F336491

General Info

Members Datasets Scaffolds Average Seq Length
224 155 448 189

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100385544|Ga0068857_1003855442
Length 213
Sequence MADPGRLRKAAPVRPLPQQESVDMPQPDHISKLGVPDPAGLDDDLNAIWQKCVDKLGFVPNVFSAYSLRPQRLRNFMAMYNEIMLSESGLSKLEREMVAVVVSSANRCFYCLVAHGAAVRALSGDAELGEMMALNYRVAKLDVRQRAMLDYAWKLTTTPSMIEDADRTTLHTAGLSSEDIFDLSETIAFFNLSNRMASSTDMMPNHEYHGTAR

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
153 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
154 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
155 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 1.34
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 1.34
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100385544 3300005577 Bacteria 1302
2 Ga0065712_10336623 3300005290 Bacteria 806
3 Ga0065715_10287071 3300005293 Bacteria 1072
4 Ga0065707_10610507 3300005295 Bacteria 684
5 Ga0070680_100167978 3300005336 Bacteria 1845
6 Ga0070714_100072965 3300005435 Bacteria 2973
7 Ga0070714_100364755 3300005435 Unclassified 1359
8 Ga0070713_100029449 3300005436 Bacteria 4350
9 Ga0070713_100250539 3300005436 Bacteria 1615
10 Ga0070705_100052727 3300005440 Bacteria 2378
11 Ga0070694_100006411 3300005444 Bacteria 7137
12 Ga0070678_100269952 3300005456 Bacteria 1434
13 Ga0070681_10197337 3300005458 Bacteria 1931
14 Ga0070706_100095316 3300005467 Bacteria 2762
15 Ga0070707_100731103 3300005468 Bacteria 953
16 Ga0070698_100005436 3300005471 Bacteria 13910
17 Ga0070698_100325488 3300005471 Bacteria 1468
18 Ga0070679_100052158 3300005530 Bacteria 4075
19 Ga0070696_100683067 3300005546 Bacteria 835
20 Ga0070704_100073479 3300005549 Bacteria 2491
21 Ga0068856_100322057 3300005614 Bacteria 1563
22 Ga0081455_10130750 3300005937 Bacteria 1963
23 Ga0081455_10228571 3300005937 Bacteria 1374
24 Ga0081540_1029707 3300005983 Bacteria 3040
25 Ga0070717_10002845 3300006028 Bacteria 12269
26 Ga0070717_10020608 3300006028 Bacteria 5188
27 Ga0070717_10054018 3300006028 Bacteria 3312
28 Ga0070717_10918962 3300006028 Unclassified 797
29 Ga0070712_100040632 3300006175 Bacteria 3190
30 Ga0070712_100101570 3300006175 Bacteria 2128
31 Ga0075430_100151501 3300006846 Bacteria 1931
32 Ga0075434_101420329 3300006871 Bacteria 704
33 Ga0105245_10777508 3300009098 Bacteria 994
34 Ga0105237_10417109 3300009545 Bacteria 1348
35 Ga0105239_10760434 3300010375 Bacteria 1109
36 Ga0105239_10996284 3300010375 Bacteria 963
37 Ga0105246_10403391 3300011119 Bacteria 1136
38 Ga0163162_11156364 3300013306 Unclassified 878
39 Ga0157375_11638594 3300013308 Bacteria 761
40 Ga0163163_10135947 3300014325 Bacteria 2500
41 Ga0182008_10025487 3300014497 Bacteria 3003
42 Ga0197907_10417977 3300020069 Unclassified 1197
43 Ga0213872_10022603 3300021361 Bacteria 2896
44 Ga0213874_10204810 3300021377 Bacteria 711
45 Ga0213876_10002326 3300021384 Bacteria 11218
46 Ga0213876_10269645 3300021384 Unclassified 905
