F337171
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 224 | 135 | 219 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0218070|Ga0501034_0218070_654_1076 |
| Length | 140 |
| Sequence | VEKNPTSLPALIVVAAALVDADGRVLLQQRAPHRKMAGLWEFPGGKLEPGETPEEALIRELEEELGIQTESACLAPAAFASHRLDDDSHLILLLYVCRKWRGTPRPLDASGLTWVRPQQMFSLAMPPADKPLIGLLDALL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 2 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 3 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 4 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 5 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 44 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 45 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 46 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 70 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 71 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 72 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 73 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 74 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 75 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 76 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 77 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 78 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 79 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 80 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 81 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 82 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 83 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 84 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 85 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 86 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 96 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 97 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 98 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 99 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 100 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 101 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 102 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 103 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 109 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 110 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 111 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 112 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 113 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 114 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 115 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 116 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 117 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 118 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 119 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 120 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 121 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 122 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 123 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 125 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 126 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 127 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 128 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 129 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 130 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 131 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 132 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 133 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 134 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 135 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 0 |
| Isolates | 2.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.29 |
| Nodule | 0 |
| Rhizoplane | 0.45 |
| Rhizosphere | 75.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1000334 | 3300002076 | Bacteria | 7114 |
| 2 | Ga0055536_1002809 | 3300003781 | Bacteria | 9617 |
| 3 | Ga0055534_1010483 | 3300003784 | Bacteria | 1939 |
| 4 | Ga0055530_10000149 | 3300003791 | Bacteria | 63152 |
| 5 | Ga0055530_10080671 | 3300003791 | Unclassified | 684 |
| 6 | Ga0055531_10002722 | 3300003794 | Bacteria | 11629 |
| 7 | Ga0065707_10086128 | 3300005295 | Bacteria | 5648 |
| 8 | Ga0070670_100000082 | 3300005331 | Bacteria | 91524 |
