F337171

General Info

Members Datasets Scaffolds Average Seq Length
224 135 219 137

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0218070|Ga0501034_0218070_654_1076
Length 140
Sequence VEKNPTSLPALIVVAAALVDADGRVLLQQRAPHRKMAGLWEFPGGKLEPGETPEEALIRELEEELGIQTESACLAPAAFASHRLDDDSHLILLLYVCRKWRGTPRPLDASGLTWVRPQQMFSLAMPPADKPLIGLLDALL

Samples

Sample ID Description Type Environment
1 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
83 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
109 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
110 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
111 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
112 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
113 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
114 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
115 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
116 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
117 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
118 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
119 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
120 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
125 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
126 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
127 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
128 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
135 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0
Rhizoplane 0.45
Rhizosphere 75.45
Stem 0
Stem Tuber 0
Unclassified 9.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1000334 3300002076 Bacteria 7114
2 Ga0055536_1002809 3300003781 Bacteria 9617
3 Ga0055534_1010483 3300003784 Bacteria 1939
4 Ga0055530_10000149 3300003791 Bacteria 63152
5 Ga0055530_10080671 3300003791 Unclassified 684
6 Ga0055531_10002722 3300003794 Bacteria 11629
7 Ga0065707_10086128 3300005295 Bacteria 5648
8 Ga0070670_100000082 3300005331 Bacteria 91524
9 Ga0070670_100000987 3300005331 Bacteria 22339
10 Ga0070666_10019328 3300005335 Bacteria 4397
11 Ga0070666_10201847 3300005335 Bacteria 1399
12 Ga0070668_100000018 3300005347 Bacteria 99142
13 Ga0070668_100000157 3300005347 Bacteria 43332
14 Ga0070668_100007745 3300005347 Bacteria 7973
15 Ga0070668_100007774 3300005347 Bacteria 7960
16 Ga0070669_100000015 3300005353 Bacteria 197597
17 Ga0070669_100080818 3300005353 Bacteria 2420
18 Ga0070671_100000134 3300005355 Bacteria 47424
19 Ga0070671_100000189 3300005355 Bacteria 41536
20 Ga0070667_100000003 3300005367 Bacteria 447715
21 Ga0070667_100003633 3300005367 Bacteria 13128
22 Ga0068867_102149867 3300005459 Bacteria 529
23 Ga0070679_101418660 3300005530 Bacteria 641
24 Ga0070665_100079057 3300005548 Bacteria 3295
25 Ga0070665_100240498 3300005548 Bacteria 1811
26 Ga0070665_100705230 3300005548 Bacteria 1022
27 Ga0068855_100249736 3300005563 Bacteria 1979
28 Ga0068855_100450124 3300005563 Bacteria 1405
29 Ga0068854_100276492 3300005578 Bacteria 1350
30 Ga0068859_100084792 3300005617 Bacteria 3213