47 Ga0213875_10049847 3300021388 Bacteria 1962
48 Ga0213871_10055401 3300021441 Bacteria 1095
49 Ga0224712_10073877 3300022467 Unclassified 1392
50 Ga0224712_10241763 3300022467 Bacteria 832
51 Ga0228598_1002683 3300024227 Bacteria 3856
52 Ga0207684_10065158 3300025910 Bacteria 3094
53 Ga0207707_10877683 3300025912 Bacteria 743
54 Ga0207663_10228731 3300025916 Bacteria 1357
55 Ga0207660_10460278 3300025917 Bacteria 1029
56 Ga0207652_10040062 3300025921 Bacteria 3978
57 Ga0207646_10412298 3300025922 Bacteria 1220
58 Ga0207700_10070234 3300025928 Bacteria 2691
59 Ga0207700_10131018 3300025928 Bacteria 2047
60 Ga0207700_10204605 3300025928 Unclassified 1665
61 Ga0207700_10524976 3300025928 Bacteria 1049
62 Ga0207700_11122843 3300025928 Unclassified 703
63 Ga0207679_10293797 3300025945 Bacteria 1398
64 Ga0207658_10152359 3300025986 Bacteria 1885
65 Ga0207702_10185950 3300026078 Bacteria 1916
66 Ga0268266_10267261 3300028379 Bacteria 1587
67 Ga0268264_10940910 3300028381 Bacteria 869
68 Ga0265337_1045624 3300028556 Bacteria 1246
69 Ga0265338_10230826 3300028800 Bacteria 1376
70 Ga0265338_10277853 3300028800 Bacteria 1225
71 Ga0265338_10427658 3300028800 Bacteria 940
72 Ga0265320_10003950 3300031240 Bacteria 9785
73 Ga0265340_10346633 3300031247 Bacteria 656
74 Ga0265339_10363106 3300031249 Bacteria 681
75 Ga0265327_10008084 3300031251 Bacteria 7922
76 Ga0265313_10000308 3300031595 Bacteria 53080
77 Ga0265314_10001084 3300031711 Bacteria 31473
78 Ga0373926_0024157 3300035083 Bacteria 2115
79 Ga0373923_0307197 3300035111 Bacteria 751
80 Ga0373923_0436311 3300035111 Bacteria 634
81 Ga0373936_0249256 3300035113 Bacteria 793
82 Ga0373954_0059473 3300035118 Bacteria 1801
83 Ga0373956_0018042 3300035119 Bacteria 2985
84 Ga0373960_0177532 3300035121 Bacteria 742
85 Ga0373943_0134541 3300035170 Bacteria 1326
86 Ga0373961_0017115 3300035241 Bacteria 1876
87 Ga0373924_0040652 3300035410 Bacteria 1904
88 Ga0373935_0186531 3300035692 Bacteria 1426
89 Ga0373935_0317447 3300035692 Bacteria 1105
90 Ga0373935_0462938 3300035692 Bacteria 917
91 Ga0373927_0107924 3300035695 Bacteria 1813
92 Ga0373933_0016113 3300035724 Bacteria 4176
93 Ga0373933_0311412 3300035724 Bacteria 1020
94 Ga0373947_0041325 3300035725 Bacteria 2749
95 Ga0373947_0246077 3300035725 Bacteria 1181
96 Ga0373937_0014202 3300036401 Bacteria 7027
97 Ga0373937_0019499 3300036401 Bacteria 6068
98 Ga0373937_0025747 3300036401 Bacteria 5312
99 Ga0373937_0038931 3300036401 Bacteria 4332
100 Ga0373937_0148098 3300036401 Bacteria 2198
101 Ga0373937_0319923 3300036401 Bacteria 1468
102 Ga0373925_0025359 3300037068 Bacteria 4331
103 Ga0373925_0026429 3300037068 Bacteria 4247
104 Ga0436364_0119714 3300037853 Bacteria 1711
105 Ga0436364_1323115 3300037853 Bacteria 5333
106 Ga0436365_0065660 3300039437 Bacteria 807
107 Ga0436365_0686003 3300039437 Bacteria 1201
108 Ga0436365_1707303 3300039437 Bacteria 7296
109 Ga0436360_0081421 3300039438 Bacteria 1677