| 9 | Ga0070670_100000987 | 3300005331 | Bacteria | 22339 |
| 10 | Ga0070666_10019328 | 3300005335 | Bacteria | 4397 |
| 11 | Ga0070666_10201847 | 3300005335 | Bacteria | 1399 |
| 12 | Ga0070668_100000018 | 3300005347 | Bacteria | 99142 |
| 13 | Ga0070668_100000157 | 3300005347 | Bacteria | 43332 |
| 14 | Ga0070668_100007745 | 3300005347 | Bacteria | 7973 |
| 15 | Ga0070668_100007774 | 3300005347 | Bacteria | 7960 |
| 16 | Ga0070669_100000015 | 3300005353 | Bacteria | 197597 |
| 17 | Ga0070669_100080818 | 3300005353 | Bacteria | 2420 |
| 18 | Ga0070671_100000134 | 3300005355 | Bacteria | 47424 |
| 19 | Ga0070671_100000189 | 3300005355 | Bacteria | 41536 |
| 20 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 21 | Ga0070667_100003633 | 3300005367 | Bacteria | 13128 |
| 22 | Ga0068867_102149867 | 3300005459 | Bacteria | 529 |
| 23 | Ga0070679_101418660 | 3300005530 | Bacteria | 641 |
| 24 | Ga0070665_100079057 | 3300005548 | Bacteria | 3295 |
| 25 | Ga0070665_100240498 | 3300005548 | Bacteria | 1811 |
| 26 | Ga0070665_100705230 | 3300005548 | Bacteria | 1022 |
| 27 | Ga0068855_100249736 | 3300005563 | Bacteria | 1979 |
| 28 | Ga0068855_100450124 | 3300005563 | Bacteria | 1405 |
| 29 | Ga0068854_100276492 | 3300005578 | Bacteria | 1350 |
| 30 | Ga0068859_100084792 | 3300005617 | Bacteria | 3213 |
| 31 | Ga0068859_100087170 | 3300005617 | Bacteria | 3169 |
| 32 | Ga0068859_100222720 | 3300005617 | Bacteria | 1974 |
| 33 | Ga0068864_100000590 | 3300005618 | Bacteria | 30911 |
| 34 | Ga0068864_100000611 | 3300005618 | Bacteria | 30197 |
| 35 | Ga0068861_100142061 | 3300005719 | Bacteria | 1960 |
| 36 | Ga0068863_100000030 | 3300005841 | Bacteria | 176023 |
| 37 | Ga0068863_100004086 | 3300005841 | Bacteria | 14419 |
| 38 | Ga0068863_100005477 | 3300005841 | Bacteria | 12502 |
| 39 | Ga0068858_100039945 | 3300005842 | Bacteria | 4351 |
| 40 | Ga0068860_100000068 | 3300005843 | Bacteria | 179208 |
| 41 | Ga0068860_100008557 | 3300005843 | Bacteria | 10197 |
| 42 | Ga0068860_100024210 | 3300005843 | Bacteria | 5870 |
| 43 | Ga0068862_100000006 | 3300005844 | Bacteria | 346828 |
| 44 | Ga0068862_100000158 | 3300005844 | Bacteria | 75829 |
| 45 | Ga0068862_100000553 | 3300005844 | Bacteria | 39108 |
| 46 | Ga0068862_100088985 | 3300005844 | Bacteria | 2687 |
| 47 | Ga0068862_100344775 | 3300005844 | Bacteria | 1380 |
| 48 | Ga0068862_101049031 | 3300005844 | Bacteria | 808 |
| 49 | Ga0081539_10027394 | 3300005985 | Bacteria | 3611 |
| 50 | Ga0081539_10029151 | 3300005985 | Bacteria | 3455 |
| 51 | Ga0075370_10098283 | 3300006353 | Bacteria | 1693 |
| 52 | Ga0097620_100045053 | 3300006931 | Bacteria | 4432 |
| 53 | Ga0097620_100084792 | 3300006931 | Bacteria | 3213 |
| 54 | Ga0097620_100087172 | 3300006931 | Bacteria | 3169 |
| 55 | Ga0097620_100222715 | 3300006931 | Bacteria | 1974 |
| 56 | Ga0105247_10006293 | 3300009101 | Bacteria | 7357 |
| 57 | Ga0105248_10005555 | 3300009177 | Bacteria | 13855 |
| 58 | Ga0105248_10213933 | 3300009177 | Bacteria | 2171 |
| 59 | Ga0105248_10222080 | 3300009177 | Bacteria | 2127 |
| 60 | Ga0105249_10001047 | 3300009553 | Bacteria | 24478 |
| 61 | Ga0105249_10040572 | 3300009553 | Bacteria | 4228 |
| 62 | Ga0105239_10924910 | 3300010375 | Bacteria | 1001 |
| 63 | Ga0157370_10197665 | 3300013104 | Bacteria | 1866 |
| 64 | Ga0157369_10006534 | 3300013105 | Bacteria | 13501 |
| 65 | Ga0163162_11432273 | 3300013306 | Bacteria | 786 |
| 66 | Ga0163163_12618016 | 3300014325 | Bacteria | 562 |
| 67 | Ga0157380_10004403 | 3300014326 | Bacteria | 9760 |
| 68 | Ga0157379_10617443 | 3300014968 | Bacteria | 1013 |
| 69 | Ga0213874_10023856 | 3300021377 | Bacteria | 1710 |
| 70 | Ga0213874_10104810 | 3300021377 | Bacteria | 944 |
| 71 | Ga0213875_10009862 | 3300021388 | Bacteria | 4814 |
| 72 | Ga0207425_1028854 | 3300025245 | Bacteria | 1122 |
| 73 | Ga0209676_1000155 | 3300025292 | Bacteria | 165151 |
| 74 | Ga0209050_1001595 | 3300025298 | Bacteria | 23432 |
| 75 | Ga0209050_1013805 | 3300025298 | Bacteria | 3549 |
| 76 | Ga0209257_1000169 | 3300025304 | Bacteria | 171227 |
| 77 | Ga0207680_10107419 | 3300025903 | Bacteria | 1804 |
| 78 | Ga0207680_10171928 | 3300025903 | Bacteria | 1460 |
| 79 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 80 | Ga0207681_10074742 | 3300025923 | Bacteria | 2375 |
| 81 | Ga0207681_10353899 | 3300025923 | Bacteria | 1176 |