31 Ga0068859_100087170 3300005617 Bacteria 3169
32 Ga0068859_100222720 3300005617 Bacteria 1974
33 Ga0068864_100000590 3300005618 Bacteria 30911
34 Ga0068864_100000611 3300005618 Bacteria 30197
35 Ga0068861_100142061 3300005719 Bacteria 1960
36 Ga0068863_100000030 3300005841 Bacteria 176023
37 Ga0068863_100004086 3300005841 Bacteria 14419
38 Ga0068863_100005477 3300005841 Bacteria 12502
39 Ga0068858_100039945 3300005842 Bacteria 4351
40 Ga0068860_100000068 3300005843 Bacteria 179208
41 Ga0068860_100008557 3300005843 Bacteria 10197
42 Ga0068860_100024210 3300005843 Bacteria 5870
43 Ga0068862_100000006 3300005844 Bacteria 346828
44 Ga0068862_100000158 3300005844 Bacteria 75829
45 Ga0068862_100000553 3300005844 Bacteria 39108
46 Ga0068862_100088985 3300005844 Bacteria 2687
47 Ga0068862_100344775 3300005844 Bacteria 1380
48 Ga0068862_101049031 3300005844 Bacteria 808
49 Ga0081539_10027394 3300005985 Bacteria 3611
50 Ga0081539_10029151 3300005985 Bacteria 3455
51 Ga0075370_10098283 3300006353 Bacteria 1693
52 Ga0097620_100045053 3300006931 Bacteria 4432
53 Ga0097620_100084792 3300006931 Bacteria 3213
54 Ga0097620_100087172 3300006931 Bacteria 3169
55 Ga0097620_100222715 3300006931 Bacteria 1974
56 Ga0105247_10006293 3300009101 Bacteria 7357
57 Ga0105248_10005555 3300009177 Bacteria 13855
58 Ga0105248_10213933 3300009177 Bacteria 2171
59 Ga0105248_10222080 3300009177 Bacteria 2127
60 Ga0105249_10001047 3300009553 Bacteria 24478
61 Ga0105249_10040572 3300009553 Bacteria 4228
62 Ga0105239_10924910 3300010375 Bacteria 1001
63 Ga0157370_10197665 3300013104 Bacteria 1866
64 Ga0157369_10006534 3300013105 Bacteria 13501
65 Ga0163162_11432273 3300013306 Bacteria 786
66 Ga0163163_12618016 3300014325 Bacteria 562
67 Ga0157380_10004403 3300014326 Bacteria 9760
68 Ga0157379_10617443 3300014968 Bacteria 1013
69 Ga0213874_10023856 3300021377 Bacteria 1710
70 Ga0213874_10104810 3300021377 Bacteria 944
71 Ga0213875_10009862 3300021388 Bacteria 4814
72 Ga0207425_1028854 3300025245 Bacteria 1122
73 Ga0209676_1000155 3300025292 Bacteria 165151
74 Ga0209050_1001595 3300025298 Bacteria 23432
75 Ga0209050_1013805 3300025298 Bacteria 3549
76 Ga0209257_1000169 3300025304 Bacteria 171227
77 Ga0207680_10107419 3300025903 Bacteria 1804
78 Ga0207680_10171928 3300025903 Bacteria 1460
79 Ga0207681_10000001 3300025923 Bacteria 1105841
80 Ga0207681_10074742 3300025923 Bacteria 2375
81 Ga0207681_10353899 3300025923 Bacteria 1176
82 Ga0207681_10359386 3300025923 Bacteria 1167
83 Ga0207681_11540189 3300025923 Bacteria 557
84 Ga0207650_10000050 3300025925 Bacteria 169589
85 Ga0207650_10001152 3300025925 Bacteria 19412
86 Ga0207650_10121268 3300025925 Bacteria 2036
87 Ga0207644_10000096 3300025931 Bacteria 63618
88 Ga0207644_10000160 3300025931 Bacteria 49009
89 Ga0207711_10001368 3300025941 Bacteria 22973
90 Ga0207711_10051424 3300025941 Bacteria 3528
91 Ga0207711_10281629 3300025941 Bacteria 1531
92 Ga0207667_10027821 3300025949 Bacteria 6148
93 Ga0207667_10442668 3300025949 Bacteria 1321