110 Ga0436360_0083486 3300039438 Bacteria 1980
111 Ga0436360_1053116 3300039438 Bacteria 1201
112 Ga0436361_0381913 3300039447 Bacteria 3438
113 Ga0436361_0601350 3300039447 Bacteria 3271
114 Ga0436361_0793496 3300039447 Bacteria 2340
115 Ga0436361_0813694 3300039447 Bacteria 12222
116 Ga0436363_0423875 3300039450 Bacteria 3445
117 Ga0436363_0469350 3300039450 Bacteria 1067
118 Ga0436363_0521081 3300039450 Bacteria 1204
119 Ga0436362_0363862 3300039453 Bacteria 1176
120 Ga0436362_0777190 3300039453 Bacteria 2513
121 Ga0451577_0505357 3300042876 Bacteria 1097
122 Ga0451577_0516453 3300042876 Bacteria 1084
123 Ga0453683_0055745 3300044673 Bacteria 2474
124 Ga0466963_0224217 3300044694 Bacteria 1317
125 Ga0453684_0000071 3300044712 Bacteria 448904
126 Ga0453684_0044731 3300044712 Bacteria 5918
127 Ga0451576_0184707 3300045051 Bacteria 2177
128 Ga0451576_0810307 3300045051 Bacteria 983
129 Ga0466967_0206003 3300045976 Bacteria 1864
130 Ga0495592_0081713 3300046454 Bacteria 2336
131 Ga0495592_0586596 3300046454 Bacteria 681
132 Ga0495651_0014209 3300046462 Bacteria 6154
133 Ga0495651_0037460 3300046462 Bacteria 3775
134 Ga0495653_0152754 3300046463 Bacteria 1611
135 Ga0495653_0504869 3300046463 Bacteria 753
136 Ga0495664_0003872 3300046477 Bacteria 8165
137 Ga0495664_0382198 3300046477 Bacteria 846
138 Ga0495608_0130915 3300046511 Bacteria 1605
139 Ga0495618_0156168 3300046514 Bacteria 1456
140 Ga0495628_0203431 3300046516 Bacteria 1491
141 Ga0495628_0439657 3300046516 Bacteria 948
142 Ga0495628_0463719 3300046516 Bacteria 919
143 Ga0495652_0493755 3300046529 Bacteria 850
144 Ga0495587_0042218 3300046536 Bacteria 2720
145 Ga0495587_0107619 3300046536 Bacteria 1603
146 Ga0495645_0032976 3300046543 Bacteria 3777
147 Ga0495667_0037540 3300046559 Bacteria 3228
148 Ga0495667_0136311 3300046559 Bacteria 1582
149 Ga0495635_0018590 3300046663 Bacteria 4848
150 Ga0495635_0345722 3300046663 Bacteria 993
151 Ga0495657_0086821 3300046675 Bacteria 2014
152 Ga0495657_0101978 3300046675 Bacteria 1827
153 Ga0495599_0016319 3300046678 Bacteria 4611
154 Ga0495623_0105039 3300046679 Bacteria 1717
155 Ga0495646_0010647 3300046680 Bacteria 5842
156 Ga0495646_0161891 3300046680 Bacteria 1238
157 Ga0495613_0601624 3300046689 Bacteria 732
158 Ga0495600_0015753 3300046809 Bacteria 4787
159 Ga0495600_0083643 3300046809 Bacteria 2083
160 Ga0495604_0020708 3300047317 Bacteria 5251
161 Ga0495674_0031377 3300047319 Bacteria 4827
162 Ga0495674_0149541 3300047319 Bacteria 1959
163 Ga0495674_0337733 3300047319 Bacteria 1225
164 Ga0495680_0158966 3300047322 Bacteria 1642
165 Ga0495602_0004753 3300048088 Bacteria 14201
166 Ga0495602_0112989 3300048088 Bacteria 2202
167 Ga0496102_0174550 3300048905 Bacteria 2023
168 Ga0496108_0912217 3300048911 Bacteria 754
169 Ga0496112_0638379 3300048915 Bacteria 995
170 Ga0496119_0016338 3300048922 Bacteria 5654
171 Ga0496120_0093623 3300048923 Bacteria 1601
