Bacteria 1781
130 Ga0496105_0389073 3300048908 Bacteria 1109
131 Ga0496105_0501064 3300048908 Bacteria 953
132 Ga0496106_0499838 3300048909 Bacteria 977
133 Ga0496107_0147896 3300048910 Bacteria 1737
134 Ga0496108_0257542 3300048911 Bacteria 1518
135 Ga0496109_0116822 3300048912 Bacteria 2483
136 Ga0496110_0368926 3300048913 Bacteria 1308
137 Ga0496112_0455035 3300048915 Bacteria 1218
138 Ga0496113_0067107 3300048916 Bacteria 2719
139 Ga0496114_0142199 3300048917 Bacteria 2078
140 Ga0496114_0179422 3300048917 Bacteria 1849
141 Ga0496114_0449330 3300048917 Bacteria 1141
142 Ga0496115_0283965 3300048918 Bacteria 1358
143 Ga0496115_0925130 3300048918 Bacteria 671
144 Ga0496116_0068905 3300048919 Bacteria 2252
145 Ga0496117_0001079 3300048920 Bacteria 41309
146 Ga0496117_0001576 3300048920 Bacteria 32370
147 Ga0496117_0031326 3300048920 Bacteria 4062
148 Ga0496117_0035590 3300048920 Bacteria 3735
149 Ga0496118_0000398 3300048921 Bacteria 73344
150 Ga0496118_0013856 3300048921 Bacteria 7589
151 Ga0496119_0038566 3300048922 Bacteria 3085
152 Ga0496120_0084053 3300048923 Bacteria 1717
153 Ga0496120_0247259 3300048923 Bacteria 839
154 Ga0496121_0038853 3300048924 Bacteria 4206
155 Ga0496121_0108069 3300048924 Bacteria 2129
156 Ga0496124_0000198 3300048927 Bacteria 119277
157 Ga0496126_0028098 3300048929 Bacteria 5363
158 Ga0496126_0092705 3300048929 Bacteria 2653
159 Ga0496126_0096336 3300048929 Bacteria 2594
160 Ga0496126_0126584 3300048929 Bacteria 2211
161 Ga0501033_0032321 3300049570 Bacteria 3930
162 Ga0501034_0002868 3300049571 Bacteria 20058
163 Ga0501034_0074356 3300049571 Bacteria 3406
164 Ga0501034_0265212 3300049571 Bacteria 1659
165 Ga0501034_0375861 3300049571 Bacteria 1346
166 Ga0501036_0054818 3300049572 Bacteria 3378
167 Ga0501037_0037409 3300049573 Bacteria 3578
168 Ga0501043_0007291 3300049579 Bacteria 8779
169 Ga0501043_0383162 3300049579 Bacteria 1064
170 Ga0501047_0092416 3300049581 Bacteria 2904
171 Ga0501047_0137083 3300049581 Bacteria 2327
172 Ga0501070_0000350 3300049586 Bacteria 41828
173 Ga0501070_0000980 3300049586 Bacteria 25623
174 Ga0501071_0376610 3300049587 Bacteria 1082
175 Ga0501072_0424267 3300049588 Bacteria 1054
176 Ga0501073_0140368 3300049589 Bacteria 1674
177 Ga0501080_0006757 3300049742 Bacteria 10335
178 Ga0501081_0987289 3300049743 Bacteria 636
179 Ga0501083_0024986 3300049744 Bacteria 4137
180 nmdc:mga00v17_3469_c1 3300050491 Bacteria 8164
181 nmdc:mga0yw44_15251_c2 3300050492 Bacteria 2673
182 nmdc:mga08y16_548594_c1 3300050511 Bacteria 1170
183 Ga0500643_001374 3300053087 Bacteria 14103
184 Ga0500556_0000007 3300053104 Bacteria 331400
185 Ga0500556_0000775 3300053104 Bacteria 18888
186 Ga0500562_000370 3300053108 Bacteria 10851
187 Ga0500593_001805 3300053117 Bacteria 7690
188 Ga0500655_001211 3300053133 Bacteria 4901
189 Ga0500559_0000926 3300053136 Bacteria 18567
190 Ga0500568_0000021 3300053139 Bacteria 185406
191 Ga0500568_0000098 3300053139 Bacteria 80393
192 Ga0500568_0002866 3300053139 Bacteria 9921
193 Ga0500568_0057726 3300053139 Bacteria 1509
