F337233

General Info

Members Datasets Scaffolds Average Seq Length
224 144 223 215

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0354840|Ga0530510_0354840_187_885
Length 232
Sequence MVTRSLIDASSPATLGAMKLNLTADEVLTTTRSVRKRLDFDRPVDRATVEECLEIAMQAPTGSNRQGWHWVVIEDEATRKAIADVYRANFEEYRAMPGAVYKDGDTRGERQDKVRDSAGYLSDNFHRAPLMLIPCIWGRLEPAHVNASAGFWGSLLPAVWSFMLALRERGMGSAWTTIHMMNDGEQQVAELLGIPYDKVSQAGLFPIAYTIGADFKPAKREPLENVLHWDRW

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
54 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
69 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
70 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
74 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
75 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
76 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.84
Nodule 0
Rhizoplane 6.7
Rhizosphere 68.75
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10083212 3300005295 Bacteria 10001
2 Ga0070658_11133374 3300005327 Bacteria 680
3 Ga0070683_100561771 3300005329 Bacteria 1091
4 Ga0070670_100000018 3300005331 Bacteria 221691
5 Ga0070666_10003919 3300005335 Bacteria 9041
6 Ga0070668_100100256 3300005347 Bacteria 2294
7 Ga0070671_100000044 3300005355 Bacteria 86204
8 Ga0070671_100000953 3300005355 Bacteria 21192
9 Ga0070671_100001261 3300005355 Bacteria 18971
10 Ga0070671_100273056 3300005355 Bacteria 1437
11 Ga0070667_100000002 3300005367 Bacteria 504831
12 Ga0070714_100008588 3300005435 Bacteria 7993
13 Ga0070685_10000003 3300005466 Bacteria 283138
14 Ga0070665_100000536 3300005548 Bacteria 53463
15 Ga0070665_100051855 3300005548 Bacteria 4114
16 Ga0070665_100108072 3300005548 Bacteria 2784
17 Ga0068859_100014576 3300005617 Bacteria 7895
18 Ga0068864_100000002 3300005618 Bacteria 658857
19 Ga0068861_100019307 3300005719 Bacteria 4870
20 Ga0068863_100028826 3300005841 Bacteria 5301
21 Ga0068860_100000757 3300005843 Bacteria 36483
22 Ga0068860_100003287 3300005843 Bacteria 16642
23 Ga0068860_100038735 3300005843 Bacteria 4561
24 Ga0068862_100001413 3300005844 Bacteria 22247
25 Ga0068862_100081000 3300005844 Bacteria 2816
26 Ga0081455_10000524 3300005937 Bacteria 49825
27 Ga0081455_10002336 3300005937 Bacteria 22640
28 Ga0081539_10007148 3300005985 Bacteria 10301
29 Ga0070717_10937442 3300006028 Bacteria 788
30 Ga0075365_10007585 3300006038 Bacteria 6092
31 Ga0075365_10015866 3300006038 Bacteria 4565
32 Ga0075365_10037204 3300006038 Bacteria 3158
33 Ga0075365_10169680 3300006038 Bacteria 1523
34 Ga0075365_10185287 3300006038 Bacteria 1456
35 Ga0075363_100163955 3300006048 Bacteria 1259
36 Ga0075364_10003773 3300006051 Bacteria 8661
37 Ga0075364_10029751 3300006051 Bacteria 3503
38 Ga0075364_10342940 3300006051 Bacteria 1018
39 Ga0075362_10250945 3300006177 Bacteria 870
40 Ga0075367_10040214 3300006178 Bacteria 2729
41 Ga0075367_10081228 3300006178 Bacteria 1961
42 Ga0075370_10396997 3300006353 Bacteria 827
43 Ga0097620_100014575 3300006931 Bacteria 7895
44 Ga0099794_10265801 3300007265 Bacteria 886
45 Ga0105250_10000005 3300009092 Bacteria 422580
46 Ga0105243_10590564 3300009148 Bacteria 1067
47 Ga0105249_10175405 3300009553 Bacteria 2082
48 Ga0163162_10217536 3300013306 Bacteria 2040
49 Ga0163162_11011744 3300013306 Bacteria 940
50 Ga0163163_10000128 3300014325 Bacteria 78848
51 Ga0157380_10663210 3300014326 Bacteria 1042