172 Ga0496120_0143314 3300048923 Bacteria 1210
173 Ga0501031_0143195 3300049568 Bacteria 1562
174 Ga0501032_0686844 3300049569 Bacteria 649
175 Ga0501033_0038737 3300049570 Bacteria 3561
176 Ga0501034_0520921 3300049571 Bacteria 1101
177 Ga0501034_0634863 3300049571 Bacteria 971
178 Ga0501037_0021404 3300049573 Bacteria 4778
179 Ga0501038_0023296 3300049574 Bacteria 5538
180 Ga0501040_0005485 3300049576 Bacteria 8209
181 Ga0501041_0018182 3300049577 Bacteria 4186
182 Ga0501043_0041039 3300049579 Bacteria 3636
183 Ga0501043_0312990 3300049579 Bacteria 1198
184 Ga0501046_0018028 3300049580 Bacteria 5883
185 Ga0501048_0071009 3300049582 Bacteria 2458
186 Ga0501067_0081844 3300049583 Bacteria 1790
187 Ga0501069_0017279 3300049585 Bacteria 3881
188 Ga0501070_0061298 3300049586 Bacteria 3117
189 Ga0501070_0102100 3300049586 Bacteria 2372
190 Ga0501072_0017505 3300049588 Bacteria 5507
191 Ga0501073_0070213 3300049589 Bacteria 2440
192 Ga0501073_0145369 3300049589 Bacteria 1643
193 Ga0501073_0198941 3300049589 Bacteria 1386
194 Ga0501074_0006592 3300049590 Bacteria 8394
195 Ga0501074_0329289 3300049590 Bacteria 1084
196 Ga0501075_0016637 3300049591 Bacteria 5302
197 Ga0501076_0016473 3300049592 Bacteria 5603
198 Ga0501077_0043854 3300049593 Bacteria 2842
199 Ga0501079_0006962 3300049741 Bacteria 8522
200 Ga0501080_0312571 3300049742 Bacteria 1424
201 Ga0501081_0006180 3300049743 Bacteria 7757
202 Ga0501083_0009049 3300049744 Bacteria 7032
203 Ga0501035_0030631 3300049822 Bacteria 4904
204 Ga0501035_0432861 3300049822 Bacteria 1091
205 Ga0501044_0051304 3300049823 Bacteria 4254
206 Ga0501044_0157221 3300049823 Bacteria 2252
207 Ga0501044_0514515 3300049823 Bacteria 1097
208 Ga0501045_0001924 3300049824 Bacteria 14010
209 nmdc:mga03n38_251577_c1 3300050490 Bacteria 933
210 nmdc:mga00v17_109858_c1 3300050491 Bacteria 1748
211 nmdc:mga0qj67_245002_c1 3300050509 Bacteria 1454
212 nmdc:mga0sz30_98408_c1 3300050516 Bacteria 1276
213 Ga0495601_0007678 3300053077 Bacteria 6340
214 Ga0495612_0002788 3300053078 Bacteria 7231
215 Ga0495595_0023054 3300053084 Bacteria 2738
216 Ga0495595_0200270 3300053084 Bacteria 994
217 Ga0495619_0012492 3300053085 Bacteria 5349
218 Ga0495619_0313295 3300053085 Bacteria 1087
219 Ga0501082_0056542 3300060353 Bacteria 3380
220 Ga0530510_0011254 3300061734 Bacteria 6276
221 2739612847 2739367655 Bacteria 4051151
222 2846954564 2846952575 Bacteria 6587527
223 2848859171 2848858292 Bacteria 7391279
224 8054006354 8054002106 Bacteria 7987183
225 Ga0068857_100385544
226 Ga0065712_10336623
227 Ga0065715_10287071
228 Ga0065707_10610507
229 Ga0070680_100167978
230 Ga0070714_100072965
231 Ga0070714_100364755
232 Ga0070713_100029449
233 Ga0070713_100250539
234 Ga0070705_100052727
235 Ga0070694_100006411
236 Ga0070678_100269952
237 Ga0070681_10197337
238 Ga0070706_100095316
239 Ga0070707_100731103
240 Ga0070698_100005436
241 Ga0070698_100325488