| 82 | Ga0207681_10359386 | 3300025923 | Bacteria | 1167 |
| 83 | Ga0207681_11540189 | 3300025923 | Bacteria | 557 |
| 84 | Ga0207650_10000050 | 3300025925 | Bacteria | 169589 |
| 85 | Ga0207650_10001152 | 3300025925 | Bacteria | 19412 |
| 86 | Ga0207650_10121268 | 3300025925 | Bacteria | 2036 |
| 87 | Ga0207644_10000096 | 3300025931 | Bacteria | 63618 |
| 88 | Ga0207644_10000160 | 3300025931 | Bacteria | 49009 |
| 89 | Ga0207711_10001368 | 3300025941 | Bacteria | 22973 |
| 90 | Ga0207711_10051424 | 3300025941 | Bacteria | 3528 |
| 91 | Ga0207711_10281629 | 3300025941 | Bacteria | 1531 |
| 92 | Ga0207667_10027821 | 3300025949 | Bacteria | 6148 |
| 93 | Ga0207667_10442668 | 3300025949 | Bacteria | 1321 |
| 94 | Ga0207712_10000754 | 3300025961 | Bacteria | 24470 |
| 95 | Ga0207712_11365587 | 3300025961 | Bacteria | 634 |
| 96 | Ga0207668_10000045 | 3300025972 | Bacteria | 103160 |
| 97 | Ga0207668_10000082 | 3300025972 | Bacteria | 71860 |
| 98 | Ga0207668_10008192 | 3300025972 | Bacteria | 6224 |
| 99 | Ga0207668_10017957 | 3300025972 | Bacteria | 4441 |
| 100 | Ga0207640_10296223 | 3300025981 | Bacteria | 1278 |
| 101 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 102 | Ga0207658_10001979 | 3300025986 | Bacteria | 15290 |
| 103 | Ga0207703_10000862 | 3300026035 | Bacteria | 29697 |
| 104 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 105 | Ga0207641_10000277 | 3300026088 | Bacteria | 64441 |
| 106 | Ga0207641_10018526 | 3300026088 | Bacteria | 5709 |
| 107 | Ga0207641_10020991 | 3300026088 | Bacteria | 5369 |
| 108 | Ga0207641_11227240 | 3300026088 | Bacteria | 750 |
| 109 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 110 | Ga0207676_10002101 | 3300026095 | Bacteria | 14423 |
| 111 | Ga0207674_10784872 | 3300026116 | Bacteria | 919 |
| 112 | Ga0207675_100000295 | 3300026118 | Bacteria | 48065 |
| 113 | Ga0207675_100150221 | 3300026118 | Bacteria | 2217 |
| 114 | Ga0207698_10233857 | 3300026142 | Bacteria | 1670 |
| 115 | Ga0209974_10121085 | 3300027876 | Bacteria | 927 |
| 116 | Ga0268266_10084595 | 3300028379 | Bacteria | 2770 |
| 117 | Ga0268266_11072881 | 3300028379 | Bacteria | 779 |
| 118 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 119 | Ga0268265_10000863 | 3300028380 | Bacteria | 28360 |
| 120 | Ga0268265_10002804 | 3300028380 | Bacteria | 12834 |
| 121 | Ga0268265_10102595 | 3300028380 | Bacteria | 2314 |
| 122 | Ga0268265_10525374 | 3300028380 | Unclassified | 1119 |
| 123 | Ga0268264_10000103 | 3300028381 | Bacteria | 222439 |
| 124 | Ga0268264_10005457 | 3300028381 | Bacteria | 10777 |
| 125 | Ga0268264_10051483 | 3300028381 | Bacteria | 3431 |
| 126 | Ga0307513_10206581 | 3300031456 | Bacteria | 1799 |
| 127 | Ga0307408_100096394 | 3300031548 | Bacteria | 2244 |
| 128 | Ga0307405_10049434 | 3300031731 | Bacteria | 2599 |
| 129 | Ga0307413_11763662 | 3300031824 | Bacteria | 553 |
| 130 | Ga0307406_10043429 | 3300031901 | Bacteria | 2811 |
| 131 | Ga0307406_10052217 | 3300031901 | Bacteria | 2599 |
| 132 | Ga0307412_10000374 | 3300031911 | Bacteria | 27876 |
| 133 | Ga0307412_10120880 | 3300031911 | Bacteria | 1885 |
| 134 | Ga0307416_100086067 | 3300032002 | Bacteria | 2678 |
| 135 | Ga0307414_10000144 | 3300032004 | Bacteria | 48442 |
| 136 | Ga0307414_10000204 | 3300032004 | Bacteria | 39795 |
| 137 | Ga0307414_10001310 | 3300032004 | Bacteria | 12846 |
| 138 | Ga0307414_10024881 | 3300032004 | Bacteria | 3825 |
| 139 | Ga0307414_10105658 | 3300032004 | Bacteria | 2129 |
| 140 | Ga0307414_10319024 | 3300032004 | Bacteria | 1322 |
| 141 | Ga0307414_10596389 | 3300032004 | Bacteria | 990 |
| 142 | Ga0395905_0233607 | 3300037471 | Bacteria | 1719 |
| 143 | Ga0436364_0024756 | 3300037853 | Bacteria | 185423 |
| 144 | Ga0436363_1340139 | 3300039450 | Bacteria | 1569 |
| 145 | Ga0436363_1455987 | 3300039450 | Bacteria | 582 |
| 146 | Ga0436363_1469920 | 3300039450 | Bacteria | 1814 |
| 147 | Ga0439461_0036024 | 3300041410 | Bacteria | 1052 |
| 148 | Ga0451791_0759008 | 3300041451 | Bacteria | 897 |
| 149 | Ga0451843_0637931 | 3300041509 | Bacteria | 1031 |
| 150 | Ga0466973_0256329 | 3300044659 | Bacteria | 1224 |
| 151 | Ga0466968_0027833 | 3300044735 | Bacteria | 2327 |
| 152 | Ga0466968_0066687 | 3300044735 | Bacteria | 1559 |
| 153 | Ga0466970_0430200 | 3300044765 | Bacteria | 755 |