94 Ga0207712_10000754 3300025961 Bacteria 24470
95 Ga0207712_11365587 3300025961 Bacteria 634
96 Ga0207668_10000045 3300025972 Bacteria 103160
97 Ga0207668_10000082 3300025972 Bacteria 71860
98 Ga0207668_10008192 3300025972 Bacteria 6224
99 Ga0207668_10017957 3300025972 Bacteria 4441
100 Ga0207640_10296223 3300025981 Bacteria 1278
101 Ga0207658_10000002 3300025986 Bacteria 1364188
102 Ga0207658_10001979 3300025986 Bacteria 15290
103 Ga0207703_10000862 3300026035 Bacteria 29697
104 Ga0207641_10000001 3300026088 Bacteria 1180841
105 Ga0207641_10000277 3300026088 Bacteria 64441
106 Ga0207641_10018526 3300026088 Bacteria 5709
107 Ga0207641_10020991 3300026088 Bacteria 5369
108 Ga0207641_11227240 3300026088 Bacteria 750
109 Ga0207676_10000004 3300026095 Bacteria 725417
110 Ga0207676_10002101 3300026095 Bacteria 14423
111 Ga0207674_10784872 3300026116 Bacteria 919
112 Ga0207675_100000295 3300026118 Bacteria 48065
113 Ga0207675_100150221 3300026118 Bacteria 2217
114 Ga0207698_10233857 3300026142 Bacteria 1670
115 Ga0209974_10121085 3300027876 Bacteria 927
116 Ga0268266_10084595 3300028379 Bacteria 2770
117 Ga0268266_11072881 3300028379 Bacteria 779
118 Ga0268265_10000002 3300028380 Bacteria 1035381
119 Ga0268265_10000863 3300028380 Bacteria 28360
120 Ga0268265_10002804 3300028380 Bacteria 12834
121 Ga0268265_10102595 3300028380 Bacteria 2314
122 Ga0268265_10525374 3300028380 Unclassified 1119
123 Ga0268264_10000103 3300028381 Bacteria 222439
124 Ga0268264_10005457 3300028381 Bacteria 10777
125 Ga0268264_10051483 3300028381 Bacteria 3431
126 Ga0307513_10206581 3300031456 Bacteria 1799
127 Ga0307408_100096394 3300031548 Bacteria 2244
128 Ga0307405_10049434 3300031731 Bacteria 2599
129 Ga0307413_11763662 3300031824 Bacteria 553
130 Ga0307406_10043429 3300031901 Bacteria 2811
131 Ga0307406_10052217 3300031901 Bacteria 2599
132 Ga0307412_10000374 3300031911 Bacteria 27876
133 Ga0307412_10120880 3300031911 Bacteria 1885
134 Ga0307416_100086067 3300032002 Bacteria 2678
135 Ga0307414_10000144 3300032004 Bacteria 48442
136 Ga0307414_10000204 3300032004 Bacteria 39795
137 Ga0307414_10001310 3300032004 Bacteria 12846
138 Ga0307414_10024881 3300032004 Bacteria 3825
139 Ga0307414_10105658 3300032004 Bacteria 2129
140 Ga0307414_10319024 3300032004 Bacteria 1322
141 Ga0307414_10596389 3300032004 Bacteria 990
142 Ga0395905_0233607 3300037471 Bacteria 1719
143 Ga0436364_0024756 3300037853 Bacteria 185423
144 Ga0436363_1340139 3300039450 Bacteria 1569
145 Ga0436363_1455987 3300039450 Bacteria 582
146 Ga0436363_1469920 3300039450 Bacteria 1814
147 Ga0439461_0036024 3300041410 Bacteria 1052
148 Ga0451791_0759008 3300041451 Bacteria 897
149 Ga0451843_0637931 3300041509 Bacteria 1031
150 Ga0466973_0256329 3300044659 Bacteria 1224
151 Ga0466968_0027833 3300044735 Bacteria 2327
152 Ga0466968_0066687 3300044735 Bacteria 1559
153 Ga0466970_0430200 3300044765 Bacteria 755
154 Ga0495590_0178989 3300046457 Bacteria 775
155 Ga0495638_0016606 3300046460 Bacteria 4926
