F337135

General Info

Members Datasets Scaffolds Average Seq Length
224 173 448 131

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_1227548|Ga0496113_1227548_82_564
Length 160
Sequence MEFAFSARRESHELMTPKAALNCAGTFGVLLMLTYFWIMLGGALGTGARFWASGFIAENFGEVFPLGTLFVNVTGSFVIGFFAGLIDPLGPFLIGPRLRQFVMIGVCGGYTTFSSFSLQTLELARDGDWLRAGLNSVFSFACCLLAVWLGRGAAVLLVSR

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0
Rhizoplane 6.7
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 17.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_1227548 3300048916 Bacteria 585
2 JGI25153J46596_10058463 3300003215 Bacteria 1061
3 rootL2_10099010 3300003322 Bacteria 1231
4 JGI25160J50197_1020422 3300003354 Bacteria 1998
5 Ga0070658_10294644 3300005327 Bacteria 1383
6 Ga0070666_10571782 3300005335 Unclassified 823
7 Ga0070660_101141331 3300005339 Bacteria 660
8 Ga0070714_100058625 3300005435 Bacteria 3299
9 Ga0070713_100244522 3300005436 Bacteria 1635
10 Ga0070681_10016732 3300005458 Bacteria 7320
11 Ga0070681_11247052 3300005458 Bacteria 666
12 Ga0070706_100236035 3300005467 Bacteria 1707
13 Ga0070707_100276384 3300005468 Bacteria 1633
14 Ga0070679_100026756 3300005530 Bacteria 5672
15 Ga0070697_100016302 3300005536 Bacteria 5844
16 Ga0070697_100066827 3300005536 Bacteria 2939
17 Ga0070697_100276593 3300005536 Bacteria 1440
18 Ga0068853_100484699 3300005539 Bacteria 1166
19 Ga0070672_100763132 3300005543 Bacteria 849
20 Ga0068855_100993836 3300005563 Bacteria 882
21 Ga0070664_101486405 3300005564 Bacteria 641
22 Ga0068856_101395931 3300005614 Bacteria 715
23 Ga0068856_101736603 3300005614 Bacteria 636
24 Ga0068863_100014792 3300005841 Bacteria 7503
25 Ga0081455_10026806 3300005937 Bacteria 5292
26 Ga0070717_10039533 3300006028 Bacteria 3838
27 Ga0070716_101366927 3300006173 Bacteria 575
28 Ga0070712_100046451 3300006175 Unclassified 3002
29 Ga0075367_10084877 3300006178 Bacteria 1921
30 Ga0097621_100129136 3300006237 Unclassified 2149
31 Ga0075428_100222667 3300006844 Bacteria 2037
32 Ga0075430_100083609 3300006846 Bacteria 2674
33 Ga0075433_10635374 3300006852 Bacteria 936
34 Ga0075429_100027385 3300006880 Bacteria 4947
35 Ga0105240_10003447 3300009093 Bacteria 24551
36 Ga0105240_12467298 3300009093 Bacteria 538
37 Ga0111539_10293762 3300009094 Bacteria 1891
38 Ga0111539_11040285 3300009094 Unclassified 952
39 Ga0114129_10298736 3300009147 Bacteria 2147
40 Ga0105242_10036383 3300009176 Unclassified 3949
41 Ga0105248_10992555 3300009177 Unclassified 948
42 Ga0105239_11379720 3300010375 Bacteria 813
43 Ga0157370_10017939 3300013104 Bacteria 7127
44 Ga0157374_10310140 3300013296 Unclassified 1562
45 Ga0157372_10062472 3300013307 Bacteria 4173
46 Ga0157372_10140981 3300013307 Bacteria 2777
47 Ga0157372_10207811 3300013307 Bacteria 2268
48 Ga0157375_10380784 3300013308 Unclassified 1578
49 Ga0163163_10287326 3300014325 Bacteria 1697
50 Ga0163161_11041480 3300017792 Bacteria 700
51 Ga0213876_10002085 3300021384 Bacteria 11835