| 154 | Ga0495590_0178989 | 3300046457 | Bacteria | 775 |
| 155 | Ga0495638_0016606 | 3300046460 | Bacteria | 4926 |
| 156 | Ga0495607_0017292 | 3300046501 | Bacteria | 4633 |
| 157 | Ga0495606_0064732 | 3300046507 | Bacteria | 2325 |
| 158 | Ga0495654_0038575 | 3300046530 | Bacteria | 2388 |
| 159 | Ga0495654_0073397 | 3300046530 | Bacteria | 1618 |
| 160 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 161 | Ga0495625_0000281 | 3300046660 | Bacteria | 79314 |
| 162 | Ga0495681_0134047 | 3300047470 | Bacteria | 1052 |
| 163 | Ga0495686_0000280 | 3300047472 | Bacteria | 90032 |
| 164 | Ga0495686_0009528 | 3300047472 | Bacteria | 6987 |
| 165 | Ga0495686_0126465 | 3300047472 | Bacteria | 1519 |
| 166 | Ga0495686_0186785 | 3300047472 | Bacteria | 1197 |
| 167 | Ga0495686_0192160 | 3300047472 | Bacteria | 1176 |
| 168 | Ga0496117_0035482 | 3300048920 | Bacteria | 3742 |
| 169 | Ga0496118_0003914 | 3300048921 | Bacteria | 18229 |
| 170 | Ga0496121_0165994 | 3300048924 | Bacteria | 1609 |
| 171 | Ga0496123_0307758 | 3300048926 | Bacteria | 753 |
| 172 | Ga0496124_0100403 | 3300048927 | Bacteria | 2346 |
| 173 | Ga0496124_0493052 | 3300048927 | Bacteria | 824 |
| 174 | Ga0496124_0879944 | 3300048927 | Bacteria | 546 |
| 175 | Ga0496125_0131899 | 3300048928 | Bacteria | 1757 |
| 176 | Ga0496126_0750892 | 3300048929 | Bacteria | 753 |
| 177 | Ga0501293_002761 | 3300049516 | Bacteria | 1340 |
| 178 | Ga0501034_0218070 | 3300049571 | Bacteria | 1861 |
| 179 | Ga0501034_0447144 | 3300049571 | Bacteria | 1210 |
| 180 | Ga0501043_0071837 | 3300049579 | Bacteria | 2718 |
| 181 | Ga0501046_0467476 | 3300049580 | Bacteria | 906 |
| 182 | Ga0501047_0035623 | 3300049581 | Bacteria | 4807 |
| 183 | Ga0501047_0741092 | 3300049581 | Unclassified | 799 |
| 184 | Ga0501048_0175816 | 3300049582 | Bacteria | 1517 |
| 185 | Ga0501223_000070 | 3300049663 | Bacteria | 31069 |
| 186 | Ga0501224_000012 | 3300049664 | Bacteria | 92585 |
| 187 | Ga0501233_002559 | 3300049668 | Bacteria | 3212 |
| 188 | Ga0501235_023213 | 3300049669 | Bacteria | 1382 |
| 189 | Ga0501249_001919 | 3300049679 | Bacteria | 4225 |
| 190 | Ga0501257_000067 | 3300049686 | Bacteria | 28497 |
| 191 | Ga0501225_0000019 | 3300049705 | Bacteria | 59374 |
| 192 | Ga0501229_044063 | 3300049706 | Bacteria | 643 |
| 193 | Ga0501234_009850 | 3300049707 | Bacteria | 1491 |
| 194 | Ga0501282_003404 | 3300049778 | Bacteria | 1714 |
| 195 | Ga0501204_003755 | 3300049850 | Bacteria | 1613 |
| 196 | Ga0501226_000064 | 3300049853 | Bacteria | 35696 |
| 197 | Ga0501284_02254 | 3300050005 | Bacteria | 1059 |
| 198 | nmdc:mga03683_187381_c1 | 3300050489 | Bacteria | 946 |
| 199 | nmdc:mga03n38_664871_c1 | 3300050490 | Bacteria | 598 |
| 200 | nmdc:mga0qj67_21757_c1 | 3300050509 | Bacteria | 4920 |
| 201 | Ga0500643_000260 | 3300053087 | Bacteria | 47191 |
| 202 | Ga0500643_003053 | 3300053087 | Bacteria | 8256 |
| 203 | Ga0500643_092148 | 3300053087 | Bacteria | 826 |
| 204 | Ga0500641_0009228 | 3300053096 | Bacteria | 3542 |
| 205 | Ga0500650_0518956 | 3300053098 | Bacteria | 505 |
| 206 | Ga0500592_000195 | 3300053116 | Bacteria | 11538 |
| 207 | Ga0500592_006138 | 3300053116 | Bacteria | 1914 |
| 208 | Ga0500652_317196 | 3300053131 | Bacteria | 598 |
| 209 | Ga0500658_0336106 | 3300053134 | Bacteria | 694 |
| 210 | Ga0500559_0021972 | 3300053136 | Bacteria | 2706 |
| 211 | Ga0500559_0105602 | 3300053136 | Bacteria | 1301 |
| 212 | Ga0500568_0001615 | 3300053139 | Bacteria | 14250 |
| 213 | Ga0500604_0141909 | 3300053151 | Bacteria | 812 |
| 214 | Ga0500616_0012599 | 3300053153 | Bacteria | 4946 |
| 215 | Ga0500616_0015194 | 3300053153 | Bacteria | 4407 |
| 216 | Ga0500627_0000015 | 3300053158 | Bacteria | 132947 |
| 217 | Ga0500627_0000144 | 3300053158 | Bacteria | 20890 |
| 218 | Ga0500627_0037844 | 3300053158 | Bacteria | 2060 |
| 219 | Ga0500645_001058 | 3300053730 | Bacteria | 15269 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10197665 | Ga0157370_101976652 | 127 |
| 2 | 3300032004 | Ga0307414_10024881 | Ga0307414_100248813 | 127 |
| 3 | 3300050005 | Ga0501284_02254 | Ga0501284_02254_523_909 | 128 |
| 4 | 3300005548 | Ga0070665_100079057 | Ga0070665_1000790572 | 129 |
| 5 | 3300009177 | Ga0105248_10213933 | Ga0105248_102139333 | 129 |
| 6 | 3300009177 | Ga0105248_10222080 | Ga0105248_102220804 | 129 |
| 7 | 3300009553 | Ga0105249_10040572 | Ga0105249_100405725 | 129 |