242 Ga0070679_100052158
243 Ga0070696_100683067
244 Ga0070704_100073479
245 Ga0068856_100322057
246 Ga0081455_10130750
247 Ga0081455_10228571
248 Ga0081540_1029707
249 Ga0070717_10002845
250 Ga0070717_10020608
251 Ga0070717_10054018
252 Ga0070717_10918962
253 Ga0070712_100040632
254 Ga0070712_100101570
255 Ga0075430_100151501
256 Ga0075434_101420329
257 Ga0105245_10777508
258 Ga0105237_10417109
259 Ga0105239_10760434
260 Ga0105239_10996284
261 Ga0105246_10403391
262 Ga0163162_11156364
263 Ga0157375_11638594
264 Ga0163163_10135947
265 Ga0182008_10025487
266 Ga0197907_10417977
267 Ga0213872_10022603
268 Ga0213874_10204810
269 Ga0213876_10002326
270 Ga0213876_10269645
271 Ga0213875_10049847
272 Ga0213871_10055401
273 Ga0224712_10073877
274 Ga0224712_10241763
275 Ga0228598_1002683
276 Ga0207684_10065158
277 Ga0207707_10877683
278 Ga0207663_10228731
279 Ga0207660_10460278
280 Ga0207652_10040062
281 Ga0207646_10412298
282 Ga0207700_10070234
283 Ga0207700_10131018
284 Ga0207700_10204605
285 Ga0207700_10524976
286 Ga0207700_11122843
287 Ga0207679_10293797
288 Ga0207658_10152359
289 Ga0207702_10185950
290 Ga0268266_10267261
291 Ga0268264_10940910
292 Ga0265337_1045624
293 Ga0265338_10230826
294 Ga0265338_10277853
295 Ga0265338_10427658
296 Ga0265320_10003950
297 Ga0265340_10346633
298 Ga0265339_10363106
299 Ga0265327_10008084
300 Ga0265313_10000308
301 Ga0265314_10001084
302 Ga0373926_0024157
303 Ga0373923_0307197
304 Ga0373923_0436311
305 Ga0373936_0249256
306 Ga0373954_0059473
307 Ga0373956_0018042
308 Ga0373960_0177532
309 Ga0373943_0134541
310 Ga0373961_0017115
311 Ga0373924_0040652
312 Ga0373935_0186531
313 Ga0373935_0317447
314 Ga0373935_0462938
315 Ga0373927_0107924
316 Ga0373933_0016113
317 Ga0373933_0311412
318 Ga0373947_0041325
319 Ga0373947_0246077
320 Ga0373937_0014202
321 Ga0373937_0019499
322 Ga0373937_0025747
323 Ga0373937_0038931
324 Ga0373937_0148098
325 Ga0373937_0319923
326 Ga0373925_0025359
327 Ga0373925_0026429
328 Ga0436364_0119714
329 Ga0436364_1323115
330 Ga0436365_0065660
331 Ga0436365_0686003
332 Ga0436365_1707303
333 Ga0436360_0081421
334 Ga0436360_0083486
335 Ga0436360_1053116
336 Ga0436361_0381913
337 Ga0436361_0601350
338 Ga0436361_0793496
339 Ga0436361_0813694
340 Ga0436363_0423875
341 Ga0436363_0469350
342 Ga0436363_0521081
343 Ga0436362_0363862
344 Ga0436362_0777190
345 Ga0451577_0505357
346 Ga0451577_0516453
347 Ga0453683_0055745
348 Ga0466963_0224217
349 Ga0453684_0000071
350 Ga0453684_0044731
351 Ga0451576_0184707
352 Ga0451576_0810307
353 Ga0466967_0206003
354 Ga0495592_0081713
355 Ga0495592_0586596
356 Ga0495651_0014209
357 Ga0495651_0037460
358 Ga0495653_0152754
359 Ga0495653_0504869
360 Ga0495664_0003872
361 Ga0495664_0382198
362 Ga0495608_0130915
363 Ga0495618_0156168
364 Ga0495628_0203431
365 Ga0495628_0439657
366 Ga0495628_0463719
367 Ga0495652_0493755
368 Ga0495587_0042218
369 Ga0495587_0107619
370 Ga0495645_0032976
371 Ga0495667_0037540