52 Ga0213875_10004319 3300021388 Bacteria 7826
53 Ga0209130_1000972 3300025284 Bacteria 22559
54 Ga0209025_1000053 3300025294 Bacteria 317600
55 Ga0209025_1155818 3300025294 Bacteria 624
56 Ga0209758_1002312 3300025297 Bacteria 19711
57 Ga0209758_1084498 3300025297 Bacteria 949
58 Ga0207426_1000198 3300025302 Bacteria 146241
59 Ga0207680_10055097 3300025903 Bacteria 2395
60 Ga0207699_10234805 3300025906 Bacteria 1257
61 Ga0207705_10608690 3300025909 Bacteria 850
62 Ga0207684_10377058 3300025910 Bacteria 1220
63 Ga0207707_10075900 3300025912 Bacteria 2933
64 Ga0207695_10022196 3300025913 Bacteria 7217
65 Ga0207695_10403019 3300025913 Bacteria 1252
66 Ga0207693_10041162 3300025915 Unclassified 3638
67 Ga0207693_11281341 3300025915 Unclassified 549
68 Ga0207660_10615417 3300025917 Bacteria 885
69 Ga0207657_10334077 3300025919 Bacteria 1197
70 Ga0207652_11462171 3300025921 Bacteria 587
71 Ga0207659_10245350 3300025926 Bacteria 1451
72 Ga0207700_10806954 3300025928 Bacteria 839
73 Ga0207664_10667879 3300025929 Bacteria 934
74 Ga0207686_10004169 3300025934 Bacteria 7756
75 Ga0207665_10277005 3300025939 Bacteria 1247
76 Ga0207665_10921860 3300025939 Bacteria 693
77 Ga0207679_10869463 3300025945 Bacteria 824
78 Ga0207658_12124023 3300025986 Bacteria 510
79 Ga0207639_11027906 3300026041 Unclassified 772
80 Ga0207641_10049590 3300026088 Bacteria 3548
81 Ga0207676_10387121 3300026095 Bacteria 1303
82 Ga0265338_10082991 3300028800 Bacteria 2682
83 Ga0265330_10149389 3300031235 Bacteria 993
84 Ga0265328_10163427 3300031239 Unclassified 840
85 Ga0265327_10003474 3300031251 Bacteria 14996
86 Ga0307408_101032265 3300031548 Bacteria 759
87 Ga0307410_10687500 3300031852 Unclassified 861
88 Ga0307407_10066140 3300031903 Bacteria 2131
89 Ga0307414_10717359 3300032004 Bacteria 906
90 Ga0307415_101432092 3300032126 Unclassified 659
91 Ga0373934_0048525 3300035086 Bacteria 1681
92 Ga0373934_0076734 3300035086 Bacteria 1340
93 Ga0373934_0361757 3300035086 Unclassified 605
94 Ga0373944_0017123 3300035089 Bacteria 2053
95 Ga0373953_0220158 3300035117 Unclassified 822
96 Ga0373954_0462706 3300035118 Bacteria 628
97 Ga0373956_0130996 3300035119 Bacteria 1174
98 Ga0373957_0189390 3300035120 Unclassified 855
99 Ga0373943_0090025 3300035170 Bacteria 1588
100 Ga0373955_0385684 3300035172 Bacteria 850
101 Ga0373931_0465041 3300035691 Unclassified 811
102 Ga0373935_0411729 3300035692 Bacteria 972
103 Ga0373927_0065933 3300035695 Bacteria 2342
104 Ga0373927_0327768 3300035695 Bacteria 1009
105 Ga0373937_0002836 3300036401 Bacteria 14486
106 Ga0373937_0018575 3300036401 Bacteria 6211
107 Ga0373937_0984473 3300036401 Unclassified 792
108 Ga0373925_0028937 3300037068 Bacteria 4062
109 Ga0373925_0229769 3300037068 Bacteria 1483
110 Ga0373925_0265100 3300037068 Bacteria 1381
111 Ga0373925_0668494 3300037068 Bacteria 856
112 Ga0395899_0042664 3300037312 Bacteria 3386
113 Ga0395899_0451479 3300037312 Bacteria 842
114 Ga0395899_0498206 3300037312 Bacteria 790