| 8 | 3300021388 | Ga0213875_10009862 | Ga0213875_100098624 | 129 |
| 9 | 3300037853 | Ga0436364_0024756 | Ga0436364_0024756_168784_169188 | 129 |
| 10 | 3300053136 | Ga0500559_0105602 | Ga0500559_0105602_672_1082 | 129 |
| 11 | 3300010375 | Ga0105239_10924910 | Ga0105239_109249102 | 130 |
| 12 | 3300021377 | Ga0213874_10023856 | Ga0213874_100238562 | 130 |
| 13 | 3300026116 | Ga0207674_10784872 | Ga0207674_107848721 | 130 |
| 14 | 3300039450 | Ga0436363_1455987 | Ga0436363_1455987_21_413 | 130 |
| 15 | 3300039450 | Ga0436363_1469920 | Ga0436363_1469920_252_644 | 130 |
| 16 | 3300046457 | Ga0495590_0178989 | Ga0495590_0178989_208_600 | 130 |
| 17 | 3300046501 | Ga0495607_0017292 | Ga0495607_0017292_1067_1486 | 130 |
| 18 | 3300048927 | Ga0496124_0493052 | Ga0496124_0493052_76_468 | 130 |
| 19 | 3300049663 | Ga0501223_000070 | Ga0501223_000070_24623_25015 | 130 |
| 20 | 3300049664 | Ga0501224_000012 | Ga0501224_000012_34370_34762 | 130 |
| 21 | 3300049705 | Ga0501225_0000019 | Ga0501225_0000019_34314_34706 | 130 |
| 22 | 3300049706 | Ga0501229_044063 | Ga0501229_044063_94_486 | 130 |
| 23 | 3300049707 | Ga0501234_009850 | Ga0501234_009850_94_486 | 130 |
| 24 | 3300049778 | Ga0501282_003404 | Ga0501282_003404_72_464 | 130 |
| 25 | 3300049853 | Ga0501226_000064 | Ga0501226_000064_1218_1610 | 130 |
| 26 | 3300050489 | nmdc:mga03683_187381_c1 | nmdc:mga03683_187381_c1_340_732 | 130 |
| 27 | 3300053087 | Ga0500643_092148 | Ga0500643_092148_374_766 | 130 |
| 28 | 3300053098 | Ga0500650_0518956 | Ga0500650_0518956_35_427 | 130 |
| 29 | 3300005985 | Ga0081539_10029151 | Ga0081539_100291516 | 131 |
| 30 | 3300014968 | Ga0157379_10617443 | Ga0157379_106174432 | 131 |
| 31 | 3300050509 | nmdc:mga0qj67_21757_c1 | nmdc:mga0qj67_21757_c1_83_496 | 131 |
| 32 | iso_pu_bacteria | 2643221605 | 2644037067 | 131 |
| 33 | 3300005347 | Ga0070668_100000018 | Ga0070668_10000001814 | 132 |
| 34 | 3300005355 | Ga0070671_100000189 | Ga0070671_10000018937 | 132 |
| 35 | 3300005459 | Ga0068867_102149867 | Ga0068867_1021498671 | 132 |
| 36 | 3300005617 | Ga0068859_100222720 | Ga0068859_1002227204 | 132 |
| 37 | 3300005841 | Ga0068863_100000030 | Ga0068863_100000030151 | 132 |
| 38 | 3300005843 | Ga0068860_100024210 | Ga0068860_1000242105 | 132 |
| 39 | 3300005844 | Ga0068862_100344775 | Ga0068862_1003447753 | 132 |
| 40 | 3300006931 | Ga0097620_100222715 | Ga0097620_1002227154 | 132 |
| 41 | 3300013105 | Ga0157369_10006534 | Ga0157369_1000653416 | 132 |
| 42 | 3300021377 | Ga0213874_10104810 | Ga0213874_101048102 | 132 |
| 43 | 3300025923 | Ga0207681_10353899 | Ga0207681_103538992 | 132 |
| 44 | 3300025931 | Ga0207644_10000096 | Ga0207644_1000009638 | 132 |
| 45 | 3300025972 | Ga0207668_10000082 | Ga0207668_1000008269 | 132 |
| 46 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001132 | 132 |
| 47 | 3300028379 | Ga0268266_10084595 | Ga0268266_100845952 | 132 |
| 48 | 3300028380 | Ga0268265_10525374 | Ga0268265_105253742 | 132 |
| 49 | 3300028381 | Ga0268264_10005457 | Ga0268264_1000545711 | 132 |
| 50 | 3300031548 | Ga0307408_100096394 | Ga0307408_1000963945 | 132 |
| 51 | 3300031731 | Ga0307405_10049434 | Ga0307405_100494345 | 132 |
| 52 | 3300031901 | Ga0307406_10052217 | Ga0307406_100522175 | 132 |
| 53 | 3300032002 | Ga0307416_100086067 | Ga0307416_1000860675 | 132 |
| 54 | 3300039450 | Ga0436363_1340139 | Ga0436363_1340139_156_560 | 132 |
| 55 | 3300041410 | Ga0439461_0036024 | Ga0439461_0036024_385_792 | 132 |
| 56 | 3300046507 | Ga0495606_0064732 | Ga0495606_0064732_1096_1494 | 132 |
| 57 | 3300046530 | Ga0495654_0038575 | Ga0495654_0038575_397_819 | 132 |
| 58 | 3300047472 | Ga0495686_0000280 | Ga0495686_0000280_45900_46298 | 132 |
| 59 | 3300047472 | Ga0495686_0186785 | Ga0495686_0186785_260_658 | 132 |
| 60 | 3300047472 | Ga0495686_0192160 | Ga0495686_0192160_662_1069 | 132 |
| 61 | 3300049516 | Ga0501293_002761 | Ga0501293_002761_115_537 | 132 |
| 62 | 3300049580 | Ga0501046_0467476 | Ga0501046_0467476_407_814 | 132 |
| 63 | 3300049581 | Ga0501047_0741092 | Ga0501047_0741092_303_710 | 132 |
| 64 | 3300049686 | Ga0501257_000067 | Ga0501257_000067_28024_28446 | 132 |
| 65 | 3300053087 | Ga0500643_000260 | Ga0500643_000260_26485_26907 | 132 |
| 66 | 3300053116 | Ga0500592_000195 | Ga0500592_000195_8954_9376 | 132 |
| 67 | 3300053134 | Ga0500658_0336106 | Ga0500658_0336106_112_534 | 132 |
