F336432

General Info

Members Datasets Scaffolds Average Seq Length
224 147 448 117

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101161628|Ga0070708_1011616282
Length 140
Sequence VGDLIRPENVSPIQNPNTTPELPEEAVLLRIFVGEDDHYKRHPLYEAIVLKAREMRLAGATVLRGPLGFGKSSHMHTAKILRLSMDLPMVIEIVDSLEKINAFLPHLEGMMRGGLVTMERAQVIRYKQSPHPLKRGKHSS

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.45
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0.45
Rhizoplane 4.91
Rhizosphere 92.41
Stem 0
Stem Tuber 0
Unclassified 16.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101161628 3300005445 Bacteria 722
2 SwRhRL3b_contig_1739289 2162886006 Bacteria 1115
3 SwRhRL3b_contig_3759297 2162886006 Bacteria 1675
4 Ga0065707_10021638 3300005295 Bacteria 1650
5 Ga0070690_100362547 3300005330 Bacteria 1055
6 Ga0070670_100925405 3300005331 Bacteria 791
7 Ga0070677_10904783 3300005333 Unclassified 510
8 Ga0068868_100019170 3300005338 Bacteria 5125
9 Ga0070660_100721936 3300005339 Bacteria 836
10 Ga0070689_100002848 3300005340 Bacteria 11367
11 Ga0070689_101006666 3300005340 Bacteria 741
12 Ga0070668_100222612 3300005347 Bacteria 1557
13 Ga0070713_100037188 3300005436 Unclassified 3935
14 Ga0070710_10275156 3300005437 Bacteria 1090
15 Ga0070711_100008530 3300005439 Bacteria 6282
16 Ga0070711_100728527 3300005439 Bacteria 837
17 Ga0070705_101405521 3300005440 Bacteria 582
18 Ga0070708_100527515 3300005445 Bacteria 1114
19 Ga0070663_101206754 3300005455 Bacteria 665
20 Ga0070685_10643370 3300005466 Bacteria 767
21 Ga0070685_10794860 3300005466 Bacteria 697
22 Ga0070706_100129080 3300005467 Bacteria 2358
23 Ga0070706_100268784 3300005467 Bacteria 1591
24 Ga0070706_100689378 3300005467 Bacteria 948
25 Ga0070707_100113118 3300005468 Bacteria 2634
26 Ga0070698_100000532 3300005471 Bacteria 40626
27 Ga0070698_100578927 3300005471 Bacteria 1063
28 Ga0070699_100248607 3300005518 Bacteria 1588
29 Ga0070699_100288208 3300005518 Bacteria 1472
30 Ga0070697_100072614 3300005536 Bacteria 2823
31 Ga0070697_100276593 3300005536 Bacteria 1440
32 Ga0070686_101589463 3300005544 Unclassified 553
33 Ga0068855_100015661 3300005563 Bacteria 9124
34 Ga0068855_100108407 3300005563 Bacteria 3190
35 Ga0068857_100024074 3300005577 Bacteria 5360
36 Ga0068857_101207704 3300005577 Unclassified 732
37 Ga0068854_102007176 3300005578 Bacteria 533
38 Ga0070702_100104380 3300005615 Bacteria 1745
39 Ga0068852_101289241 3300005616 Bacteria 752
40 Ga0068859_100285600 3300005617 Bacteria 1743
41 Ga0068859_100388496 3300005617 Unclassified 1491
42 Ga0068863_100207971 3300005841 Bacteria 1884
43 Ga0068858_100214425 3300005842 Unclassified 1822
44 Ga0081455_10018271 3300005937 Bacteria 6686
45 Ga0081455_10279510 3300005937 Bacteria 1207
46 Ga0081455_10984891 3300005937 Unclassified 522
47 Ga0070715_10938038 3300006163 Bacteria 535
48 Ga0070712_100046451 3300006175 Unclassified 3002
49 Ga0070712_100096095 3300006175 Bacteria 2181
50 Ga0070712_100396245 3300006175 Bacteria 1139
51 Ga0070712_101018191 3300006175 Unclassified 717
52 Ga0097621_100824605 3300006237 Bacteria 860
53 Ga0068871_100361495 3300006358 Bacteria 1286
54 Ga0075428_100222667 3300006844 Bacteria 2037
55 Ga0068865_100522987 3300006881 Bacteria 992
56 Ga0068865_101021296 3300006881 Unclassified 725
57 Ga0097620_100285586 3300006931 Bacteria 1743
58 Ga0097620_100388478 3300006931 Unclassified 1491
59 Ga0099794_10014484 3300007265 Unclassified 3456
60 Ga0099794_10036916 3300007265 Bacteria 2312
61 Ga0099794_10070442 3300007265 Bacteria 1712
62 Ga0105240_10006339 3300009093 Bacteria 17416
63 Ga0105240_10080795 3300009093 Bacteria 3997
64 Ga0111539_10077443 3300009094 Bacteria 3914
65 Ga0105245_10606666 3300009098 Bacteria 1121
66 Ga0114129_10298736 3300009147 Bacteria 2147