156 Ga0495607_0017292 3300046501 Bacteria 4633
157 Ga0495606_0064732 3300046507 Bacteria 2325
158 Ga0495654_0038575 3300046530 Bacteria 2388
159 Ga0495654_0073397 3300046530 Bacteria 1618
160 Ga0495668_0000002 3300046616 Bacteria 763179
161 Ga0495625_0000281 3300046660 Bacteria 79314
162 Ga0495681_0134047 3300047470 Bacteria 1052
163 Ga0495686_0000280 3300047472 Bacteria 90032
164 Ga0495686_0009528 3300047472 Bacteria 6987
165 Ga0495686_0126465 3300047472 Bacteria 1519
166 Ga0495686_0186785 3300047472 Bacteria 1197
167 Ga0495686_0192160 3300047472 Bacteria 1176
168 Ga0496117_0035482 3300048920 Bacteria 3742
169 Ga0496118_0003914 3300048921 Bacteria 18229
170 Ga0496121_0165994 3300048924 Bacteria 1609
171 Ga0496123_0307758 3300048926 Bacteria 753
172 Ga0496124_0100403 3300048927 Bacteria 2346
173 Ga0496124_0493052 3300048927 Bacteria 824
174 Ga0496124_0879944 3300048927 Bacteria 546
175 Ga0496125_0131899 3300048928 Bacteria 1757
176 Ga0496126_0750892 3300048929 Bacteria 753
177 Ga0501293_002761 3300049516 Bacteria 1340
178 Ga0501034_0218070 3300049571 Bacteria 1861
179 Ga0501034_0447144 3300049571 Bacteria 1210
180 Ga0501043_0071837 3300049579 Bacteria 2718
181 Ga0501046_0467476 3300049580 Bacteria 906
182 Ga0501047_0035623 3300049581 Bacteria 4807
183 Ga0501047_0741092 3300049581 Unclassified 799
184 Ga0501048_0175816 3300049582 Bacteria 1517
185 Ga0501223_000070 3300049663 Bacteria 31069
186 Ga0501224_000012 3300049664 Bacteria 92585
187 Ga0501233_002559 3300049668 Bacteria 3212
188 Ga0501235_023213 3300049669 Bacteria 1382
189 Ga0501249_001919 3300049679 Bacteria 4225
190 Ga0501257_000067 3300049686 Bacteria 28497
191 Ga0501225_0000019 3300049705 Bacteria 59374
192 Ga0501229_044063 3300049706 Bacteria 643
193 Ga0501234_009850 3300049707 Bacteria 1491
194 Ga0501282_003404 3300049778 Bacteria 1714
195 Ga0501204_003755 3300049850 Bacteria 1613
196 Ga0501226_000064 3300049853 Bacteria 35696
197 Ga0501284_02254 3300050005 Bacteria 1059
198 nmdc:mga03683_187381_c1 3300050489 Bacteria 946
199 nmdc:mga03n38_664871_c1 3300050490 Bacteria 598
200 nmdc:mga0qj67_21757_c1 3300050509 Bacteria 4920
201 Ga0500643_000260 3300053087 Bacteria 47191
202 Ga0500643_003053 3300053087 Bacteria 8256
203 Ga0500643_092148 3300053087 Bacteria 826
204 Ga0500641_0009228 3300053096 Bacteria 3542
205 Ga0500650_0518956 3300053098 Bacteria 505
206 Ga0500592_000195 3300053116 Bacteria 11538
207 Ga0500592_006138 3300053116 Bacteria 1914
208 Ga0500652_317196 3300053131 Bacteria 598
209 Ga0500658_0336106 3300053134 Bacteria 694
210 Ga0500559_0021972 3300053136 Bacteria 2706
211 Ga0500559_0105602 3300053136 Bacteria 1301
212 Ga0500568_0001615 3300053139 Bacteria 14250
213 Ga0500604_0141909 3300053151 Bacteria 812
214 Ga0500616_0012599 3300053153 Bacteria 4946
215 Ga0500616_0015194 3300053153 Bacteria 4407
216 Ga0500627_0000015 3300053158 Bacteria 132947
217 Ga0500627_0000144 3300053158 Bacteria 20890
218 Ga0500627_0037844 3300053158 Bacteria 2060
219 Ga0500645_001058 3300053730 Bacteria 15269