194 Ga0500616_0000078 3300053153 Bacteria 202009
195 Ga0500616_0000302 3300053153 Bacteria 71543
196 Ga0500616_0001272 3300053153 Bacteria 25197
197 Ga0501084_0194024 3300054114 Bacteria 1713
198 Ga0466962_0039563 3300061719 Bacteria 2258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0320886 Ga0466961_0320886_12_626 179
2 iso_pu_bacteria 2751185788 2753303442 179
3 3300046691 Ga0495670_0474341 Ga0495670_0474341_18_650 182
4 3300053139 Ga0500568_0002866 Ga0500568_0002866_8603_9175 184
5 3300005577 Ga0068857_100393492 Ga0068857_1003934922 185
6 3300026116 Ga0207674_10150291 Ga0207674_101502912 185
7 3300037418 Ga0395900_0248813 Ga0395900_0248813_731_1288 185
8 3300038443 Ga0395901_0564909 Ga0395901_0564909_486_1043 185
9 3300050491 nmdc:mga00v17_3469_c1 nmdc:mga00v17_3469_c1_1860_2417 185
10 3300053108 Ga0500562_000370 Ga0500562_000370_4157_4714 185
11 3300048908 Ga0496105_0501064 Ga0496105_0501064_372_932 186
12 3300050492 nmdc:mga0yw44_15251_c2 nmdc:mga0yw44_15251_c2_271_831 186
13 3300046519 Ga0495632_0284484 Ga0495632_0284484_126_698 189
14 3300049571 Ga0501034_0375861 Ga0501034_0375861_243_815 189
15 3300049588 Ga0501072_0424267 Ga0501072_0424267_226_798 189
16 iso_pu_bacteria 2811994872 2812322195 190
17 3300045976 Ga0466967_0527000 Ga0466967_0527000_24_707 191
18 3300048920 Ga0496117_0001079 Ga0496117_0001079_15692_16330 191
19 3300048921 Ga0496118_0000398 Ga0496118_0000398_32569_33207 191
20 3300048923 Ga0496120_0084053 Ga0496120_0084053_371_991 191
21 3300048927 Ga0496124_0000198 Ga0496124_0000198_78420_79058 191
22 iso_pu_bacteria 2857737099 2857739429 191
23 3300003323 rootH1_10201175 rootH1_102011751 192
24 3300046665 Ga0495661_0399963 Ga0495661_0399963_44_637 192
25 3300047320 Ga0495672_0185505 Ga0495672_0185505_97_726 192
26 3300047472 Ga0495686_0104853 Ga0495686_0104853_292_891 192
27 3300049743 Ga0501081_0987289 Ga0501081_0987289_19_597 192
28 3300053087 Ga0500643_001374 Ga0500643_001374_7785_8384 192
29 3300053104 Ga0500556_0000007 Ga0500556_0000007_321677_322276 192
30 3300053139 Ga0500568_0000021 Ga0500568_0000021_175666_176265 192
31 3300041453 Ga0451797_0206934 Ga0451797_0206934_185_796 193
32 3300044683 Ga0466965_0009352 Ga0466965_0009352_191_778 193
33 3300044901 Ga0466960_0345609 Ga0466960_0345609_177_764 193
34 3300013104 Ga0157370_10380653 Ga0157370_103806532 194
35 3300048905 Ga0496102_0661225 Ga0496102_0661225_71_655 194
36 3300048907 Ga0496104_0933777 Ga0496104_0933777_39_623 194
37 3300048918 Ga0496115_0925130 Ga0496115_0925130_43_627 194
38 iso_pu_bacteria 2928104781 2928107004 194
39 iso_pu_bacteria 8057345674 8057347859 194
40 3300044683 Ga0466965_0051075 Ga0466965_0051075_450_1046 195
41 iso_pu_bacteria 2643221616 2644095413 196
42 3300044765 Ga0466970_0268717 Ga0466970_0268717_177_773 197
43 iso_pu_bacteria 2844841374 2844841803 197
44 iso_pu_bacteria 2919523602 2919523856 197
45 3300006178 Ga0075367_10168570 Ga0075367_101685702 198
46 3300041460 Ga0451802_1036890 Ga0451802_1036890_1078_1689 198
47 3300048908 Ga0496105_0389073 Ga0496105_0389073_145_741 198
48 3300048917 Ga0496114_0142199 Ga0496114_0142199_1368_1964 198
49 3300048917 Ga0496114_0179422 Ga0496114_0179422_875_1471 198
50 3300053139 Ga0500568_0057726 Ga0500568_0057726_740_1351 198
51 iso_pu_bacteria 2919055335 2919058992 198
52 iso_pu_bacteria 2928153084 2928153160 198
53 3300006038 Ga0075365_10009563 Ga0075365_100095636 199
54 3300006186 Ga0075369_10021665 Ga0075369_100216653 199
55 3300048929 Ga0496126_0096336 Ga0496126_0096336_1210_1809 199
56 3300053104 Ga0500556_0000775 Ga0500556_0000775_10638_11237 199
57 3300053117 Ga0500593_001805 Ga0500593_001805_1752_2351 199
58 3300053133 Ga0500655_001211 Ga0500655_001211_4148_4747 199
59 3300053136 Ga0500559_0000926 Ga0500559_0000926_72_671 199
60 iso_pu_bacteria 2643221549 2643769231 199
61 iso_pu_bacteria 2643221619 2644112677 199
62 iso_pu_bacteria 2808606372 2808900300 199
63 iso_pu_bacteria 2919443155 2919444882 199
64 3300006038 Ga0075365_10021025 Ga0075365_100210256 200
65 3300046453 Ga0495627_000852 Ga0495627_000852_2187_2819 200
66 3300053153 Ga0500616_0001272 Ga0500616_0001272_19876_20490 200
67 3300003322 rootL2_10257705 rootL2_102577051 201
68 3300003752 Ga0055539_1000035 Ga0055539_100003521 201
69 3300003756 Ga0055533_1000001 Ga0055533_1000001147 201
70 3300003759 Ga0055525_1000531 Ga0055525_100053116 201
71 3300003760 Ga0055527_1000005 Ga0055527_100000553 201
72 3300003762 Ga0055542_1000006 Ga0055542_100000653 201
73 3300003763 Ga0055529_1000334 Ga0055529_100033453 201
74 3300003763 Ga0055529_1019877 Ga0055529_10198771 201
75 3300013105 Ga0157369_10182306 Ga0157369_101823062 201
76 3300013306 Ga0163162_10265356 Ga0163162_102653562 201
77 3300013308 Ga0157375_10934728 Ga0157375_109347282 201
78 3300025225 Ga0209566_100055 Ga0209566_10005573 201
79 3300025226 Ga0209674_100001 Ga0209674_100001147 201
80 3300025228 Ga0209672_100003 Ga0209672_100003397 201
81 3300025229 Ga0209147_103577 Ga0209147_1035772 201
82 3300025230 Ga0209563_100001 Ga0209563_100001147 201
83 3300025253 Ga0209677_100001 Ga0209677_100001147 201
84 3300025254 Ga0209148_1000004 Ga0209148_1000004692 201
85 3300025272 Ga0209455_1000022 Ga0209455_1000022291 201
86 3300025272 Ga0209455_1019403 Ga0209455_10194032 201
87 3300025904 Ga0207647_10029466 Ga0207647_100294664 201
88 3300037418 Ga0395900_0045020 Ga0395900_0045020_1993_2631 201
89 3300037466 Ga0395898_0000246 Ga0395898_0000246_58793_59431 201
90 3300044658 Ga0466972_0034728 Ga0466972_0034728_642_1304 201
91 3300044658 Ga0466972_0206846 Ga0466972_0206846_187_849 201
92 3300044683 Ga0466965_0016275 Ga0466965_0016275_1391_2020 201
93 3300044684 Ga0466966_0030561 Ga0466966_0030561_1813_2475 201
94 3300044684 Ga0466966_0201059 Ga0466966_0201059_509_1138 201
95 3300044693 Ga0466961_0063155 Ga0466961_0063155_1660_2289 201
96 3300044719 Ga0466971_0298931 Ga0466971_0298931_12_674 201
97 3300044735 Ga0466968_0030768 Ga0466968_0030768_930_1592 201
98 3300044765 Ga0466970_0018882 Ga0466970_0018882_2002_2664 201
99 3300044842 Ga0466957_0029115 Ga0466957_0029115_115_777 201
100 3300045976 Ga0466967_0966654 Ga0466967_0966654_162_791 201
101 3300048904 Ga0496101_0010845 Ga0496101_0010845_4522_5160 201
102 3300048905 Ga0496102_0075009 Ga0496102_0075009_1835_2473 201
103 3300048907 Ga0496104_0093298 Ga0496104_0093298_1483_2121 201
104 3300048908 Ga0496105_0135664 Ga0496105_0135664_430_1068 201
105 3300048909 Ga0496106_0499838 Ga0496106_0499838_322_960 201
106 3300048910 Ga0496107_0147896 Ga0496107_0147896_777_1415 201
107 3300048918 Ga0496115_0283965 Ga0496115_0283965_314_952 201
108 3300048919 Ga0496116_0068905 Ga0496116_0068905_400_1032 201
109 3300048920 Ga0496117_0001576 Ga0496117_0001576_24342_24968 201
110 3300048920 Ga0496117_0031326 Ga0496117_0031326_425_1057 201
111 3300048921 Ga0496118_0013856 Ga0496118_0013856_1705_2337 201
112 3300048922 Ga0496119_0038566 Ga0496119_0038566_932_1570 201
113 3300048923 Ga0496120_0247259 Ga0496120_0247259_120_743 201
114 3300048924 Ga0496121_0038853 Ga0496121_0038853_449_1087 201
115 3300048924 Ga0496121_0108069 Ga0496121_0108069_639_1262 201
116 3300048929 Ga0496126_0092705 Ga0496126_0092705_571_1209 201
117 3300049586 Ga0501070_0000350 Ga0501070_0000350_30932_31570 201
118 3300053153 Ga0500616_0000078 Ga0500616_0000078_17295_17921 201
119 3300002067 JGI24735J21928_10002540 JGI24735J21928_100025402 202
120 3300003578 Ga0006562J51391_1093522 Ga0006562J51391_10935222 202
121 3300003578 Ga0006562J51391_1093523 Ga0006562J51391_10935234 202
122 3300044706 Ga0466964_0169038 Ga0466964_0169038_323_940 202
123 3300044765 Ga0466970_0048373 Ga0466970_0048373_1430_2047 202
124 3300048920 Ga0496117_0035590 Ga0496117_0035590_2268_2990 202
125 iso_pu_bacteria 2643221572 2643874796 202
126 iso_pu_bacteria 2643221669 2644381852 202
127 3300005327 Ga0070658_10037041 Ga0070658_100370412 203
128 3300005354 Ga0070675_100862549 Ga0070675_1008625491 203
129 3300005367 Ga0070667_100975780 Ga0070667_1009757801 203
130 3300005455 Ga0070663_100105886 Ga0070663_1001058862 203
131 3300005618 Ga0068864_100908503 Ga0068864_1009085031 203
132 3300005840 Ga0068870_10148559 Ga0068870_101485592 203
133 3300013104 Ga0157370_10208381 Ga0157370_102083812 203
134 3300020082 Ga0206353_10505610 Ga0206353_105056102 203
135 3300025253 Ga0209677_100720 Ga0209677_1007208 203
136 3300025901 Ga0207688_10025333 Ga0207688_100253333 203
137 3300025908 Ga0207643_10027041 Ga0207643_100270414 203
138 3300025909 Ga0207705_10030344 Ga0207705_100303442 203
139 3300025926 Ga0207659_10246485 Ga0207659_102464851 203
140 3300025935 Ga0207709_10245818 Ga0207709_102458182 203
141 3300025986 Ga0207658_10718378 Ga0207658_107183782 203
142 3300026067 Ga0207678_10282112 Ga0207678_102821122 203
143 3300026095 Ga0207676_10563214 Ga0207676_105632142 203
144 3300026121 Ga0207683_10147724 Ga0207683_101477241 203
145 3300031903 Ga0307407_10618388 Ga0307407_106183881 203
146 3300032002 Ga0307416_100294071 Ga0307416_1002940712 203
147 3300032004 Ga0307414_10239686 Ga0307414_102396861 203
148 3300032004 Ga0307414_10771500 Ga0307414_107715001 203
149 3300032004 Ga0307414_11268876 Ga0307414_112688761 203