52 Ga0157379_10000311 3300014968 Bacteria 38664
53 Ga0207696_1000650 3300025711 Bacteria 25058
54 Ga0207680_10116316 3300025903 Bacteria 1742
55 Ga0207650_10000002 3300025925 Bacteria 1439222
56 Ga0207664_10008226 3300025929 Bacteria 7262
57 Ga0207644_10000080 3300025931 Bacteria 70312
58 Ga0207644_10008325 3300025931 Bacteria 6796
59 Ga0207644_10021585 3300025931 Bacteria 4389
60 Ga0207711_10000414 3300025941 Bacteria 45250
61 Ga0207711_10004302 3300025941 Bacteria 12164
62 Ga0207711_10005472 3300025941 Bacteria 10735
63 Ga0207712_10035070 3300025961 Bacteria 3404
64 Ga0207668_10082447 3300025972 Bacteria 2336
65 Ga0207668_10089139 3300025972 Bacteria 2261
66 Ga0207668_10242615 3300025972 Bacteria 1459
67 Ga0207658_10000001 3300025986 Bacteria 1439333
68 Ga0207641_10079149 3300026088 Bacteria 2848
69 Ga0207641_10102072 3300026088 Bacteria 2528
70 Ga0207676_10000001 3300026095 Bacteria 1439222
71 Ga0207675_100020886 3300026118 Bacteria 6105
72 Ga0207698_10552325 3300026142 Bacteria 1129
73 Ga0268266_10025000 3300028379 Bacteria 5083
74 Ga0268266_10752629 3300028379 Bacteria 940
75 Ga0268265_10001410 3300028380 Bacteria 20340
76 Ga0268265_10118460 3300028380 Bacteria 2177
77 Ga0268264_10000004 3300028381 Bacteria 1116842
78 Ga0268264_10010245 3300028381 Bacteria 7760
79 Ga0268264_10021145 3300028381 Bacteria 5315
80 Ga0307408_100261955 3300031548 Unclassified 1431
81 Ga0316579_10012599 3300031691 Bacteria 3622
82 Ga0316576_10000375 3300031727 Bacteria 20334
83 Ga0316576_10027708 3300031727 Bacteria 3985
84 Ga0316576_10040901 3300031727 Bacteria 3333
85 Ga0316576_10086726 3300031727 Bacteria 2328
86 Ga0316576_10177070 3300031727 Bacteria 1609
87 Ga0316576_10408876 3300031727 Bacteria 1005
88 Ga0316576_10595013 3300031727 Bacteria 808
89 Ga0316578_10024025 3300031728 Bacteria 3417
90 Ga0316578_10058393 3300031728 Bacteria 2268
91 Ga0307405_10098418 3300031731 Bacteria 1955
92 Ga0307405_10119537 3300031731 Bacteria 1801
93 Ga0307413_10038372 3300031824 Bacteria 2776
94 Ga0307413_10457975 3300031824 Bacteria 1014
95 Ga0307518_10122225 3300031838 Bacteria 1841
96 Ga0307410_10443919 3300031852 Bacteria 1057
97 Ga0307406_10035006 3300031901 Bacteria 3085
98 Ga0307407_10000466 3300031903 Bacteria 12391
99 Ga0307407_10046798 3300031903 Bacteria 2451
100 Ga0307407_10361579 3300031903 Bacteria 1031
101 Ga0307409_100176747 3300031995 Bacteria 1885
102 Ga0307409_100331423 3300031995 Bacteria 1428
103 Ga0307416_100766970 3300032002 Bacteria 1058
104 Ga0307414_10001028 3300032004 Bacteria 14250
105 Ga0307411_10217334 3300032005 Bacteria 1480
106 Ga0307415_100079363 3300032126 Bacteria 2338
107 Ga0307415_100191909 3300032126 Bacteria 1613
108 Ga0307415_100973531 3300032126 Bacteria 787
109 Ga0316574_0027120 3300035398 Bacteria 3449
110 Ga0316574_0035631 3300035398 Bacteria 3043
111 Ga0316574_0070966 3300035398 Bacteria 2199
112 Ga0316574_0311520 3300035398 Bacteria 1000
113 Ga0316582_0181245 3300036647 Bacteria 1433
114 Ga0316584_0066744 3300036712 Bacteria 2696
115 Ga0316584_0112830 3300036712 Bacteria 2034
116 Ga0316584_0123794 3300036712 Bacteria 1931
117 Ga0400483_084980 3300039062 Bacteria 13408
118 Ga0400483_114248 3300039062 Bacteria 15995
119 Ga0400483_245646 3300039062 Bacteria 1302
120 Ga0436365_1601215 3300039437 Bacteria 1698
121 Ga0439465_0030650 3300041413 Bacteria 1712