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10197665 Ga0157370_101976652 127
2 3300032004 Ga0307414_10024881 Ga0307414_100248813 127
3 3300050005 Ga0501284_02254 Ga0501284_02254_523_909 128
4 3300005548 Ga0070665_100079057 Ga0070665_1000790572 129
5 3300009177 Ga0105248_10213933 Ga0105248_102139333 129
6 3300009177 Ga0105248_10222080 Ga0105248_102220804 129
7 3300009553 Ga0105249_10040572 Ga0105249_100405725 129
8 3300021388 Ga0213875_10009862 Ga0213875_100098624 129
9 3300037853 Ga0436364_0024756 Ga0436364_0024756_168784_169188 129
10 3300053136 Ga0500559_0105602 Ga0500559_0105602_672_1082 129
11 3300010375 Ga0105239_10924910 Ga0105239_109249102 130
12 3300021377 Ga0213874_10023856 Ga0213874_100238562 130
13 3300026116 Ga0207674_10784872 Ga0207674_107848721 130
14 3300039450 Ga0436363_1455987 Ga0436363_1455987_21_413 130
15 3300039450 Ga0436363_1469920 Ga0436363_1469920_252_644 130
16 3300046457 Ga0495590_0178989 Ga0495590_0178989_208_600 130
17 3300046501 Ga0495607_0017292 Ga0495607_0017292_1067_1486 130
18 3300048927 Ga0496124_0493052 Ga0496124_0493052_76_468 130
19 3300049663 Ga0501223_000070 Ga0501223_000070_24623_25015 130
20 3300049664 Ga0501224_000012 Ga0501224_000012_34370_34762 130
21 3300049705 Ga0501225_0000019 Ga0501225_0000019_34314_34706 130
22 3300049706 Ga0501229_044063 Ga0501229_044063_94_486 130
23 3300049707 Ga0501234_009850 Ga0501234_009850_94_486 130
24 3300049778 Ga0501282_003404 Ga0501282_003404_72_464 130
25 3300049853 Ga0501226_000064 Ga0501226_000064_1218_1610 130
26 3300050489 nmdc:mga03683_187381_c1 nmdc:mga03683_187381_c1_340_732 130
27 3300053087 Ga0500643_092148 Ga0500643_092148_374_766 130
28 3300053098 Ga0500650_0518956 Ga0500650_0518956_35_427 130
29 3300005985 Ga0081539_10029151 Ga0081539_100291516 131
30 3300014968 Ga0157379_10617443 Ga0157379_106174432 131
31 3300050509 nmdc:mga0qj67_21757_c1 nmdc:mga0qj67_21757_c1_83_496 131
32 iso_pu_bacteria 2643221605 2644037067 131
33 3300005347 Ga0070668_100000018 Ga0070668_10000001814 132
34 3300005355 Ga0070671_100000189 Ga0070671_10000018937 132
35 3300005459 Ga0068867_102149867 Ga0068867_1021498671 132
36 3300005617 Ga0068859_100222720 Ga0068859_1002227204 132
37 3300005841 Ga0068863_100000030 Ga0068863_100000030151 132
38 3300005843 Ga0068860_100024210 Ga0068860_1000242105 132
39 3300005844 Ga0068862_100344775 Ga0068862_1003447753 132
40 3300006931 Ga0097620_100222715 Ga0097620_1002227154 132
41 3300013105 Ga0157369_10006534 Ga0157369_1000653416 132
42 3300021377 Ga0213874_10104810 Ga0213874_101048102 132
43 3300025923 Ga0207681_10353899 Ga0207681_103538992 132
44 3300025931 Ga0207644_10000096 Ga0207644_1000009638 132
45 3300025972 Ga0207668_10000082 Ga0207668_1000008269 132
46 3300026088 Ga0207641_10000001 Ga0207641_10000001132 132
47 3300028379 Ga0268266_10084595 Ga0268266_100845952 132
48 3300028380 Ga0268265_10525374 Ga0268265_105253742 132
49 3300028381 Ga0268264_10005457 Ga0268264_1000545711 132
50 3300031548 Ga0307408_100096394 Ga0307408_1000963945 132
51 3300031731 Ga0307405_10049434 Ga0307405_100494345 132
52 3300031901 Ga0307406_10052217 Ga0307406_100522175 132
53 3300032002 Ga0307416_100086067 Ga0307416_1000860675 132
54 3300039450 Ga0436363_1340139 Ga0436363_1340139_156_560 132
55 3300041410 Ga0439461_0036024 Ga0439461_0036024_385_792 132
56 3300046507 Ga0495606_0064732 Ga0495606_0064732_1096_1494 132
57 3300046530 Ga0495654_0038575 Ga0495654_0038575_397_819 132
58 3300047472 Ga0495686_0000280 Ga0495686_0000280_45900_46298 132
59 3300047472 Ga0495686_0186785 Ga0495686_0186785_260_658 132
60 3300047472 Ga0495686_0192160 Ga0495686_0192160_662_1069 132
61 3300049516 Ga0501293_002761 Ga0501293_002761_115_537 132
62 3300049580 Ga0501046_0467476 Ga0501046_0467476_407_814 132
63 3300049581 Ga0501047_0741092 Ga0501047_0741092_303_710 132