115 Ga0395900_0139759 3300037418 Bacteria 2480
116 Ga0395900_0586338 3300037418 Bacteria 1056
117 Ga0395900_1177156 3300037418 Unclassified 682
118 Ga0395898_0320529 3300037466 Bacteria 1478
119 Ga0395898_1631861 3300037466 Unclassified 569
120 Ga0395905_0027729 3300037471 Bacteria 5341
121 Ga0395905_0098913 3300037471 Bacteria 2740
122 Ga0395905_0224480 3300037471 Bacteria 1758
123 Ga0436364_0451110 3300037853 Bacteria 2777
124 Ga0395901_0469312 3300038443 Bacteria 1285
125 Ga0395901_0476347 3300038443 Bacteria 1274
126 Ga0395901_0505839 3300038443 Bacteria 1229
127 Ga0436365_0068566 3300039437 Bacteria 10703
128 Ga0436360_0430329 3300039438 Bacteria 1310
129 Ga0436363_0523458 3300039450 Bacteria 12704
130 Ga0436362_0514571 3300039453 Bacteria 8382
131 Ga0451802_2133827 3300041460 Unclassified 719
132 Ga0439431_0092496 3300041997 Bacteria 825
133 Ga0450907_051487 3300042146 Bacteria 708
134 Ga0466963_0325316 3300044694 Bacteria 1082
135 Ga0466964_0731320 3300044706 Bacteria 554
136 Ga0453684_0397133 3300044712 Bacteria 1545
137 Ga0453684_0675178 3300044712 Bacteria 1125
138 Ga0451576_0255884 3300045051 Unclassified 1830
139 Ga0466958_0655950 3300045836 Bacteria 683
140 Ga0495629_0257392 3300046459 Bacteria 1200
141 Ga0495651_0035649 3300046462 Bacteria 3873
142 Ga0495651_0765241 3300046462 Unclassified 598
143 Ga0495639_0153612 3300046475 Unclassified 1111
144 Ga0495610_0000749 3300046512 Bacteria 30647
145 Ga0495610_0008742 3300046512 Bacteria 6505
146 Ga0495618_0265874 3300046514 Unclassified 1073
147 Ga0495628_0010787 3300046516 Bacteria 7738
148 Ga0495628_0054275 3300046516 Bacteria 3160
149 Ga0495630_0231013 3300046517 Bacteria 1413
150 Ga0495643_0399102 3300046522 Bacteria 607
151 Ga0495652_0040299 3300046529 Bacteria 4037
152 Ga0495640_0172906 3300046533 Unclassified 1380
153 Ga0495645_0549078 3300046543 Unclassified 716
154 Ga0495667_0551979 3300046559 Unclassified 720
155 Ga0495658_0051468 3300046683 Bacteria 2333
156 Ga0495613_0181736 3300046689 Bacteria 1489
157 Ga0495649_0166730 3300046694 Bacteria 1154
158 Ga0495674_0151303 3300047319 Bacteria 1946
159 Ga0495674_0422482 3300047319 Unclassified 1074
160 Ga0495674_0524011 3300047319 Bacteria 946
161 Ga0495680_0267106 3300047322 Bacteria 1209
162 Ga0495675_0420802 3300047444 Unclassified 776
163 Ga0495684_0105341 3300047471 Bacteria 2131
164 Ga0495684_0257600 3300047471 Bacteria 1267
165 Ga0496101_0299045 3300048904 Bacteria 1260
166 Ga0496103_0403260 3300048906 Bacteria 878
167 Ga0496103_0953447 3300048906 Bacteria 536
168 Ga0496104_0004508 3300048907 Bacteria 12137
169 Ga0496105_0002070 3300048908 Bacteria 14513
170 Ga0496108_0001068 3300048911 Bacteria 21368
171 Ga0496109_0004916 3300048912 Bacteria 11155
172 Ga0496110_0022351 3300048913 Bacteria 5369
173 Ga0496111_0040622 3300048914 Bacteria 3336
174 Ga0496112_0012445 3300048915 Bacteria 7823
175 Ga0496113_0000745 3300048916 Bacteria 16750
176 Ga0496114_0161183 3300048917 Bacteria 1950