122 Ga0451807_1050739 3300041486 Bacteria 1200
123 Ga0451837_1354792 3300041494 Bacteria 1438
124 Ga0451841_0955250 3300041498 Bacteria 1017
125 Ga0451843_1451001 3300041509 Bacteria 815
126 Ga0451853_1872525 3300041512 Bacteria 1140
127 Ga0451853_2921270 3300041512 Bacteria 1148
128 Ga0451853_4101278 3300041512 Bacteria 1140
129 Ga0451577_0002082 3300042876 Bacteria 24635
130 Ga0453684_0151765 3300044712 Bacteria 2752
131 Ga0466968_0104235 3300044735 Bacteria 1269
132 Ga0466967_0216527 3300045976 Bacteria 1818
133 Ga0466967_1089642 3300045976 Bacteria 796
134 Ga0495641_0052264 3300046461 Bacteria 1863
135 Ga0495651_0159098 3300046462 Bacteria 1620
136 Ga0495653_0400596 3300046463 Bacteria 872
137 Ga0495667_0091440 3300046559 Bacteria 1971
138 Ga0495635_0242762 3300046663 Bacteria 1215
139 Ga0495602_0196001 3300048088 Bacteria 1545
140 Ga0496100_0004992 3300048903 Bacteria 7098
141 Ga0496101_0202679 3300048904 Bacteria 1534
142 Ga0496102_0000008 3300048905 Bacteria 417021
143 Ga0496102_0942724 3300048905 Unclassified 784
144 Ga0496103_0000033 3300048906 Bacteria 194019
145 Ga0496104_0044618 3300048907 Bacteria 4166
146 Ga0496105_0060086 3300048908 Bacteria 3136
147 Ga0496108_0140707 3300048911 Bacteria 2079
148 Ga0496109_0091577 3300048912 Bacteria 2812
149 Ga0496110_0343029 3300048913 Bacteria 1361
150 Ga0496110_0357722 3300048913 Bacteria 1330
151 Ga0496113_0440378 3300048916 Bacteria 1047
152 Ga0496114_0126243 3300048917 Bacteria 2206
153 Ga0496114_0778322 3300048917 Bacteria 835
154 Ga0496116_0000102 3300048919 Bacteria 193979
155 Ga0496117_0000026 3300048920 Bacteria 416644
156 Ga0496118_0000042 3300048921 Bacteria 287521
157 Ga0496119_0000694 3300048922 Bacteria 45053
158 Ga0496119_0337886 3300048922 Bacteria 733
159 Ga0496121_0016820 3300048924 Bacteria 7522
160 Ga0496124_0075840 3300048927 Bacteria 2777
161 Ga0496124_0161824 3300048927 Bacteria 1743
162 Ga0496125_0006538 3300048928 Bacteria 12561
163 Ga0496125_0027794 3300048928 Bacteria 5120
164 Ga0496126_0000054 3300048929 Bacteria 309327
165 Ga0496126_0050708 3300048929 Bacteria 3781
166 Ga0496126_0374594 3300048929 Bacteria 1160
167 Ga0501031_0479408 3300049568 Bacteria 803
168 Ga0501034_0240167 3300049571 Bacteria 1758
169 Ga0501036_0148395 3300049572 Bacteria 1978
170 Ga0501037_0148378 3300049573 Bacteria 1677
171 Ga0501038_0139309 3300049574 Bacteria 1986
172 Ga0501039_0034949 3300049575 Bacteria 3879
173 Ga0501039_0202965 3300049575 Bacteria 1559
174 Ga0501040_0075014 3300049576 Bacteria 2337
175 Ga0501040_0169669 3300049576 Bacteria 1545
176 Ga0501041_0180516 3300049577 Bacteria 1321
177 Ga0501042_0279332 3300049578 Bacteria 1206
178 Ga0501042_0373174 3300049578 Bacteria 1032
179 Ga0501047_0409739 3300049581 Bacteria 1188
180 Ga0501048_0049053 3300049582 Bacteria 3010
181 Ga0501069_0312772 3300049585 Bacteria 922
182 Ga0501071_0199180 3300049587 Bacteria 1504
183 Ga0501072_0156397 3300049588 Bacteria 1818
184 Ga0501073_0092047 3300049589 Bacteria 2108
185 Ga0501073_0227633 3300049589 Bacteria 1288
186 Ga0501073_0407573 3300049589 Bacteria 939
187 Ga0501074_0220599 3300049590 Bacteria 1350
188 Ga0501075_0087082 3300049591 Bacteria 2367
189 Ga0501075_0214448 3300049591 Bacteria 1468
190 Ga0501076_0398068 3300049592 Bacteria 1132
191 Ga0501076_0908821 3300049592 Bacteria 726
192 Ga0501077_0335672 3300049593 Bacteria 964