150 3300032126 Ga0307415_101009973 Ga0307415_1010099732 203
151 3300037418 Ga0395900_0080023 Ga0395900_0080023_2088_2816 203
152 3300044658 Ga0466972_0028710 Ga0466972_0028710_223_909 203
153 3300044683 Ga0466965_0074310 Ga0466965_0074310_389_1075 203
154 3300044684 Ga0466966_0171926 Ga0466966_0171926_298_984 203
155 3300044735 Ga0466968_0034452 Ga0466968_0034452_1112_1798 203
156 3300044765 Ga0466970_0024474 Ga0466970_0024474_874_1560 203
157 3300044842 Ga0466957_0028694 Ga0466957_0028694_1894_2580 203
158 3300045836 Ga0466958_0091920 Ga0466958_0091920_166_852 203
159 3300046660 Ga0495625_0126482 Ga0495625_0126482_428_1054 203
160 3300048905 Ga0496102_0468715 Ga0496102_0468715_448_1059 203
161 3300048929 Ga0496126_0028098 Ga0496126_0028098_122_739 203
162 3300048929 Ga0496126_0126584 Ga0496126_0126584_602_1240 203
163 3300049571 Ga0501034_0002868 Ga0501034_0002868_16794_17420 203
164 3300049573 Ga0501037_0037409 Ga0501037_0037409_1435_2061 203
165 3300049579 Ga0501043_0007291 Ga0501043_0007291_8089_8715 203
166 3300049581 Ga0501047_0092416 Ga0501047_0092416_1889_2515 203
167 3300049586 Ga0501070_0000980 Ga0501070_0000980_8260_8886 203
168 3300049587 Ga0501071_0376610 Ga0501071_0376610_108_734 203
169 3300049589 Ga0501073_0140368 Ga0501073_0140368_482_1108 203
170 3300049742 Ga0501080_0006757 Ga0501080_0006757_1454_2080 203
171 3300049744 Ga0501083_0024986 Ga0501083_0024986_1301_1927 203
172 3300054114 Ga0501084_0194024 Ga0501084_0194024_892_1518 203
173 3300061719 Ga0466962_0039563 Ga0466962_0039563_1478_2164 203
174 iso_pu_bacteria 2895660088 2895662826 203
175 3300025230 Ga0209563_100923 Ga0209563_1009233 204
176 3300044683 Ga0466965_0000007 Ga0466965_0000007_14126_14752 204
177 3300046457 Ga0495590_0000122 Ga0495590_0000122_40241_40870 204
178 3300047472 Ga0495686_0110178 Ga0495686_0110178_772_1479 204
179 3300049570 Ga0501033_0032321 Ga0501033_0032321_1893_2519 204
180 3300053153 Ga0500616_0000302 Ga0500616_0000302_43471_44100 204
181 3300031456 Ga0307513_10427071 Ga0307513_104270712 205
182 3300041512 Ga0451853_4052207 Ga0451853_4052207_357_986 205
183 3300047472 Ga0495686_0097919 Ga0495686_0097919_988_1629 205
184 3300049571 Ga0501034_0074356 Ga0501034_0074356_957_1586 205
185 3300049571 Ga0501034_0265212 Ga0501034_0265212_112_741 205
186 3300049572 Ga0501036_0054818 Ga0501036_0054818_1018_1647 205
187 3300049579 Ga0501043_0383162 Ga0501043_0383162_263_892 205
188 3300049581 Ga0501047_0137083 Ga0501047_0137083_1436_2065 205
189 3300053139 Ga0500568_0000098 Ga0500568_0000098_25087_25731 205
190 iso_pu_bacteria 2721755702 2723643822 205
191 iso_pu_bacteria 2935409751 2935413479 205
192 3300005543 Ga0070672_100276058 Ga0070672_1002760582 206
193 3300009094 Ga0111539_10559565 Ga0111539_105595652 206
194 3300009148 Ga0105243_10087181 Ga0105243_100871812 206
195 3300011119 Ga0105246_10684368 Ga0105246_106843681 206
196 3300013308 Ga0157375_11626159 Ga0157375_116261591 206
197 3300025961 Ga0207712_10636673 Ga0207712_106366732 206