177 Ga0496115_0005735 3300048918 Bacteria 9040
178 Ga0495682_0150879 3300049460 Bacteria 829
179 Ga0495682_0225328 3300049460 Bacteria 664
180 Ga0501033_0020079 3300049570 Bacteria 5051
181 Ga0501036_0813631 3300049572 Unclassified 769
182 Ga0501037_0062420 3300049573 Bacteria 2716
183 Ga0501040_0339511 3300049576 Bacteria 1075
184 Ga0501041_0009082 3300049577 Bacteria 5849
185 Ga0501042_0169722 3300049578 Bacteria 1574
186 Ga0501046_0162467 3300049580 Bacteria 1679
187 Ga0501046_0392970 3300049580 Unclassified 1002
188 Ga0501046_0919133 3300049580 Bacteria 610
189 Ga0501047_0047482 3300049581 Bacteria 4148
190 Ga0501047_0664529 3300049581 Bacteria 861
191 Ga0501068_0142309 3300049584 Bacteria 1504
192 Ga0501070_1437159 3300049586 Unclassified 523
193 Ga0501072_0745962 3300049588 Bacteria 768
194 Ga0501074_0696324 3300049590 Unclassified 717
195 Ga0501075_0766363 3300049591 Bacteria 734
196 Ga0501076_0653950 3300049592 Unclassified 867
197 Ga0501077_0181639 3300049593 Bacteria 1337
198 Ga0501079_0272324 3300049741 Bacteria 1323
199 Ga0501079_1442449 3300049741 Bacteria 542
200 Ga0501081_0004249 3300049743 Bacteria 9177
201 Ga0501081_0099045 3300049743 Bacteria 2059
202 Ga0501081_0129871 3300049743 Bacteria 1800
203 Ga0501044_0656880 3300049823 Bacteria 937
204 Ga0501044_0707023 3300049823 Bacteria 893
205 Ga0501044_1048890 3300049823 Bacteria 686
206 Ga0501045_0070592 3300049824 Bacteria 2570
207 nmdc:mga05p37_1872354_c1 3300050507 Bacteria 575
208 nmdc:mga05p37_211085_c1 3300050507 Bacteria 2347
209 nmdc:mga09592_10412_c1 3300050508 Bacteria 7566
210 nmdc:mga0qj67_416772_c1 3300050509 Bacteria 1083
211 nmdc:mga08y16_1696819_c1 3300050511 Bacteria 587
212 nmdc:mga08y16_943183_c1 3300050511 Bacteria 846
213 nmdc:mga0n895_235192_c1 3300050512 Bacteria 1859
214 nmdc:mga0a205_777015_c1 3300050515 Bacteria 806
215 Ga0495601_0322146 3300053077 Unclassified 1006
216 Ga0495619_0553284 3300053085 Unclassified 789
217 Ga0495619_0826267 3300053085 Unclassified 626
218 Ga0500644_0308990 3300053088 Bacteria 678
219 Ga0500595_022132 3300053119 Bacteria 2256
220 Ga0500588_0006410 3300053146 Bacteria 2665
221 Ga0500645_020812 3300053730 Bacteria 2029
222 Ga0501084_0123981 3300054114 Bacteria 2173
223 Ga0501082_1221528 3300060353 Bacteria 657
224 Ga0530510_0021379 3300061734 Bacteria 4604
225 Ga0496113_1227548
226 JGI25153J46596_10058463
227 rootL2_10099010
228 JGI25160J50197_1020422
229 Ga0070658_10294644
230 Ga0070666_10571782
231 Ga0070660_101141331
232 Ga0070714_100058625
233 Ga0070713_100244522
234 Ga0070681_10016732
235 Ga0070681_11247052
236 Ga0070706_100236035
237 Ga0070707_100276384
238 Ga0070679_100026756
239 Ga0070697_100016302
240 Ga0070697_100066827
241 Ga0070697_100276593
242 Ga0068853_100484699
243 Ga0070672_100763132
244 Ga0068855_100993836
245 Ga0070664_101486405
246 Ga0068856_101395931
247 Ga0068856_101736603
248 Ga0068863_100014792
249 Ga0081455_10026806
250 Ga0070717_10039533