193 Ga0501081_0058800 3300049743 Bacteria 2661
194 nmdc:mga03683_252652_c1 3300050489 Bacteria 819
195 nmdc:mga00v17_145366_c1 3300050491 Bacteria 1522
196 nmdc:mga00v17_225764_c1 3300050491 Bacteria 1213
197 nmdc:mga00v17_51291_c1 3300050491 Bacteria 2509
198 nmdc:mga00v17_54406_c1 3300050491 Bacteria 2441
199 nmdc:mga0yw44_143019_c1 3300050492 Bacteria 1063
200 nmdc:mga0yw44_16305_c1 3300050492 Bacteria 4009
201 nmdc:mga0yw44_1811_c1 3300050492 Bacteria 8744
202 nmdc:mga0yw44_35632_c1 3300050492 Bacteria 2926
203 nmdc:mga0yw44_541542_c1 3300050492 Bacteria 790
204 nmdc:mga0yw44_62936_c1 3300050492 Bacteria 2280
205 nmdc:mga0k408_177168_c1 3300050493 Bacteria 1271
206 nmdc:mga06z11_110631_c1 3300050494 Bacteria 1520
207 nmdc:mga06z11_136400_c1 3300050494 Bacteria 1383
208 nmdc:mga07m45_98160_c2 3300050496 Bacteria 827
209 nmdc:mga0qj67_424656_c1 3300050509 Bacteria 1071
210 Ga0495601_0069123 3300053077 Bacteria 2252
211 Ga0495612_0043932 3300053078 Bacteria 1827
212 Ga0495595_0116457 3300053084 Bacteria 1299
213 Ga0495619_0173902 3300053085 Bacteria 1489
214 Ga0500568_0000094 3300053139 Bacteria 83123
215 Ga0500616_0058900 3300053153 Bacteria 1996
216 Ga0500599_001782 3300053736 Bacteria 2524
217 Ga0501084_0417110 3300054114 Bacteria 1135
218 Ga0501082_0063832 3300060353 Bacteria 3171
219 Ga0501082_0112463 3300060353 Bacteria 2358
220 Ga0501082_0471972 3300060353 Bacteria 1096
221 Ga0530510_0215191 3300061734 Bacteria 1428
222 Ga0530510_0269538 3300061734 Bacteria 1270
223 Ga0530510_0354840 3300061734 Bacteria 1102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0140707 Ga0496108_0140707_24_578 182
2 3300031731 Ga0307405_10098418 Ga0307405_100984183 183
3 3300031824 Ga0307413_10038372 Ga0307413_100383724 183
4 3300032004 Ga0307414_10001028 Ga0307414_1000102815 183
5 3300031838 Ga0307518_10122225 Ga0307518_101222252 191
6 3300031903 Ga0307407_10361579 Ga0307407_103615791 193
7 3300031995 Ga0307409_100176747 Ga0307409_1001767472 193
8 3300032126 Ga0307415_100079363 Ga0307415_1000793632 198
9 3300006353 Ga0075370_10396997 Ga0075370_103969971 201
10 3300050496 nmdc:mga07m45_98160_c2 nmdc:mga07m45_98160_c2_10_633 201
11 3300005435 Ga0070714_100008588 Ga0070714_1000085886 204
12 3300006028 Ga0070717_10937442 Ga0070717_109374422 204
13 3300025929 Ga0207664_10008226 Ga0207664_100082263 204
14 3300031901 Ga0307406_10035006 Ga0307406_100350064 204
15 3300032126 Ga0307415_100191909 Ga0307415_1001919092 204
16 3300035398 Ga0316574_0027120 Ga0316574_0027120_1001_1624 204
17 3300036712 Ga0316584_0112830 Ga0316584_0112830_1388_2011 204
18 3300049593 Ga0501077_0335672 Ga0501077_0335672_258_881 204
19 3300005937 Ga0081455_10000524 Ga0081455_1000052418 205
20 3300041498 Ga0451841_0955250 Ga0451841_0955250_120_749 205
21 3300049581 Ga0501047_0409739 Ga0501047_0409739_421_1050 206
22 3300005937 Ga0081455_10002336 Ga0081455_1000233615 207
23 3300039062 Ga0400483_245646 Ga0400483_245646_37_681 207
24 iso_pu_bacteria 8046352972 8046353882 207
25 3300031691 Ga0316579_10012599 Ga0316579_100125993 208
26 3300031727 Ga0316576_10027708 Ga0316576_100277085 208
27 3300031727 Ga0316576_10040901 Ga0316576_100409012 208
28 3300031727 Ga0316576_10595013 Ga0316576_105950131 208
29 3300031728 Ga0316578_10058393 Ga0316578_100583932 208
30 3300035398 Ga0316574_0070966 Ga0316574_0070966_1189_1833 208