| 68 | 3300053151 | Ga0500604_0141909 | Ga0500604_0141909_106_528 | 132 |
| 69 | 3300053153 | Ga0500616_0012599 | Ga0500616_0012599_808_1206 | 132 |
| 70 | 3300053158 | Ga0500627_0000144 | Ga0500627_0000144_8394_8816 | 132 |
| 71 | 3300053158 | Ga0500627_0037844 | Ga0500627_0037844_1070_1492 | 132 |
| 72 | 3300005563 | Ga0068855_100249736 | Ga0068855_1002497362 | 133 |
| 73 | 3300005563 | Ga0068855_100450124 | Ga0068855_1004501244 | 133 |
| 74 | 3300005841 | Ga0068863_100005477 | Ga0068863_10000547715 | 133 |
| 75 | 3300005843 | Ga0068860_100008557 | Ga0068860_1000085578 | 133 |
| 76 | 3300005844 | Ga0068862_100000158 | Ga0068862_10000015817 | 133 |
| 77 | 3300006931 | Ga0097620_100045053 | Ga0097620_1000450534 | 133 |
| 78 | 3300009101 | Ga0105247_10006293 | Ga0105247_100062934 | 133 |
| 79 | 3300009553 | Ga0105249_10001047 | Ga0105249_1000104716 | 133 |
| 80 | 3300025949 | Ga0207667_10027821 | Ga0207667_100278215 | 133 |
| 81 | 3300025949 | Ga0207667_10442668 | Ga0207667_104426683 | 133 |
| 82 | 3300025961 | Ga0207712_10000754 | Ga0207712_1000075417 | 133 |
| 83 | 3300026088 | Ga0207641_10018526 | Ga0207641_100185262 | 133 |
| 84 | 3300026142 | Ga0207698_10233857 | Ga0207698_102338572 | 133 |
| 85 | 3300028380 | Ga0268265_10000863 | Ga0268265_1000086316 | 133 |
| 86 | 3300028381 | Ga0268264_10051483 | Ga0268264_100514836 | 133 |
| 87 | 3300031456 | Ga0307513_10206581 | Ga0307513_102065814 | 133 |
| 88 | 3300053153 | Ga0500616_0015194 | Ga0500616_0015194_3592_3993 | 133 |
| 89 | 3300044735 | Ga0466968_0027833 | Ga0466968_0027833_1315_1719 | 134 |
| 90 | 3300048927 | Ga0496124_0879944 | Ga0496124_0879944_62_478 | 134 |
| 91 | 3300002076 | JGI24749J21850_1000334 | JGI24749J21850_10003347 | 135 |
| 92 | 3300003781 | Ga0055536_1002809 | Ga0055536_10028098 | 135 |
| 93 | 3300003784 | Ga0055534_1010483 | Ga0055534_10104834 | 135 |
| 94 | 3300003791 | Ga0055530_10000149 | Ga0055530_1000014910 | 135 |
| 95 | 3300003791 | Ga0055530_10080671 | Ga0055530_100806711 | 135 |
| 96 | 3300003794 | Ga0055531_10002722 | Ga0055531_100027226 | 135 |
| 97 | 3300005295 | Ga0065707_10086128 | Ga0065707_100861286 | 135 |
| 98 | 3300005331 | Ga0070670_100000082 | Ga0070670_10000008212 | 135 |
| 99 | 3300005331 | Ga0070670_100000987 | Ga0070670_10000098720 | 135 |
| 100 | 3300005335 | Ga0070666_10019328 | Ga0070666_100193285 | 135 |
| 101 | 3300005335 | Ga0070666_10201847 | Ga0070666_102018472 | 135 |
| 102 | 3300005347 | Ga0070668_100000157 | Ga0070668_10000015720 | 135 |
| 103 | 3300005347 | Ga0070668_100007745 | Ga0070668_1000077456 | 135 |
| 104 | 3300005347 | Ga0070668_100007774 | Ga0070668_1000077746 | 135 |
| 105 | 3300005353 | Ga0070669_100000015 | Ga0070669_10000001512 | 135 |
| 106 | 3300005353 | Ga0070669_100080818 | Ga0070669_1000808183 | 135 |
| 107 | 3300005355 | Ga0070671_100000134 | Ga0070671_10000013421 | 135 |
| 108 | 3300005367 | Ga0070667_100000003 | Ga0070667_10000000348 | 135 |
| 109 | 3300005367 | Ga0070667_100003633 | Ga0070667_1000036337 | 135 |
| 110 | 3300005530 | Ga0070679_101418660 | Ga0070679_1014186601 | 135 |
| 111 | 3300005548 | Ga0070665_100240498 | Ga0070665_1002404984 | 135 |
| 112 | 3300005548 | Ga0070665_100705230 | Ga0070665_1007052302 | 135 |
| 113 | 3300005578 | Ga0068854_100276492 | Ga0068854_1002764922 | 135 |
| 114 | 3300005617 | Ga0068859_100084792 | Ga0068859_1000847924 | 135 |
| 115 | 3300005617 | Ga0068859_100087170 | Ga0068859_1000871705 | 135 |
| 116 | 3300005618 | Ga0068864_100000590 | Ga0068864_10000059022 | 135 |
| 117 | 3300005618 | Ga0068864_100000611 | Ga0068864_1000006116 | 135 |
| 118 | 3300005719 | Ga0068861_100142061 | Ga0068861_1001420613 | 135 |
| 119 | 3300005841 | Ga0068863_100004086 | Ga0068863_10000408611 | 135 |
| 120 | 3300005842 | Ga0068858_100039945 | Ga0068858_1000399453 | 135 |
| 121 | 3300005843 | Ga0068860_100000068 | Ga0068860_100000068138 | 135 |
| 122 | 3300005844 | Ga0068862_100000006 | Ga0068862_10000000662 | 135 |
| 123 | 3300005844 | Ga0068862_100000553 | Ga0068862_10000055326 | 135 |
| 124 | 3300005844 | Ga0068862_100088985 | Ga0068862_1000889853 | 135 |
| 125 | 3300005844 | Ga0068862_101049031 | Ga0068862_1010490312 | 135 |
| 126 | 3300005985 | Ga0081539_10027394 | Ga0081539_100273945 | 135 |
| 127 | 3300006353 | Ga0075370_10098283 | Ga0075370_100982832 | 135 |
| 128 | 3300006931 | Ga0097620_100084792 | Ga0097620_1000847924 | 135 |