64 3300049686 Ga0501257_000067 Ga0501257_000067_28024_28446 132
65 3300053087 Ga0500643_000260 Ga0500643_000260_26485_26907 132
66 3300053116 Ga0500592_000195 Ga0500592_000195_8954_9376 132
67 3300053134 Ga0500658_0336106 Ga0500658_0336106_112_534 132
68 3300053151 Ga0500604_0141909 Ga0500604_0141909_106_528 132
69 3300053153 Ga0500616_0012599 Ga0500616_0012599_808_1206 132
70 3300053158 Ga0500627_0000144 Ga0500627_0000144_8394_8816 132
71 3300053158 Ga0500627_0037844 Ga0500627_0037844_1070_1492 132
72 3300005563 Ga0068855_100249736 Ga0068855_1002497362 133
73 3300005563 Ga0068855_100450124 Ga0068855_1004501244 133
74 3300005841 Ga0068863_100005477 Ga0068863_10000547715 133
75 3300005843 Ga0068860_100008557 Ga0068860_1000085578 133
76 3300005844 Ga0068862_100000158 Ga0068862_10000015817 133
77 3300006931 Ga0097620_100045053 Ga0097620_1000450534 133
78 3300009101 Ga0105247_10006293 Ga0105247_100062934 133
79 3300009553 Ga0105249_10001047 Ga0105249_1000104716 133
80 3300025949 Ga0207667_10027821 Ga0207667_100278215 133
81 3300025949 Ga0207667_10442668 Ga0207667_104426683 133
82 3300025961 Ga0207712_10000754 Ga0207712_1000075417 133
83 3300026088 Ga0207641_10018526 Ga0207641_100185262 133
84 3300026142 Ga0207698_10233857 Ga0207698_102338572 133
85 3300028380 Ga0268265_10000863 Ga0268265_1000086316 133
86 3300028381 Ga0268264_10051483 Ga0268264_100514836 133
87 3300031456 Ga0307513_10206581 Ga0307513_102065814 133
88 3300053153 Ga0500616_0015194 Ga0500616_0015194_3592_3993 133
89 3300044735 Ga0466968_0027833 Ga0466968_0027833_1315_1719 134
90 3300048927 Ga0496124_0879944 Ga0496124_0879944_62_478 134
91 3300002076 JGI24749J21850_1000334 JGI24749J21850_10003347 135
92 3300003781 Ga0055536_1002809 Ga0055536_10028098 135
93 3300003784 Ga0055534_1010483 Ga0055534_10104834 135
94 3300003791 Ga0055530_10000149 Ga0055530_1000014910 135
95 3300003791 Ga0055530_10080671 Ga0055530_100806711 135
96 3300003794 Ga0055531_10002722 Ga0055531_100027226 135
97 3300005295 Ga0065707_10086128 Ga0065707_100861286 135
98 3300005331 Ga0070670_100000082 Ga0070670_10000008212 135
99 3300005331 Ga0070670_100000987 Ga0070670_10000098720 135
100 3300005335 Ga0070666_10019328 Ga0070666_100193285 135
101 3300005335 Ga0070666_10201847 Ga0070666_102018472 135
102 3300005347 Ga0070668_100000157 Ga0070668_10000015720 135
103 3300005347 Ga0070668_100007745 Ga0070668_1000077456 135
104 3300005347 Ga0070668_100007774 Ga0070668_1000077746 135
105 3300005353 Ga0070669_100000015 Ga0070669_10000001512 135
106 3300005353 Ga0070669_100080818 Ga0070669_1000808183 135
107 3300005355 Ga0070671_100000134 Ga0070671_10000013421 135
108 3300005367 Ga0070667_100000003 Ga0070667_10000000348 135
109 3300005367 Ga0070667_100003633 Ga0070667_1000036337 135
110 3300005530 Ga0070679_101418660 Ga0070679_1014186601 135
111 3300005548 Ga0070665_100240498 Ga0070665_1002404984 135
112 3300005548 Ga0070665_100705230 Ga0070665_1007052302 135
113 3300005578 Ga0068854_100276492 Ga0068854_1002764922 135
114 3300005617 Ga0068859_100084792 Ga0068859_1000847924 135
115 3300005617 Ga0068859_100087170 Ga0068859_1000871705 135
116 3300005618 Ga0068864_100000590 Ga0068864_10000059022 135
117 3300005618 Ga0068864_100000611 Ga0068864_1000006116 135
118 3300005719 Ga0068861_100142061 Ga0068861_1001420613 135
119 3300005841 Ga0068863_100004086 Ga0068863_10000408611 135
120 3300005842 Ga0068858_100039945 Ga0068858_1000399453 135
121 3300005843 Ga0068860_100000068 Ga0068860_100000068138 135
122 3300005844 Ga0068862_100000006 Ga0068862_10000000662 135
123 3300005844 Ga0068862_100000553 Ga0068862_10000055326 135
124 3300005844 Ga0068862_100088985 Ga0068862_1000889853 135
125 3300005844 Ga0068862_101049031 Ga0068862_1010490312 135
126 3300005985 Ga0081539_10027394 Ga0081539_100273945 135
127 3300006353 Ga0075370_10098283 Ga0075370_100982832 135