251 Ga0070716_101366927
252 Ga0070712_100046451
253 Ga0075367_10084877
254 Ga0097621_100129136
255 Ga0075428_100222667
256 Ga0075430_100083609
257 Ga0075433_10635374
258 Ga0075429_100027385
259 Ga0105240_10003447
260 Ga0105240_12467298
261 Ga0111539_10293762
262 Ga0111539_11040285
263 Ga0114129_10298736
264 Ga0105242_10036383
265 Ga0105248_10992555
266 Ga0105239_11379720
267 Ga0157370_10017939
268 Ga0157374_10310140
269 Ga0157372_10062472
270 Ga0157372_10140981
271 Ga0157372_10207811
272 Ga0157375_10380784
273 Ga0163163_10287326
274 Ga0163161_11041480
275 Ga0213876_10002085
276 Ga0213875_10004319
277 Ga0209130_1000972
278 Ga0209025_1000053
279 Ga0209025_1155818
280 Ga0209758_1002312
281 Ga0209758_1084498
282 Ga0207426_1000198
283 Ga0207680_10055097
284 Ga0207699_10234805
285 Ga0207705_10608690
286 Ga0207684_10377058
287 Ga0207707_10075900
288 Ga0207695_10022196
289 Ga0207695_10403019
290 Ga0207693_10041162
291 Ga0207693_11281341
292 Ga0207660_10615417
293 Ga0207657_10334077
294 Ga0207652_11462171
295 Ga0207659_10245350
296 Ga0207700_10806954
297 Ga0207664_10667879
298 Ga0207686_10004169
299 Ga0207665_10277005
300 Ga0207665_10921860
301 Ga0207679_10869463
302 Ga0207658_12124023
303 Ga0207639_11027906
304 Ga0207641_10049590
305 Ga0207676_10387121
306 Ga0265338_10082991
307 Ga0265330_10149389
308 Ga0265328_10163427
309 Ga0265327_10003474
310 Ga0307408_101032265
311 Ga0307410_10687500
312 Ga0307407_10066140
313 Ga0307414_10717359
314 Ga0307415_101432092
315 Ga0373934_0048525
316 Ga0373934_0076734
317 Ga0373934_0361757
318 Ga0373944_0017123
319 Ga0373953_0220158
320 Ga0373954_0462706
321 Ga0373956_0130996
322 Ga0373957_0189390
323 Ga0373943_0090025
324 Ga0373955_0385684
325 Ga0373931_0465041
326 Ga0373935_0411729
327 Ga0373927_0065933
328 Ga0373927_0327768
329 Ga0373937_0002836
330 Ga0373937_0018575
331 Ga0373937_0984473
332 Ga0373925_0028937
333 Ga0373925_0229769
334 Ga0373925_0265100
335 Ga0373925_0668494
336 Ga0395899_0042664
337 Ga0395899_0451479
338 Ga0395899_0498206
339 Ga0395900_0139759
340 Ga0395900_0586338
341 Ga0395900_1177156
342 Ga0395898_0320529
343 Ga0395898_1631861
344 Ga0395905_0027729
345 Ga0395905_0098913
346 Ga0395905_0224480
347 Ga0436364_0451110
348 Ga0395901_0469312
349 Ga0395901_0476347
350 Ga0395901_0505839
351 Ga0436365_0068566
352 Ga0436360_0430329
353 Ga0436363_0523458
354 Ga0436362_0514571
355 Ga0451802_2133827
356 Ga0439431_0092496
357 Ga0450907_051487
358 Ga0466963_0325316
359 Ga0466964_0731320
360 Ga0453684_0397133
361 Ga0453684_0675178
362 Ga0451576_0255884
363 Ga0466958_0655950
364 Ga0495629_0257392
365 Ga0495651_0035649
366 Ga0495651_0765241
367 Ga0495639_0153612
368 Ga0495610_0000749
369 Ga0495610_0008742
370 Ga0495618_0265874
371 Ga0495628_0010787
372 Ga0495628_0054275
373 Ga0495630_0231013
374 Ga0495643_0399102
375 Ga0495652_0040299
376 Ga0495640_0172906
377 Ga0495645_0549078
378 Ga0495667_0551979
379 Ga0495658_0051468
380 Ga0495613_0181736
381 Ga0495649_0166730
382 Ga0495674_0151303