| 129 | 3300006931 | Ga0097620_100087172 | Ga0097620_1000871725 | 135 |
| 130 | 3300009177 | Ga0105248_10005555 | Ga0105248_100055554 | 135 |
| 131 | 3300013306 | Ga0163162_11432273 | Ga0163162_114322731 | 135 |
| 132 | 3300014325 | Ga0163163_12618016 | Ga0163163_126180161 | 135 |
| 133 | 3300014326 | Ga0157380_10004403 | Ga0157380_1000440310 | 135 |
| 134 | 3300025245 | Ga0207425_1028854 | Ga0207425_10288542 | 135 |
| 135 | 3300025292 | Ga0209676_1000155 | Ga0209676_10001559 | 135 |
| 136 | 3300025298 | Ga0209050_1001595 | Ga0209050_10015954 | 135 |
| 137 | 3300025298 | Ga0209050_1013805 | Ga0209050_10138052 | 135 |
| 138 | 3300025304 | Ga0209257_1000169 | Ga0209257_100016951 | 135 |
| 139 | 3300025903 | Ga0207680_10107419 | Ga0207680_101074193 | 135 |
| 140 | 3300025903 | Ga0207680_10171928 | Ga0207680_101719282 | 135 |
| 141 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001736 | 135 |
| 142 | 3300025923 | Ga0207681_10074742 | Ga0207681_100747423 | 135 |
| 143 | 3300025923 | Ga0207681_10359386 | Ga0207681_103593863 | 135 |
| 144 | 3300025923 | Ga0207681_11540189 | Ga0207681_115401891 | 135 |
| 145 | 3300025925 | Ga0207650_10000050 | Ga0207650_1000005079 | 135 |
| 146 | 3300025925 | Ga0207650_10001152 | Ga0207650_1000115216 | 135 |
| 147 | 3300025925 | Ga0207650_10121268 | Ga0207650_101212681 | 135 |
| 148 | 3300025931 | Ga0207644_10000160 | Ga0207644_1000016029 | 135 |
| 149 | 3300025941 | Ga0207711_10001368 | Ga0207711_1000136818 | 135 |
| 150 | 3300025941 | Ga0207711_10051424 | Ga0207711_100514245 | 135 |
| 151 | 3300025941 | Ga0207711_10281629 | Ga0207711_102816294 | 135 |
| 152 | 3300025961 | Ga0207712_11365587 | Ga0207712_113655872 | 135 |
| 153 | 3300025972 | Ga0207668_10000045 | Ga0207668_1000004560 | 135 |
| 154 | 3300025972 | Ga0207668_10008192 | Ga0207668_100081926 | 135 |
| 155 | 3300025972 | Ga0207668_10017957 | Ga0207668_100179575 | 135 |
| 156 | 3300025981 | Ga0207640_10296223 | Ga0207640_102962232 | 135 |
| 157 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002949 | 135 |
| 158 | 3300025986 | Ga0207658_10001979 | Ga0207658_1000197912 | 135 |
| 159 | 3300026035 | Ga0207703_10000862 | Ga0207703_100008623 | 135 |
| 160 | 3300026088 | Ga0207641_10000277 | Ga0207641_1000027754 | 135 |
| 161 | 3300026088 | Ga0207641_10020991 | Ga0207641_100209916 | 135 |
| 162 | 3300026088 | Ga0207641_11227240 | Ga0207641_112272401 | 135 |
| 163 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004316 | 135 |
| 164 | 3300026095 | Ga0207676_10002101 | Ga0207676_1000210114 | 135 |
| 165 | 3300026118 | Ga0207675_100000295 | Ga0207675_10000029510 | 135 |
| 166 | 3300026118 | Ga0207675_100150221 | Ga0207675_1001502213 | 135 |
| 167 | 3300027876 | Ga0209974_10121085 | Ga0209974_101210852 | 135 |
| 168 | 3300028379 | Ga0268266_11072881 | Ga0268266_110728812 | 135 |
| 169 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002789 | 135 |
| 170 | 3300028380 | Ga0268265_10002804 | Ga0268265_1000280412 | 135 |
| 171 | 3300028380 | Ga0268265_10102595 | Ga0268265_101025953 | 135 |
| 172 | 3300028381 | Ga0268264_10000103 | Ga0268264_10000103183 | 135 |
| 173 | 3300031824 | Ga0307413_11763662 | Ga0307413_117636621 | 135 |
| 174 | 3300031901 | Ga0307406_10043429 | Ga0307406_100434294 | 135 |
| 175 | 3300031911 | Ga0307412_10000374 | Ga0307412_1000037431 | 135 |
| 176 | 3300031911 | Ga0307412_10120880 | Ga0307412_101208803 | 135 |
| 177 | 3300032004 | Ga0307414_10000144 | Ga0307414_1000014423 | 135 |
| 178 | 3300032004 | Ga0307414_10000204 | Ga0307414_1000020410 | 135 |
| 179 | 3300032004 | Ga0307414_10001310 | Ga0307414_100013102 | 135 |
| 180 | 3300032004 | Ga0307414_10105658 | Ga0307414_101056583 | 135 |
| 181 | 3300032004 | Ga0307414_10319024 | Ga0307414_103190242 | 135 |
| 182 | 3300032004 | Ga0307414_10596389 | Ga0307414_105963892 | 135 |
| 183 | 3300037471 | Ga0395905_0233607 | Ga0395905_0233607_834_1292 | 135 |
| 184 | 3300041451 | Ga0451791_0759008 | Ga0451791_0759008_76_483 | 135 |
| 185 | 3300041509 | Ga0451843_0637931 | Ga0451843_0637931_565_972 | 135 |
| 186 | 3300044659 | Ga0466973_0256329 | Ga0466973_0256329_108_515 | 135 |
| 187 | 3300044735 | Ga0466968_0066687 | Ga0466968_0066687_505_927 | 135 |
| 188 | 3300044765 | Ga0466970_0430200 | Ga0466970_0430200_153_566 | 135 |
| 189 | 3300046460 | Ga0495638_0016606 | Ga0495638_0016606_975_1400 | 135 |