31 3300036647 Ga0316582_0181245 Ga0316582_0181245_54_692 208
32 3300036712 Ga0316584_0123794 Ga0316584_0123794_1131_1775 208
33 3300041509 Ga0451843_1451001 Ga0451843_1451001_103_741 208
34 3300048916 Ga0496113_0440378 Ga0496113_0440378_240_914 208
35 3300053736 Ga0500599_001782 Ga0500599_001782_629_1264 208
36 3300005327 Ga0070658_11133374 Ga0070658_111333741 209
37 3300005329 Ga0070683_100561771 Ga0070683_1005617711 209
38 3300005355 Ga0070671_100000953 Ga0070671_10000095318 209
39 3300005548 Ga0070665_100000536 Ga0070665_10000053616 209
40 3300005841 Ga0068863_100028826 Ga0068863_1000288267 209
41 3300005843 Ga0068860_100003287 Ga0068860_10000328712 209
42 3300006051 Ga0075364_10342940 Ga0075364_103429401 209
43 3300025931 Ga0207644_10008325 Ga0207644_100083253 209
44 3300025972 Ga0207668_10089139 Ga0207668_100891392 209
45 3300026088 Ga0207641_10102072 Ga0207641_101020722 209
46 3300028381 Ga0268264_10010245 Ga0268264_100102456 209
47 3300031727 Ga0316576_10408876 Ga0316576_104088761 209
48 3300041413 Ga0439465_0030650 Ga0439465_0030650_175_816 209
49 3300046461 Ga0495641_0052264 Ga0495641_0052264_978_1619 209
50 3300048903 Ga0496100_0004992 Ga0496100_0004992_4543_5202 209
51 3300048904 Ga0496101_0202679 Ga0496101_0202679_197_856 209
52 3300048905 Ga0496102_0000008 Ga0496102_0000008_407909_408568 209
53 3300048906 Ga0496103_0000033 Ga0496103_0000033_8040_8699 209
54 3300048907 Ga0496104_0044618 Ga0496104_0044618_2795_3454 209
55 3300048908 Ga0496105_0060086 Ga0496105_0060086_836_1495 209
56 3300048919 Ga0496116_0000102 Ga0496116_0000102_185300_185959 209
57 3300048920 Ga0496117_0000026 Ga0496117_0000026_407895_408554 209
58 3300048921 Ga0496118_0000042 Ga0496118_0000042_185290_185949 209
59 3300048922 Ga0496119_0000694 Ga0496119_0000694_8069_8728 209
60 3300048924 Ga0496121_0016820 Ga0496121_0016820_4480_5139 209
61 3300048927 Ga0496124_0075840 Ga0496124_0075840_1336_1995 209
62 3300048928 Ga0496125_0006538 Ga0496125_0006538_8153_8812 209
63 3300048929 Ga0496126_0000054 Ga0496126_0000054_300253_300912 209
64 3300050491 nmdc:mga00v17_225764_c1 nmdc:mga00v17_225764_c1_50_691 209
65 3300050492 nmdc:mga0yw44_541542_c1 nmdc:mga0yw44_541542_c1_95_736 209
66 3300007265 Ga0099794_10265801 Ga0099794_102658012 210
67 3300009553 Ga0105249_10175405 Ga0105249_101754052 210
68 3300026142 Ga0207698_10552325 Ga0207698_105523252 210
69 3300031548 Ga0307408_100261955 Ga0307408_1002619552 210
70 3300031727 Ga0316576_10177070 Ga0316576_101770702 210
71 3300031903 Ga0307407_10000466 Ga0307407_100004665 210
72 3300049571 Ga0501034_0240167 Ga0501034_0240167_969_1652 210
73 3300006038 Ga0075365_10007585 Ga0075365_100075854 211
74 3300006038 Ga0075365_10015866 Ga0075365_100158663 211
75 3300006038 Ga0075365_10037204 Ga0075365_100372042 211
76 3300006038 Ga0075365_10185287 Ga0075365_101852872 211
77 3300006048 Ga0075363_100163955 Ga0075363_1001639552 211
78 3300006051 Ga0075364_10003773 Ga0075364_100037735 211
79 3300006051 Ga0075364_10029751 Ga0075364_100297512 211
80 3300006177 Ga0075362_10250945 Ga0075362_102509452 211
81 3300006178 Ga0075367_10040214 Ga0075367_100402143 211
82 3300006178 Ga0075367_10081228 Ga0075367_100812283 211
83 3300009092 Ga0105250_10000005 Ga0105250_10000005162 211
84 3300013306 Ga0163162_11011744 Ga0163162_110117442 211
85 3300014326 Ga0157380_10663210 Ga0157380_106632102 211
86 3300014968 Ga0157379_10000311 Ga0157379_1000031111 211
87 3300039062 Ga0400483_084980 Ga0400483_084980_11657_12322 211
88 3300039062 Ga0400483_114248 Ga0400483_114248_5950_6603 211
89 3300039437 Ga0436365_1601215 Ga0436365_1601215_925_1575 211
90 3300041494 Ga0451837_1354792 Ga0451837_1354792_423_1067 211
91 3300041512 Ga0451853_4101278 Ga0451853_4101278_425_1072 211
92 3300042876 Ga0451577_0002082 Ga0451577_0002082_15638_16285 211
93 3300044712 Ga0453684_0151765 Ga0453684_0151765_414_1061 211
94 3300044735 Ga0466968_0104235 Ga0466968_0104235_517_1158 211
95 3300045976 Ga0466967_0216527 Ga0466967_0216527_1038_1679 211
96 3300045976 Ga0466967_1089642 Ga0466967_1089642_64_711 211
97 3300046462 Ga0495651_0159098 Ga0495651_0159098_37_678 211
98 3300046463 Ga0495653_0400596 Ga0495653_0400596_215_856 211
99 3300046559 Ga0495667_0091440 Ga0495667_0091440_1128_1769 211
100 3300046663 Ga0495635_0242762 Ga0495635_0242762_198_839 211
101 3300048088 Ga0495602_0196001 Ga0495602_0196001_861_1517 211
102 3300049568 Ga0501031_0479408 Ga0501031_0479408_49_708 211
103 3300049572 Ga0501036_0148395 Ga0501036_0148395_593_1240 211
104 3300049573 Ga0501037_0148378 Ga0501037_0148378_216_875 211
105 3300049574 Ga0501038_0139309 Ga0501038_0139309_21_668 211
106 3300049575 Ga0501039_0034949 Ga0501039_0034949_2299_2946 211
107 3300049575 Ga0501039_0202965 Ga0501039_0202965_11_658 211
108 3300049576 Ga0501040_0075014 Ga0501040_0075014_440_1087 211
109 3300049576 Ga0501040_0169669 Ga0501040_0169669_674_1345 211
110 3300049577 Ga0501041_0180516 Ga0501041_0180516_361_1008 211
111 3300049578 Ga0501042_0279332 Ga0501042_0279332_147_794 211
112 3300049578 Ga0501042_0373174 Ga0501042_0373174_153_800 211
113 3300049582 Ga0501048_0049053 Ga0501048_0049053_849_1496 211
114 3300049587 Ga0501071_0199180 Ga0501071_0199180_829_1476 211
115 3300049588 Ga0501072_0156397 Ga0501072_0156397_1067_1714 211
116 3300049590 Ga0501074_0220599 Ga0501074_0220599_275_922 211
117 3300049591 Ga0501075_0087082 Ga0501075_0087082_503_1150 211
118 3300049591 Ga0501075_0214448 Ga0501075_0214448_64_711 211
119 3300049592 Ga0501076_0398068 Ga0501076_0398068_206_853 211
120 3300049592 Ga0501076_0908821 Ga0501076_0908821_67_714 211
121 3300049743 Ga0501081_0058800 Ga0501081_0058800_1088_1735 211
122 3300050489 nmdc:mga03683_252652_c1 nmdc:mga03683_252652_c1_127_774 211
123 3300050491 nmdc:mga00v17_145366_c1 nmdc:mga00v17_145366_c1_100_747 211
124 3300050491 nmdc:mga00v17_51291_c1 nmdc:mga00v17_51291_c1_370_1017 211
125 3300050491 nmdc:mga00v17_54406_c1 nmdc:mga00v17_54406_c1_1726_2373 211
126 3300050492 nmdc:mga0yw44_143019_c1 nmdc:mga0yw44_143019_c1_24_671 211
127 3300050492 nmdc:mga0yw44_16305_c1 nmdc:mga0yw44_16305_c1_1721_2368 211
128 3300050492 nmdc:mga0yw44_1811_c1 nmdc:mga0yw44_1811_c1_1632_2279 211
129 3300050492 nmdc:mga0yw44_35632_c1 nmdc:mga0yw44_35632_c1_175_822 211
130 3300050492 nmdc:mga0yw44_62936_c1 nmdc:mga0yw44_62936_c1_752_1399 211
131 3300050494 nmdc:mga06z11_110631_c1 nmdc:mga06z11_110631_c1_691_1338 211
132 3300050494 nmdc:mga06z11_136400_c1 nmdc:mga06z11_136400_c1_131_778 211
133 3300050509 nmdc:mga0qj67_424656_c1 nmdc:mga0qj67_424656_c1_353_1000 211
134 3300053077 Ga0495601_0069123 Ga0495601_0069123_888_1529 211
135 3300053078 Ga0495612_0043932 Ga0495612_0043932_57_698 211
136 3300053084 Ga0495595_0116457 Ga0495595_0116457_450_1091 211