383 Ga0495674_0422482
384 Ga0495674_0524011
385 Ga0495680_0267106
386 Ga0495675_0420802
387 Ga0495684_0105341
388 Ga0495684_0257600
389 Ga0496101_0299045
390 Ga0496103_0403260
391 Ga0496103_0953447
392 Ga0496104_0004508
393 Ga0496105_0002070
394 Ga0496108_0001068
395 Ga0496109_0004916
396 Ga0496110_0022351
397 Ga0496111_0040622
398 Ga0496112_0012445
399 Ga0496113_0000745
400 Ga0496114_0161183
401 Ga0496115_0005735
402 Ga0495682_0150879
403 Ga0495682_0225328
404 Ga0501033_0020079
405 Ga0501036_0813631
406 Ga0501037_0062420
407 Ga0501040_0339511
408 Ga0501041_0009082
409 Ga0501042_0169722
410 Ga0501046_0162467
411 Ga0501046_0392970
412 Ga0501046_0919133
413 Ga0501047_0047482
414 Ga0501047_0664529
415 Ga0501068_0142309
416 Ga0501070_1437159
417 Ga0501072_0745962
418 Ga0501074_0696324
419 Ga0501075_0766363
420 Ga0501076_0653950
421 Ga0501077_0181639
422 Ga0501079_0272324
423 Ga0501079_1442449
424 Ga0501081_0004249
425 Ga0501081_0099045
426 Ga0501081_0129871
427 Ga0501044_0656880
428 Ga0501044_0707023
429 Ga0501044_1048890
430 Ga0501045_0070592
431 nmdc:mga05p37_1872354_c1
432 nmdc:mga05p37_211085_c1
433 nmdc:mga09592_10412_c1
434 nmdc:mga0qj67_416772_c1
435 nmdc:mga08y16_1696819_c1
436 nmdc:mga08y16_943183_c1
437 nmdc:mga0n895_235192_c1
438 nmdc:mga0a205_777015_c1
439 Ga0495601_0322146
440 Ga0495619_0553284
441 Ga0495619_0826267
442 Ga0500644_0308990
443 Ga0500595_022132
444 Ga0500588_0006410
445 Ga0500645_020812
446 Ga0501084_0123981
447 Ga0501082_1221528
448 Ga0530510_0021379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

36

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x58-assembly1.cif.gz_F mper-fluc-ec2 bound to 10e8v4 antibody 0.91 3 126
7kkb-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81c with bromide 0.9016 3 126
7kk9-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81a/t82a with bromide 0.9009 3 126
5kom-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 f83i mutant 0.9008 1 126
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.9005 3 126
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9467 6 119 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9219 6 119 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9189 6 120 1.10.287.70
af_Q2FXE5_5_115_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9164 6 119 1.10.287.70
af_P9WP63_10_123_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9028 6 120 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7V2G7B1-F1-model_v4 Fluoride-specific ion channel 0.9937 42 127 GO:0005886
GO:0034220
AF-A0A2H6B2F4-F1-model_v4 Fluoride-specific ion channel FluC 0.9833 3 127 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A0B7HK37-F1-model_v4 Fluoride-specific ion channel FluC 0.983 6 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A7V2G5E6-F1-model_v4 Fluoride-specific ion channel 0.983 1 81 GO:0005886
GO:0034220
AF-A0A529QTN4-F1-model_v4 Fluoride-specific ion channel 0.982 35 127 GO:0005886
GO:0034220

Map