| 190 | 3300046530 | Ga0495654_0073397 | Ga0495654_0073397_473_901 | 135 |
| 191 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_439958_440386 | 135 |
| 192 | 3300046660 | Ga0495625_0000281 | Ga0495625_0000281_63439_63867 | 135 |
| 193 | 3300047470 | Ga0495681_0134047 | Ga0495681_0134047_572_1000 | 135 |
| 194 | 3300047472 | Ga0495686_0009528 | Ga0495686_0009528_2564_2989 | 135 |
| 195 | 3300047472 | Ga0495686_0126465 | Ga0495686_0126465_1054_1479 | 135 |
| 196 | 3300048920 | Ga0496117_0035482 | Ga0496117_0035482_1912_2322 | 135 |
| 197 | 3300048921 | Ga0496118_0003914 | Ga0496118_0003914_3017_3427 | 135 |
| 198 | 3300048924 | Ga0496121_0165994 | Ga0496121_0165994_1015_1425 | 135 |
| 199 | 3300048926 | Ga0496123_0307758 | Ga0496123_0307758_319_729 | 135 |
| 200 | 3300048927 | Ga0496124_0100403 | Ga0496124_0100403_1792_2202 | 135 |
| 201 | 3300048928 | Ga0496125_0131899 | Ga0496125_0131899_106_534 | 135 |
| 202 | 3300048929 | Ga0496126_0750892 | Ga0496126_0750892_164_592 | 135 |
| 203 | 3300049571 | Ga0501034_0218070 | Ga0501034_0218070_654_1076 | 135 |
| 204 | 3300049571 | Ga0501034_0447144 | Ga0501034_0447144_550_957 | 135 |
| 205 | 3300049579 | Ga0501043_0071837 | Ga0501043_0071837_1655_2062 | 135 |
| 206 | 3300049581 | Ga0501047_0035623 | Ga0501047_0035623_1951_2358 | 135 |
| 207 | 3300049582 | Ga0501048_0175816 | Ga0501048_0175816_714_1121 | 135 |
| 208 | 3300049668 | Ga0501233_002559 | Ga0501233_002559_1791_2216 | 135 |
| 209 | 3300049669 | Ga0501235_023213 | Ga0501235_023213_452_877 | 135 |
| 210 | 3300049679 | Ga0501249_001919 | Ga0501249_001919_2693_3100 | 135 |
| 211 | 3300049850 | Ga0501204_003755 | Ga0501204_003755_505_912 | 135 |
| 212 | 3300050490 | nmdc:mga03n38_664871_c1 | nmdc:mga03n38_664871_c1_80_508 | 135 |
| 213 | 3300053087 | Ga0500643_003053 | Ga0500643_003053_3985_4392 | 135 |
| 214 | 3300053096 | Ga0500641_0009228 | Ga0500641_0009228_2201_2629 | 135 |
| 215 | 3300053116 | Ga0500592_006138 | Ga0500592_006138_209_640 | 135 |
| 216 | 3300053131 | Ga0500652_317196 | Ga0500652_317196_128_556 | 135 |
| 217 | 3300053136 | Ga0500559_0021972 | Ga0500559_0021972_641_1066 | 135 |
| 218 | 3300053139 | Ga0500568_0001615 | Ga0500568_0001615_2388_2810 | 135 |
| 219 | 3300053158 | Ga0500627_0000015 | Ga0500627_0000015_64225_64653 | 135 |
| 220 | 3300053730 | Ga0500645_001058 | Ga0500645_001058_11648_12076 | 135 |
| 221 | iso_pu_bacteria | 2643221563 | 2643832898 | 135 |
| 222 | iso_pu_bacteria | 2643221608 | 2644053307 | 135 |
| 223 | iso_pu_bacteria | 2852653556 | 2852656531 | 135 |
| 224 | iso_pu_bacteria | 2852680915 | 2852684748 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r03-assembly1.cif.gz_A | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9679 | 5 | 135 |
| 3r03-assembly1.cif.gz_A | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9607 | 5 | 135 |
| 3r03-assembly1.cif.gz_B | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9602 | 6 | 135 |
| 3hhj-assembly1.cif.gz_A | crystal structure of mutator mutt from bartonella henselae | 0.9434 | 5 | 133 |
| 3r03-assembly1.cif.gz_B | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9313 | 6 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r03B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9594 | 6 | 135 | 3.90.79.10 |
| af_P77788_1_135_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9544 | 5 | 134 | 3.90.79.10 |
| 3r03B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9301 | 6 | 135 | 3.90.79.10 |
| 3eesB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9247 | 7 | 134 | 3.90.79.10 |
| af_Q54BB8_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9172 | 5 | 133 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520INE6-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9977 | 7 | 111 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A2S8B6Z3-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9975 | 7 | 135 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A2N3D164-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.997 | 5 | 135 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A196MDB0-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9958 | 6 | 135 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A848HUH3-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9956 | 6 | 135 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar