F336780

General Info

Members Datasets Scaffolds Average Seq Length
224 121 448 162

Family's Representative Sequence

Representative Sequence 3300025272|Ga0209455_1018526|Ga0209455_10185262
Length 162
Sequence MKTLADLVLLGDPRLYEVCAPVTEADLPLVAGWVADLHNVMQEVRAHYGFGRGIAAPQLGIMKRLVYLHLDGQPHVLLNPELGELSDATIELWDDCMCFPNLLVRVRRHEALAVTYRDAQWQPHRWPVQGALAELLQHECDHLNGILCTMRALDAQSFRWRP

Samples

Sample ID Description Type Environment
1 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
121 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.89
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.36
Nodule 0
Rhizoplane 0.45
Rhizosphere 87.95
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209455_1018526 3300025272 Bacteria 1428
2 JGI24736J21556_1013913 3300001904 Bacteria 1297
3 JGI24737J22298_10010447 3300001990 Unclassified 3063
4 JGI24735J21928_10000020 3300002067 Bacteria 108706
5 JGI25162J39368_1000306 3300002737 Bacteria 44891
6 JGI25162J39368_1001505 3300002737 Bacteria 12134
7 JGI25157J39369_1008572 3300002741 Bacteria 1415
8 JGI25165J46597_1000728 3300003214 Bacteria 25784
9 rootH1_10058847 3300003316 Bacteria 7707
10 rootH1_10134309 3300003316 Unclassified 2425
11 rootH2_10003693 3300003320 Bacteria 23451
12 rootH1_10075928 3300003323 Bacteria 4975
13 rootH1_10075929 3300003323 Unclassified 3295
14 rootH1_10167934 3300003323 Bacteria 1463
15 Ga0058863_10051062 3300004799 Bacteria 1675
16 Ga0058862_10860316 3300004803 Bacteria 964
17 Ga0070658_10000053 3300005327 Bacteria 116207
18 Ga0070658_10015033 3300005327 Bacteria 6195
19 Ga0070658_10073957 3300005327 Bacteria 2795
20 Ga0070658_10934991 3300005327 Bacteria 754
21 Ga0070670_100026010 3300005331 Bacteria 5037
22 Ga0070680_100003466 3300005336 Bacteria 11777
23 Ga0068868_100077466 3300005338 Unclassified 2659
24 Ga0070660_100015780 3300005339 Bacteria 5465
25 Ga0070689_101216699 3300005340 Unclassified 676
26 Ga0070662_100000027 3300005457 Bacteria 83839
27 Ga0070681_10011469 3300005458 Bacteria 8773
28 Ga0070679_100011523 3300005530 Bacteria 8427
29 Ga0070679_100020757 3300005530 Bacteria 6407
30 Ga0068853_100026895 3300005539 Bacteria 4834
31 Ga0068853_100280131 3300005539 Bacteria 1537
32 Ga0068853_101721731 3300005539 Bacteria 608
33 Ga0070665_100000010 3300005548 Bacteria 529545
34 Ga0068855_100000060 3300005563 Bacteria 133838
35 Ga0068855_100046847 3300005563 Bacteria 5110
36 Ga0068855_100088936 3300005563 Unclassified 3567
37 Ga0068855_100392660 3300005563 Bacteria 1522
38 Ga0068855_100608626 3300005563 Bacteria 1177
39 Ga0068857_100019461 3300005577 Bacteria 5962
40 Ga0068857_100123845 3300005577 Bacteria 2329
41 Ga0068854_100020583 3300005578 Bacteria 4467
42 Ga0068854_100804636 3300005578 Bacteria 819
43 Ga0068856_100000030 3300005614 Bacteria 128494
44 Ga0068856_100020876 3300005614 Bacteria 6366
45 Ga0068856_100023443 3300005614 Bacteria 6001
46 Ga0068856_100241600 3300005614 Unclassified 1821
47 Ga0068856_100555694 3300005614 Bacteria 1169
48 Ga0068852_100006033 3300005616 Bacteria 8729
49 Ga0068864_100417453 3300005618 Bacteria 1278
50 Ga0068866_10056788 3300005718 Bacteria 2014
51 Ga0068858_101205341 3300005842 Bacteria 744
52 Ga0068860_100000880 3300005843 Bacteria 33319
53 Ga0105240_10001726 3300009093 Bacteria 36894
54 Ga0105240_10004108 3300009093 Bacteria 22346
55 Ga0105240_10006972 3300009093 Bacteria 16503
56 Ga0105240_10009698 3300009093 Bacteria 13600
57 Ga0105240_10011076 3300009093 Bacteria 12609
58 Ga0105240_10044070 3300009093 Bacteria 5673
59 Ga0105240_10062139 3300009093 Bacteria 4651
60 Ga0105240_10155274 3300009093 Bacteria 2723
61 Ga0105240_10209596 3300009093 Bacteria 2278
62 Ga0105240_10407759 3300009093 Bacteria 1529
63 Ga0105240_10452258 3300009093 Bacteria 1437
64 Ga0105243_10183524 3300009148 Bacteria 1821
65 Ga0105241_10003747 3300009174 Bacteria 11275
66 Ga0105241_10017160 3300009174 Bacteria 5317
67 Ga0105241_10127772 3300009174 Unclassified 2054
68 Ga0105241_10166694 3300009174 Bacteria 1816
69 Ga0105241_10233793 3300009174 Bacteria 1550
70 Ga0105241_10726835 3300009174 Unclassified 908
71 Ga0105241_11348190 3300009174 Bacteria 681
72 Ga0105242_11052497 3300009176 Bacteria 825
73 Ga0105237_10001092 3300009545 Bacteria 36314
74 Ga0105237_10004644 3300009545 Bacteria 15830
75 Ga0105237_10011812 3300009545 Bacteria 9237
76 Ga0105237_10020650 3300009545 Bacteria 6784
77 Ga0105237_10289985 3300009545 Bacteria 1639
78 Ga0105238_10011498 3300009551 Bacteria 8918
79 Ga0105238_10082985 3300009551 Unclassified 3194
80 Ga0105239_10000286 3300010375 Bacteria 74525
81 Ga0105239_10000908 3300010375 Bacteria 42116
82 Ga0105239_10001853 3300010375 Bacteria 27666
83 Ga0105239_10005789 3300010375 Bacteria 14420
84 Ga0105239_10017209 3300010375 Bacteria 7992
85 Ga0105239_10270787 3300010375 Bacteria 1910
86 Ga0157373_10026016 3300013100 Bacteria 4229
87 Ga0157373_10053176 3300013100 Unclassified 2880
88 Ga0157371_10072258 3300013102 Bacteria 2443
89 Ga0157370_10002675 3300013104 Bacteria 21354
90 Ga0157370_10500864 3300013104 Bacteria 1115
91 Ga0157369_10075910 3300013105 Bacteria 3602
92 Ga0157369_10125466 3300013105 Bacteria 2722
93 Ga0157369_11057709 3300013105 Bacteria 830
94 Ga0157374_10003890 3300013296 Bacteria 12537
95 Ga0157374_10024985 3300013296 Bacteria 5360
96 Ga0157374_10613830 3300013296 Bacteria 1098
97 Ga0157374_11626501 3300013296 Unclassified 670
98 Ga0157378_10012110 3300013297 Bacteria 7554
99 Ga0163162_10004817 3300013306 Bacteria 13023
100 Ga0157372_10013390 3300013307 Bacteria 8757
101 Ga0157372_10054961 3300013307 Bacteria 4445
102 Ga0157372_10144403 3300013307 Bacteria 2744
103 Ga0157377_10003388 3300014745 Bacteria 7207
104 Ga0213872_10075192 3300021361 Bacteria 1520
105 Ga0207427_100210 3300025231 Bacteria 53314
106 Ga0209437_100021 3300025233 Bacteria 646400
107 Ga0209437_100230 3300025233 Bacteria 95882
108 Ga0209026_1003671 3300025250 Bacteria 4919
109 Ga0209026_1004530 3300025250 Bacteria 4089
110 Ga0209129_1016298 3300025258 Bacteria 1496
111 Ga0209233_1000035 3300025261 Bacteria 568478
112 Ga0209455_1000992 3300025272 Bacteria 14308
113 Ga0207680_10078660 3300025903 Bacteria 2066
114 Ga0207680_10167845 3300025903 Bacteria 1476
115 Ga0207647_10000100 3300025904 Bacteria 66261
116 Ga0207647_10004200 3300025904 Bacteria 10682
117 Ga0207643_10045907 3300025908 Bacteria 2469
118 Ga0207705_10000028 3300025909 Bacteria 240636
119 Ga0207705_10054185 3300025909 Bacteria 2891
120 Ga0207705_10211548 3300025909 Bacteria 1471
121 Ga0207654_10001232 3300025911 Bacteria 13668
122 Ga0207654_10211021 3300025911 Unclassified 1283
123 Ga0207654_10445527 3300025911 Bacteria 907
124 Ga0207654_10628558 3300025911 Bacteria 768
125 Ga0207654_10762332 3300025911 Bacteria 697
126 Ga0207707_10032232 3300025912 Bacteria 4587
127 Ga0207695_10048767 3300025913 Bacteria 4470
128 Ga0207695_10051475 3300025913 Bacteria 4324
129 Ga0207695_10112033 3300025913 Bacteria 2707
130 Ga0207695_10258347 3300025913 Bacteria 1640
131 Ga0207695_10271861 3300025913 Bacteria 1590
132 Ga0207695_10275423 3300025913 Bacteria 1577
133 Ga0207695_10276602 3300025913 Unclassified 1573
134 Ga0207695_10445519 3300025913 Bacteria 1178
135 Ga0207671_10002592 3300025914 Bacteria 19096
136 Ga0207671_10002948 3300025914 Bacteria 17526
137 Ga0207671_10012221 3300025914 Bacteria 6919
138 Ga0207671_10012759 3300025914 Bacteria 6736
139 Ga0207660_10105266 3300025917 Bacteria 2114
140 Ga0207657_10025232 3300025919 Bacteria 5485
141 Ga0207657_10049969 3300025919 Bacteria 3641
142 Ga0207652_10060802 3300025921 Bacteria 3260
143 Ga0207652_10111427 3300025921 Bacteria 2427
144 Ga0207694_10114508 3300025924 Unclassified 2148
145 Ga0207694_10715170 3300025924 Bacteria 845
146 Ga0207650_10029962 3300025925 Bacteria 3916
147 Ga0207690_10015383 3300025932 Bacteria 4636
148 Ga0207706_10000036 3300025933 Bacteria 134302
149 Ga0207709_10095092 3300025935 Bacteria 1957
150 Ga0207670_10957244 3300025936 Bacteria 719
151 Ga0207667_10000033 3300025949 Bacteria 314353
152 Ga0207667_10005555 3300025949 Bacteria 15386
153 Ga0207667_10008781 3300025949 Bacteria 11968
154 Ga0207667_10054252 3300025949 Bacteria 4216
155 Ga0207667_10068349 3300025949 Bacteria 3700
156 Ga0207667_10356430 3300025949 Bacteria 1492
157 Ga0207667_10401047 3300025949 Bacteria 1396
158 Ga0207651_10339240 3300025960 Bacteria 1262
159 Ga0207640_10017598 3300025981 Bacteria 4184
160 Ga0207639_10082806 3300026041 Bacteria 2545
161 Ga0207639_10350603 3300026041 Bacteria 1318
162 Ga0207702_10000133 3300026078 Bacteria 88338
163 Ga0207702_10004456 3300026078 Bacteria 12445
164 Ga0207702_10059547 3300026078 Unclassified 3253
165 Ga0207702_10250579 3300026078 Unclassified 1663
166 Ga0207702_10350009 3300026078 Bacteria 1413
167 Ga0207702_10870251 3300026078 Bacteria 892
168 Ga0207674_10027706 3300026116 Bacteria 5989
169 Ga0268266_10000094 3300028379 Bacteria 190917
170 Ga0268264_10037784 3300028381 Unclassified 3983
171 Ga0265337_1053098 3300028556 Bacteria 1137
172 Ga0265334_10114817 3300028573 Bacteria 965
173 Ga0265322_10011083 3300028654 Bacteria 2616
174 Ga0307517_10027859 3300028786 Bacteria 6763
175 Ga0265338_10189918 3300028800 Bacteria 1558
176 Ga0265338_10438387 3300028800 Bacteria 926
177 Ga0265338_10494702 3300028800 Bacteria 861
178 Ga0265327_10091996 3300031251 Bacteria 1477
179 Ga0307513_10605427 3300031456 Bacteria 805
180 Ga0307509_10023170 3300031507 Bacteria 6982
181 Ga0307414_10126818 3300032004 Bacteria 1973
182 Ga0307510_10005596 3300033180 Bacteria 14978
183 Ga0395899_0000504 3300037312 Bacteria 43374
184 Ga0395899_0009627 3300037312 Bacteria 7416
185 Ga0395900_0000153 3300037418 Bacteria 115432
186 Ga0395900_0007895 3300037418 Bacteria 10961
187 Ga0395900_0829659 3300037418 Unclassified 851
188 Ga0395898_0009794 3300037466 Bacteria 10044
189 Ga0395905_0000188 3300037471 Bacteria 98070
190 Ga0395905_0001681 3300037471 Bacteria 26088
191 Ga0395901_0000357 3300038443 Bacteria 55376
192 Ga0395901_0007718 3300038443 Bacteria 10852
193 Ga0436361_0172871 3300039447 Bacteria 8439
194 Ga0451793_1222676 3300041452 Bacteria 837
195 Ga0439448_0034955 3300042005 Bacteria 1607
196 Ga0453684_0014305 3300044712 Bacteria 12716
197 Ga0466968_0034351 3300044735 Bacteria 2116
198 Ga0466959_0181617 3300045049 Bacteria 1471
199 Ga0451576_0158453 3300045051 Unclassified 2362
200 Ga0451576_0236029 3300045051 Unclassified 1910
201 Ga0495592_0435940 3300046454 Bacteria 824
202 Ga0495605_0278267 3300046474 Bacteria 712
203 Ga0495585_0156658 3300046492 Bacteria 1184
204 Ga0495606_0173456 3300046507 Bacteria 1249
205 Ga0495606_0257060 3300046507 Bacteria 966
206 Ga0495616_0000819 3300046513 Bacteria 22682
207 Ga0495618_0238334 3300046514 Bacteria 1144
208 Ga0495631_0142451 3300046518 Bacteria 1029
209 Ga0495632_0027106 3300046519 Unclassified 3005
210 Ga0495644_0009915 3300046523 Bacteria 3669
211 Ga0495648_0065927 3300046524 Bacteria 2125
212 Ga0495625_0003156 3300046660 Bacteria 16788
213 Ga0495625_0068049 3300046660 Unclassified 2504
214 Ga0495625_0071455 3300046660 Bacteria 2435
215 Ga0495670_0215717 3300046691 Bacteria 1019
216 Ga0495671_0139558 3300046692 Bacteria 1181
217 Ga0495649_0165915 3300046694 Bacteria 1157
218 Ga0495683_0037061 3300047323 Bacteria 2474
219 Ga0495677_0061844 3300047445 Bacteria 1389
220 Ga0495686_0000154 3300047472 Bacteria 131970
221 Ga0495686_0011013 3300047472 Bacteria 6397
222 nmdc:mga0k408_41361_c1 3300050493 Bacteria 2653
223 Ga0500608_000746 3300053122 Bacteria 11891
224 2884637443 2884634485 Bacteria 3928637
225 Ga0209455_1018526
226 JGI24736J21556_1013913
227 JGI24737J22298_10010447
228 JGI24735J21928_10000020
229 JGI25162J39368_1000306
230 JGI25162J39368_1001505
231 JGI25157J39369_1008572
232 JGI25165J46597_1000728
233 rootH1_10058847
234 rootH1_10134309
235 rootH2_10003693
236 rootH1_10075928
237 rootH1_10075929
238 rootH1_10167934
239 Ga0058863_10051062
240 Ga0058862_10860316
241 Ga0070658_10000053
242 Ga0070658_10015033
243 Ga0070658_10073957
244 Ga0070658_10934991
245 Ga0070670_100026010
246 Ga0070680_100003466
247 Ga0068868_100077466
248 Ga0070660_100015780
249 Ga0070689_101216699
250 Ga0070662_100000027
251 Ga0070681_10011469
252 Ga0070679_100011523
253 Ga0070679_100020757
254 Ga0068853_100026895
255 Ga0068853_100280131
256 Ga0068853_101721731
257 Ga0070665_100000010
258 Ga0068855_100000060
259 Ga0068855_100046847
260 Ga0068855_100088936
261 Ga0068855_100392660
262 Ga0068855_100608626
263 Ga0068857_100019461
264 Ga0068857_100123845
265 Ga0068854_100020583
266 Ga0068854_100804636
267 Ga0068856_100000030
268 Ga0068856_100020876
269 Ga0068856_100023443
270 Ga0068856_100241600
271 Ga0068856_100555694
272 Ga0068852_100006033
273 Ga0068864_100417453
274 Ga0068866_10056788
275 Ga0068858_101205341
276 Ga0068860_100000880
277 Ga0105240_10001726
278 Ga0105240_10004108
279 Ga0105240_10006972
280 Ga0105240_10009698
281 Ga0105240_10011076
282 Ga0105240_10044070
283 Ga0105240_10062139
284 Ga0105240_10155274
285 Ga0105240_10209596
286 Ga0105240_10407759
287 Ga0105240_10452258
288 Ga0105243_10183524
289 Ga0105241_10003747
290 Ga0105241_10017160
291 Ga0105241_10127772
292 Ga0105241_10166694
293 Ga0105241_10233793
294 Ga0105241_10726835
295 Ga0105241_11348190
296 Ga0105242_11052497
297 Ga0105237_10001092
298 Ga0105237_10004644
299 Ga0105237_10011812
300 Ga0105237_10020650
301 Ga0105237_10289985
302 Ga0105238_10011498
303 Ga0105238_10082985
304 Ga0105239_10000286
305 Ga0105239_10000908
306 Ga0105239_10001853
307 Ga0105239_10005789
308 Ga0105239_10017209
309 Ga0105239_10270787
310 Ga0157373_10026016
311 Ga0157373_10053176
312 Ga0157371_10072258
313 Ga0157370_10002675
314 Ga0157370_10500864
315 Ga0157369_10075910
316 Ga0157369_10125466
317 Ga0157369_11057709
318 Ga0157374_10003890
319 Ga0157374_10024985
320 Ga0157374_10613830
321 Ga0157374_11626501
322 Ga0157378_10012110
323 Ga0163162_10004817
324 Ga0157372_10013390
325 Ga0157372_10054961
326 Ga0157372_10144403
327 Ga0157377_10003388
328 Ga0213872_10075192
329 Ga0207427_100210
330 Ga0209437_100021
331 Ga0209437_100230
332 Ga0209026_1003671
333 Ga0209026_1004530
334 Ga0209129_1016298
335 Ga0209233_1000035
336 Ga0209455_1000992
337 Ga0207680_10078660
338 Ga0207680_10167845
339 Ga0207647_10000100
340 Ga0207647_10004200
341 Ga0207643_10045907
342 Ga0207705_10000028
343 Ga0207705_10054185
344 Ga0207705_10211548
345 Ga0207654_10001232
346 Ga0207654_10211021
347 Ga0207654_10445527
348 Ga0207654_10628558
349 Ga0207654_10762332
350 Ga0207707_10032232
351 Ga0207695_10048767
352 Ga0207695_10051475
353 Ga0207695_10112033
354 Ga0207695_10258347
355 Ga0207695_10271861
356 Ga0207695_10275423
357 Ga0207695_10276602
358 Ga0207695_10445519
359 Ga0207671_10002592
360 Ga0207671_10002948
361 Ga0207671_10012221
362 Ga0207671_10012759
363 Ga0207660_10105266
364 Ga0207657_10025232
365 Ga0207657_10049969
366 Ga0207652_10060802
367 Ga0207652_10111427
368 Ga0207694_10114508
369 Ga0207694_10715170
370 Ga0207650_10029962
371 Ga0207690_10015383
372 Ga0207706_10000036
373 Ga0207709_10095092
374 Ga0207670_10957244
375 Ga0207667_10000033
376 Ga0207667_10005555
377 Ga0207667_10008781
378 Ga0207667_10054252
379 Ga0207667_10068349
380 Ga0207667_10356430
381 Ga0207667_10401047
382 Ga0207651_10339240
383 Ga0207640_10017598
384 Ga0207639_10082806
385 Ga0207639_10350603
386 Ga0207702_10000133
387 Ga0207702_10004456
388 Ga0207702_10059547
389 Ga0207702_10250579
390 Ga0207702_10350009
391 Ga0207702_10870251
392 Ga0207674_10027706
393 Ga0268266_10000094
394 Ga0268264_10037784
395 Ga0265337_1053098
396 Ga0265334_10114817
397 Ga0265322_10011083
398 Ga0307517_10027859
399 Ga0265338_10189918
400 Ga0265338_10438387
401 Ga0265338_10494702
402 Ga0265327_10091996
403 Ga0307513_10605427
404 Ga0307509_10023170
405 Ga0307414_10126818
406 Ga0307510_10005596
407 Ga0395899_0000504
408 Ga0395899_0009627
409 Ga0395900_0000153
410 Ga0395900_0007895
411 Ga0395900_0829659
412 Ga0395898_0009794
413 Ga0395905_0000188
414 Ga0395905_0001681
415 Ga0395901_0000357
416 Ga0395901_0007718
417 Ga0436361_0172871
418 Ga0451793_1222676
419 Ga0439448_0034955
420 Ga0453684_0014305
421 Ga0466968_0034351
422 Ga0466959_0181617
423 Ga0451576_0158453
424 Ga0451576_0236029
425 Ga0495592_0435940
426 Ga0495605_0278267
427 Ga0495585_0156658
428 Ga0495606_0173456
429 Ga0495606_0257060
430 Ga0495616_0000819
431 Ga0495618_0238334
432 Ga0495631_0142451
433 Ga0495632_0027106
434 Ga0495644_0009915
435 Ga0495648_0065927
436 Ga0495625_0003156
437 Ga0495625_0068049
438 Ga0495625_0071455
439 Ga0495670_0215717
440 Ga0495671_0139558
441 Ga0495649_0165915
442 Ga0495683_0037061
443 Ga0495677_0061844
444 Ga0495686_0000154
445 Ga0495686_0011013
446 nmdc:mga0k408_41361_c1
447 Ga0500608_000746
448 2884637443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

4

157

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jf5-assembly1.cif.gz_A k2u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9239 9 153
5kob-assembly2.cif.gz_D crystal structure of a peptide deformylase from burkholderia xenovorans 0.9232 3 162
1v3y-assembly1.cif.gz_A the crystal structure of peptide deformylase from thermus thermophilus hb8 0.9165 9 153
6jf3-assembly1.cif.gz_B actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9118 2 153
5mte-assembly2.cif.gz_B crystal structure of pdf from the vibrio parahaemolyticus bacteriophage vp16t in complex with actinonin - crystal form ii 0.9055 9 149
ID Description Score Start End Superfamily
af_Q9VGY2_49_232_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9153 10 162 3.90.45.10
2ew5A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9024 10 153 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8989 9 149 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8977 3 162 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8932 1 156 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A7U3ZPH7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9849 5 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A258E949-F1-model_v4 Formylmethionine deformylase 0.9841 5 140 GO:0042586
GO:0043686
AF-A0A3N5EA08-F1-model_v4 Peptide deformylase 0.9826 67 163 GO:0042586
AF-A0A7D3WT40-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9821 5 164 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A1G5YPH1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9799 5 164 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map