137 3300053085 Ga0495619_0173902 Ga0495619_0173902_577_1218 211
138 3300053153 Ga0500616_0058900 Ga0500616_0058900_126_767 211
139 3300054114 Ga0501084_0417110 Ga0501084_0417110_287_958 211
140 3300060353 Ga0501082_0063832 Ga0501082_0063832_158_805 211
141 3300060353 Ga0501082_0112463 Ga0501082_0112463_850_1497 211
142 3300061734 Ga0530510_0215191 Ga0530510_0215191_133_780 211
143 3300061734 Ga0530510_0269538 Ga0530510_0269538_528_1175 211
144 3300061734 Ga0530510_0354840 Ga0530510_0354840_187_885 211
145 3300005347 Ga0070668_100100256 Ga0070668_1001002562 212
146 3300005355 Ga0070671_100273056 Ga0070671_1002730562 212
147 3300005719 Ga0068861_100019307 Ga0068861_1000193075 212
148 3300005843 Ga0068860_100038735 Ga0068860_1000387354 212
149 3300005844 Ga0068862_100081000 Ga0068862_1000810003 212
150 3300005985 Ga0081539_10007148 Ga0081539_1000714810 212
151 3300006038 Ga0075365_10169680 Ga0075365_101696801 212
152 3300009148 Ga0105243_10590564 Ga0105243_105905641 212
153 3300025961 Ga0207712_10035070 Ga0207712_100350703 212
154 3300025972 Ga0207668_10082447 Ga0207668_100824472 212
155 3300025972 Ga0207668_10242615 Ga0207668_102426152 212
156 3300026118 Ga0207675_100020886 Ga0207675_1000208862 212
157 3300028380 Ga0268265_10118460 Ga0268265_101184603 212
158 3300028381 Ga0268264_10021145 Ga0268264_100211454 212
159 3300031727 Ga0316576_10000375 Ga0316576_100003752 212
160 3300031728 Ga0316578_10024025 Ga0316578_100240254 212
161 3300031731 Ga0307405_10119537 Ga0307405_101195372 212
162 3300031824 Ga0307413_10457975 Ga0307413_104579752 212
163 3300031852 Ga0307410_10443919 Ga0307410_104439191 212
164 3300031903 Ga0307407_10046798 Ga0307407_100467984 212
165 3300031995 Ga0307409_100331423 Ga0307409_1003314232 212
166 3300032002 Ga0307416_100766970 Ga0307416_1007669703 212
167 3300032005 Ga0307411_10217334 Ga0307411_102173341 212
168 3300035398 Ga0316574_0035631 Ga0316574_0035631_746_1396 212
169 3300036712 Ga0316584_0066744 Ga0316584_0066744_1145_1795 212
170 3300041486 Ga0451807_1050739 Ga0451807_1050739_469_1113 212
171 3300041512 Ga0451853_1872525 Ga0451853_1872525_35_679 212
172 3300041512 Ga0451853_2921270 Ga0451853_2921270_190_840 212
173 3300048905 Ga0496102_0942724 Ga0496102_0942724_84_722 212
174 3300048913 Ga0496110_0343029 Ga0496110_0343029_575_1237 212
175 3300048913 Ga0496110_0357722 Ga0496110_0357722_62_700 212
176 3300048917 Ga0496114_0778322 Ga0496114_0778322_53_715 212
177 3300048922 Ga0496119_0337886 Ga0496119_0337886_56_718 212
178 3300048929 Ga0496126_0374594 Ga0496126_0374594_425_1063 212
179 3300049585 Ga0501069_0312772 Ga0501069_0312772_53_706 212
180 3300049589 Ga0501073_0227633 Ga0501073_0227633_346_996 212
181 3300049589 Ga0501073_0407573 Ga0501073_0407573_208_858 212
182 3300050493 nmdc:mga0k408_177168_c1 nmdc:mga0k408_177168_c1_437_1126 212
183 3300060353 Ga0501082_0471972 Ga0501082_0471972_66_716 212
184 3300005355 Ga0070671_100001261 Ga0070671_1000012615 214
185 3300025931 Ga0207644_10021585 Ga0207644_100215854 214
186 3300032126 Ga0307415_100973531 Ga0307415_1009735311 214
187 3300048917 Ga0496114_0126243 Ga0496114_0126243_396_1046 214
188 3300049589 Ga0501073_0092047 Ga0501073_0092047_204_860 214
189 3300053139 Ga0500568_0000094 Ga0500568_0000094_1651_2310 214
190 3300005295 Ga0065707_10083212 Ga0065707_100832125 215
191 3300005331 Ga0070670_100000018 Ga0070670_100000018122 215
192 3300005335 Ga0070666_10003919 Ga0070666_100039195 215
193 3300005355 Ga0070671_100000044 Ga0070671_10000004465 215
194 3300005367 Ga0070667_100000002 Ga0070667_10000000261 215
195 3300005466 Ga0070685_10000003 Ga0070685_1000000353 215
196 3300005548 Ga0070665_100051855 Ga0070665_1000518553 215
197 3300005548 Ga0070665_100108072 Ga0070665_1001080723 215
198 3300005617 Ga0068859_100014576 Ga0068859_1000145762 215
199 3300005618 Ga0068864_100000002 Ga0068864_100000002419 215
200 3300005843 Ga0068860_100000757 Ga0068860_10000075712 215
201 3300005844 Ga0068862_100001413 Ga0068862_10000141314 215
202 3300006931 Ga0097620_100014575 Ga0097620_1000145757 215
203 3300013306 Ga0163162_10217536 Ga0163162_102175362 215
204 3300014325 Ga0163163_10000128 Ga0163163_1000012824 215
205 3300025711 Ga0207696_1000650 Ga0207696_100065012 215
206 3300025903 Ga0207680_10116316 Ga0207680_101163162 215
207 3300025925 Ga0207650_10000002 Ga0207650_10000002415 215
208 3300025931 Ga0207644_10000080 Ga0207644_1000008044 215
209 3300025941 Ga0207711_10000414 Ga0207711_1000041439 215
210 3300025941 Ga0207711_10004302 Ga0207711_100043023 215
211 3300025941 Ga0207711_10005472 Ga0207711_100054726 215
212 3300025986 Ga0207658_10000001 Ga0207658_10000001937 215
213 3300026088 Ga0207641_10079149 Ga0207641_100791492 215
214 3300026095 Ga0207676_10000001 Ga0207676_10000001415 215
215 3300028379 Ga0268266_10025000 Ga0268266_100250006 215
216 3300028379 Ga0268266_10752629 Ga0268266_107526292 215
217 3300028380 Ga0268265_10001410 Ga0268265_1000141011 215
218 3300028381 Ga0268264_10000004 Ga0268264_10000004428 215
219 3300031727 Ga0316576_10086726 Ga0316576_100867262 215
220 3300035398 Ga0316574_0311520 Ga0316574_0311520_188_868 215
221 3300048912 Ga0496109_0091577 Ga0496109_0091577_226_879 215
222 3300048927 Ga0496124_0161824 Ga0496124_0161824_1069_1716 215
223 3300048928 Ga0496125_0027794 Ga0496125_0027794_802_1449 215
224 3300048929 Ga0496126_0050708 Ga0496126_0050708_158_805 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

28

209

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8496 8 193
6q1l-assembly1.cif.gz_B crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine 0.8433 9 215
6q1l-assembly1.cif.gz_B crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine 0.8391 9 215
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8257 8 199
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.817 12 215
ID Description Score Start End Superfamily
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9042 9 213 3.40.109.10
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8916 9 213 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8013 11 193 3.40.109.10
3e39B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7945 6 215 3.40.109.10
3e10B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7902 13 215 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A6I3IIB3-F1-model_v4 Nitroreductase 0.9785 16 215 GO:0016491
AF-A0A6J7K9N0-F1-model_v4 Unannotated protein 0.9772 11 215 GO:0016491
AF-A0A7Y5P6Y2-F1-model_v4 deleted 0.9659 3 215
AF-A0A1B1ZUN0-F1-model_v4 Nitroreductase domain-containing protein 0.9557 97 215 GO:0016491
AF-A0A7Y5P6Y2-F1-model_v4 deleted 0.9526 3 215

Feature Viewer

pLDDT pTM Quality
91.61 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map