128 3300006931 Ga0097620_100084792 Ga0097620_1000847924 135
129 3300006931 Ga0097620_100087172 Ga0097620_1000871725 135
130 3300009177 Ga0105248_10005555 Ga0105248_100055554 135
131 3300013306 Ga0163162_11432273 Ga0163162_114322731 135
132 3300014325 Ga0163163_12618016 Ga0163163_126180161 135
133 3300014326 Ga0157380_10004403 Ga0157380_1000440310 135
134 3300025245 Ga0207425_1028854 Ga0207425_10288542 135
135 3300025292 Ga0209676_1000155 Ga0209676_10001559 135
136 3300025298 Ga0209050_1001595 Ga0209050_10015954 135
137 3300025298 Ga0209050_1013805 Ga0209050_10138052 135
138 3300025304 Ga0209257_1000169 Ga0209257_100016951 135
139 3300025903 Ga0207680_10107419 Ga0207680_101074193 135
140 3300025903 Ga0207680_10171928 Ga0207680_101719282 135
141 3300025923 Ga0207681_10000001 Ga0207681_10000001736 135
142 3300025923 Ga0207681_10074742 Ga0207681_100747423 135
143 3300025923 Ga0207681_10359386 Ga0207681_103593863 135
144 3300025923 Ga0207681_11540189 Ga0207681_115401891 135
145 3300025925 Ga0207650_10000050 Ga0207650_1000005079 135
146 3300025925 Ga0207650_10001152 Ga0207650_1000115216 135
147 3300025925 Ga0207650_10121268 Ga0207650_101212681 135
148 3300025931 Ga0207644_10000160 Ga0207644_1000016029 135
149 3300025941 Ga0207711_10001368 Ga0207711_1000136818 135
150 3300025941 Ga0207711_10051424 Ga0207711_100514245 135
151 3300025941 Ga0207711_10281629 Ga0207711_102816294 135
152 3300025961 Ga0207712_11365587 Ga0207712_113655872 135
153 3300025972 Ga0207668_10000045 Ga0207668_1000004560 135
154 3300025972 Ga0207668_10008192 Ga0207668_100081926 135
155 3300025972 Ga0207668_10017957 Ga0207668_100179575 135
156 3300025981 Ga0207640_10296223 Ga0207640_102962232 135
157 3300025986 Ga0207658_10000002 Ga0207658_10000002949 135
158 3300025986 Ga0207658_10001979 Ga0207658_1000197912 135
159 3300026035 Ga0207703_10000862 Ga0207703_100008623 135
160 3300026088 Ga0207641_10000277 Ga0207641_1000027754 135
161 3300026088 Ga0207641_10020991 Ga0207641_100209916 135
162 3300026088 Ga0207641_11227240 Ga0207641_112272401 135
163 3300026095 Ga0207676_10000004 Ga0207676_10000004316 135
164 3300026095 Ga0207676_10002101 Ga0207676_1000210114 135
165 3300026118 Ga0207675_100000295 Ga0207675_10000029510 135
166 3300026118 Ga0207675_100150221 Ga0207675_1001502213 135
167 3300027876 Ga0209974_10121085 Ga0209974_101210852 135
168 3300028379 Ga0268266_11072881 Ga0268266_110728812 135
169 3300028380 Ga0268265_10000002 Ga0268265_10000002789 135
170 3300028380 Ga0268265_10002804 Ga0268265_1000280412 135
171 3300028380 Ga0268265_10102595 Ga0268265_101025953 135
172 3300028381 Ga0268264_10000103 Ga0268264_10000103183 135
173 3300031824 Ga0307413_11763662 Ga0307413_117636621 135
174 3300031901 Ga0307406_10043429 Ga0307406_100434294 135
175 3300031911 Ga0307412_10000374 Ga0307412_1000037431 135
176 3300031911 Ga0307412_10120880 Ga0307412_101208803 135
177 3300032004 Ga0307414_10000144 Ga0307414_1000014423 135
178 3300032004 Ga0307414_10000204 Ga0307414_1000020410 135
179 3300032004 Ga0307414_10001310 Ga0307414_100013102 135
180 3300032004 Ga0307414_10105658 Ga0307414_101056583 135
181 3300032004 Ga0307414_10319024 Ga0307414_103190242 135
182 3300032004 Ga0307414_10596389 Ga0307414_105963892 135
183 3300037471 Ga0395905_0233607 Ga0395905_0233607_834_1292 135
184 3300041451 Ga0451791_0759008 Ga0451791_0759008_76_483 135
185 3300041509 Ga0451843_0637931 Ga0451843_0637931_565_972 135
186 3300044659 Ga0466973_0256329 Ga0466973_0256329_108_515 135
187 3300044735 Ga0466968_0066687 Ga0466968_0066687_505_927 135
188 3300044765 Ga0466970_0430200 Ga0466970_0430200_153_566 135
189 3300046460 Ga0495638_0016606 Ga0495638_0016606_975_1400 135
190 3300046530 Ga0495654_0073397 Ga0495654_0073397_473_901 135
191 3300046616 Ga0495668_0000002 Ga0495668_0000002_439958_440386 135
192 3300046660 Ga0495625_0000281 Ga0495625_0000281_63439_63867 135
193 3300047470 Ga0495681_0134047 Ga0495681_0134047_572_1000 135
194 3300047472 Ga0495686_0009528 Ga0495686_0009528_2564_2989 135
195 3300047472 Ga0495686_0126465 Ga0495686_0126465_1054_1479 135
196 3300048920 Ga0496117_0035482 Ga0496117_0035482_1912_2322 135
197 3300048921 Ga0496118_0003914 Ga0496118_0003914_3017_3427 135
198 3300048924 Ga0496121_0165994 Ga0496121_0165994_1015_1425 135
199 3300048926 Ga0496123_0307758 Ga0496123_0307758_319_729 135
200 3300048927 Ga0496124_0100403 Ga0496124_0100403_1792_2202 135
201 3300048928 Ga0496125_0131899 Ga0496125_0131899_106_534 135
202 3300048929 Ga0496126_0750892 Ga0496126_0750892_164_592 135
203 3300049571 Ga0501034_0218070 Ga0501034_0218070_654_1076 135
204 3300049571 Ga0501034_0447144 Ga0501034_0447144_550_957 135
205 3300049579 Ga0501043_0071837 Ga0501043_0071837_1655_2062 135
206 3300049581 Ga0501047_0035623 Ga0501047_0035623_1951_2358 135
207 3300049582 Ga0501048_0175816 Ga0501048_0175816_714_1121 135
208 3300049668 Ga0501233_002559 Ga0501233_002559_1791_2216 135
209 3300049669 Ga0501235_023213 Ga0501235_023213_452_877 135
210 3300049679 Ga0501249_001919 Ga0501249_001919_2693_3100 135
211 3300049850 Ga0501204_003755 Ga0501204_003755_505_912 135
212 3300050490 nmdc:mga03n38_664871_c1 nmdc:mga03n38_664871_c1_80_508 135
213 3300053087 Ga0500643_003053 Ga0500643_003053_3985_4392 135
214 3300053096 Ga0500641_0009228 Ga0500641_0009228_2201_2629 135
215 3300053116 Ga0500592_006138 Ga0500592_006138_209_640 135
216 3300053131 Ga0500652_317196 Ga0500652_317196_128_556 135
217 3300053136 Ga0500559_0021972 Ga0500559_0021972_641_1066 135
218 3300053139 Ga0500568_0001615 Ga0500568_0001615_2388_2810 135
219 3300053158 Ga0500627_0000015 Ga0500627_0000015_64225_64653 135
220 3300053730 Ga0500645_001058 Ga0500645_001058_11648_12076 135
221 iso_pu_bacteria 2643221563 2643832898 135
222 iso_pu_bacteria 2643221608 2644053307 135
223 iso_pu_bacteria 2852653556 2852656531 135
224 iso_pu_bacteria 2852680915 2852684748 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22327

Nudt16-like

U8 snoRNA-decapping enzyme-like

24

104

0.92

PF14815

NUDIX_4

NUDIX domain

14

135

0.86

PF00293

NUDIX

NUDIX domain

9

136

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9679 5 135
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9607 5 135
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9602 6 135
3hhj-assembly1.cif.gz_A crystal structure of mutator mutt from bartonella henselae 0.9434 5 133
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9313 6 135
ID Description Score Start End Superfamily
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9594 6 135 3.90.79.10
af_P77788_1_135_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9544 5 134 3.90.79.10
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9301 6 135 3.90.79.10
3eesB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9247 7 134 3.90.79.10
af_Q54BB8_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9172 5 133 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A520INE6-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9977 7 111 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A2S8B6Z3-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9975 7 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A2N3D164-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.997 5 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A196MDB0-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9958 6 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A848HUH3-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9956 6 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716

Feature Viewer

pLDDT pTM Quality
93.77 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map