198 3300032002 Ga0307416_100458468 Ga0307416_1004584682 206
199 3300032004 Ga0307414_10292567 Ga0307414_102925672 206
200 3300032004 Ga0307414_10511893 Ga0307414_105118932 206
201 3300050511 nmdc:mga08y16_548594_c1 nmdc:mga08y16_548594_c1_222_842 206
202 iso_pu_bacteria 2643221613 2644081803 206
203 iso_pu_bacteria 2643221721 2644665154 206
204 iso_pu_bacteria 2935890801 2935891320 206
205 3300003320 rootH2_10100994 rootH2_101009942 207
206 iso_pu_bacteria 2643221575 2643888217 207
207 3300014325 Ga0163163_11410689 Ga0163163_114106891 208
208 iso_pu_bacteria 2643221566 2643847845 208
209 iso_pu_bacteria 2833709550 2833710008 209
210 3300041413 Ga0439465_0108667 Ga0439465_0108667_230_886 210
211 3300048903 Ga0496100_0612397 Ga0496100_0612397_173_823 210
212 3300048908 Ga0496105_0171011 Ga0496105_0171011_648_1298 210
213 3300048911 Ga0496108_0257542 Ga0496108_0257542_787_1437 210
214 3300048912 Ga0496109_0116822 Ga0496109_0116822_490_1140 210
215 3300048913 Ga0496110_0368926 Ga0496110_0368926_266_916 210
216 3300048915 Ga0496112_0455035 Ga0496112_0455035_500_1150 210
217 3300048916 Ga0496113_0067107 Ga0496113_0067107_2051_2701 210
218 3300048917 Ga0496114_0449330 Ga0496114_0449330_223_873 210
219 iso_pu_bacteria 2852632344 2852632768 210
220 3300044735 Ga0466968_0005408 Ga0466968_0005408_2966_3646 211
221 iso_pu_bacteria 8045830549 8045832302 211
222 3300001979 JGI24740J21852_10004355 JGI24740J21852_100043553 214
223 3300037418 Ga0395900_0388150 Ga0395900_0388150_539_1183 214
224 3300044765 Ga0466970_0000322 Ga0466970_0000322_7411_8055 214
225 3300045976 Ga0466967_0483351 Ga0466967_0483351_145_789 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

18

64

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8761 24 104
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.7304 24 174
6el2-assembly1.cif.gz_B safadr_lauroyl_coa complex 0.6647 23 177
3ljl-assembly1.cif.gz_A the crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633. 0.655 26 177
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.6435 24 174
ID Description Score Start End Superfamily
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9967 20 73 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9924 27 73 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9829 24 73 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9824 24 73 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9815 24 73 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7S8MYM6-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9454 19 129 GO:0000976
GO:0003700
AF-A0A4Q4CS65-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9201 17 146 GO:0000976
GO:0003700
AF-A0A1I3TCW4-F1-model_v4 Transcriptional regulator, TetR family 0.9187 21 139 GO:0000976
GO:0003700
AF-A0A4Q4CS65-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9003 17 146 GO:0000976
GO:0003700
AF-T1A6S9-F1-model_v4 TetR family transcriptional regulator 0.8651 4 165 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
88.79 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map