372 Ga0495667_0136311
373 Ga0495635_0018590
374 Ga0495635_0345722
375 Ga0495657_0086821
376 Ga0495657_0101978
377 Ga0495599_0016319
378 Ga0495623_0105039
379 Ga0495646_0010647
380 Ga0495646_0161891
381 Ga0495613_0601624
382 Ga0495600_0015753
383 Ga0495600_0083643
384 Ga0495604_0020708
385 Ga0495674_0031377
386 Ga0495674_0149541
387 Ga0495674_0337733
388 Ga0495680_0158966
389 Ga0495602_0004753
390 Ga0495602_0112989
391 Ga0496102_0174550
392 Ga0496108_0912217
393 Ga0496112_0638379
394 Ga0496119_0016338
395 Ga0496120_0093623
396 Ga0496120_0143314
397 Ga0501031_0143195
398 Ga0501032_0686844
399 Ga0501033_0038737
400 Ga0501034_0520921
401 Ga0501034_0634863
402 Ga0501037_0021404
403 Ga0501038_0023296
404 Ga0501040_0005485
405 Ga0501041_0018182
406 Ga0501043_0041039
407 Ga0501043_0312990
408 Ga0501046_0018028
409 Ga0501048_0071009
410 Ga0501067_0081844
411 Ga0501069_0017279
412 Ga0501070_0061298
413 Ga0501070_0102100
414 Ga0501072_0017505
415 Ga0501073_0070213
416 Ga0501073_0145369
417 Ga0501073_0198941
418 Ga0501074_0006592
419 Ga0501074_0329289
420 Ga0501075_0016637
421 Ga0501076_0016473
422 Ga0501077_0043854
423 Ga0501079_0006962
424 Ga0501080_0312571
425 Ga0501081_0006180
426 Ga0501083_0009049
427 Ga0501035_0030631
428 Ga0501035_0432861
429 Ga0501044_0051304
430 Ga0501044_0157221
431 Ga0501044_0514515
432 Ga0501045_0001924
433 nmdc:mga03n38_251577_c1
434 nmdc:mga00v17_109858_c1
435 nmdc:mga0qj67_245002_c1
436 nmdc:mga0sz30_98408_c1
437 Ga0495601_0007678
438 Ga0495612_0002788
439 Ga0495595_0023054
440 Ga0495595_0200270
441 Ga0495619_0012492
442 Ga0495619_0313295
443 Ga0501082_0056542
444 Ga0530510_0011254
445 2739612847
446 2846954564
447 2848859171
448 8054006354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

70

149

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.9538 5 190
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.9514 6 190
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.9507 7 190
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.9489 5 190
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9472 7 185
ID Description Score Start End Superfamily
2prrG01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.9686 14 61 1.20.5.810
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9621 67 186 1.20.1290.10
2prrD01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.962 14 61 1.20.5.810
3c1lA02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9608 67 186 1.20.1290.10
2prrA01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.9592 14 61 1.20.5.810
ID Description Score Start End GO Terms
AF-A0A7Z9MLV0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9734 36 175 GO:0051920
AF-A0A0M0SU11-F1-model_v4 deleted 0.9732 6 190
AF-A0A2E9GGR7-F1-model_v4 Alkylhydroperoxidase 0.9694 23 190 GO:0051920
AF-A0A529QFB3-F1-model_v4 Alkylhydroperoxidase 0.9686 57 190 GO:0051920
AF-A0A528DBG6-F1-model_v4 Alkylhydroperoxidase 0.9682 37 190 GO:0051920

Map