67 Ga0114129_10506044 3300009147 Bacteria 1577
68 Ga0114129_12280134 3300009147 Unclassified 650
69 Ga0105237_11321868 3300009545 Bacteria 727
70 Ga0099796_10186849 3300010159 Bacteria 834
71 Ga0105239_10582503 3300010375 Unclassified 1276
72 Ga0157369_12100671 3300013105 Bacteria 573
73 Ga0157369_12602917 3300013105 Bacteria 511
74 Ga0171462_1018 3300013250 Bacteria 157875
75 Ga0157374_10348310 3300013296 Bacteria 1471
76 Ga0157374_11360875 3300013296 Unclassified 732
77 Ga0157378_11127380 3300013297 Bacteria 822
78 Ga0163162_10265244 3300013306 Bacteria 1849
79 Ga0213876_10027054 3300021384 Bacteria 3027
80 Ga0209148_1000463 3300025254 Bacteria 43711
81 Ga0209455_1000550 3300025272 Bacteria 25550
82 Ga0207684_10195783 3300025910 Bacteria 1743
83 Ga0207707_11083476 3300025912 Bacteria 654
84 Ga0207695_10000270 3300025913 Bacteria 130172
85 Ga0207695_10002531 3300025913 Bacteria 26844
86 Ga0207695_10852403 3300025913 Bacteria 791
87 Ga0207693_10113289 3300025915 Bacteria 2128
88 Ga0207693_10509286 3300025915 Bacteria 939
89 Ga0207693_10617764 3300025915 Bacteria 843
90 Ga0207663_10052907 3300025916 Bacteria 2534
91 Ga0207663_10445009 3300025916 Unclassified 998
92 Ga0207652_10013642 3300025921 Bacteria 6569
93 Ga0207646_10434127 3300025922 Unclassified 1185
94 Ga0207687_10560334 3300025927 Bacteria 959
95 Ga0207670_10000858 3300025936 Bacteria 15964
96 Ga0207704_10460439 3300025938 Bacteria 1017
97 Ga0207667_10731328 3300025949 Unclassified 990
98 Ga0207667_11793568 3300025949 Bacteria 578
99 Ga0207651_10860326 3300025960 Bacteria 806
100 Ga0207668_10639839 3300025972 Bacteria 930
101 Ga0207677_10055819 3300026023 Bacteria 2703
102 Ga0207703_10863318 3300026035 Bacteria 866
103 Ga0207641_10184642 3300026088 Bacteria 1912
104 Ga0207674_10028412 3300026116 Bacteria 5904
105 Ga0209588_1154457 3300027671 Bacteria 726
106 Ga0265337_1000509 3300028556 Bacteria 20691
107 Ga0265337_1005867 3300028556 Bacteria 4810
108 Ga0265319_1000897 3300028563 Bacteria 18748
109 Ga0265319_1002709 3300028563 Bacteria 9503
110 Ga0265319_1004107 3300028563 Bacteria 7326
111 Ga0265334_10021108 3300028573 Bacteria 2661
112 Ga0265334_10100105 3300028573 Bacteria 1050
113 Ga0265318_10004508 3300028577 Bacteria 6736
114 Ga0265318_10007931 3300028577 Bacteria 4762
115 Ga0265318_10011009 3300028577 Bacteria 3915
116 Ga0265323_10159425 3300028653 Unclassified 720
117 Ga0265322_10022997 3300028654 Bacteria 1783
118 Ga0265336_10002066 3300028666 Bacteria 8549
119 Ga0265336_10041972 3300028666 Bacteria 1397
120 Ga0265338_10000082 3300028800 Bacteria 176343
121 Ga0265338_10004541 3300028800 Bacteria 18691
122 Ga0265338_10015896 3300028800 Bacteria 8234
123 Ga0265338_10023694 3300028800 Bacteria 6297
124 Ga0265338_10080656 3300028800 Bacteria 2733
125 Ga0265324_10002459 3300029957 Bacteria 9428
126 Ga0265324_10010332 3300029957 Bacteria 3604
127 Ga0265324_10040658 3300029957 Bacteria 1610
128 Ga0265324_10288489 3300029957 Bacteria 558
129 Ga0265760_10358643 3300031090 Bacteria 522
130 Ga0265330_10143947 3300031235 Bacteria 1013
131 Ga0265332_10267750 3300031238 Bacteria 706
132 Ga0265332_10320318 3300031238 Bacteria 640
133 Ga0265328_10237799 3300031239 Bacteria 696
134 Ga0265320_10000309 3300031240 Bacteria 39981
135 Ga0265320_10000571 3300031240 Bacteria 28297
136 Ga0265320_10022038 3300031240 Bacteria 3416
137 Ga0265325_10012961 3300031241 Bacteria 4755
138 Ga0265325_10056475 3300031241 Bacteria 2005
139 Ga0265340_10018057 3300031247 Bacteria 3643
140 Ga0265339_10016332 3300031249 Bacteria 4428
141 Ga0265339_10023351 3300031249 Bacteria 3576
142 Ga0265339_10147785 3300031249 Bacteria 1191
143 Ga0265327_10011860 3300031251 Bacteria 5954
144 Ga0265316_10003494 3300031344 Bacteria 15857
145 Ga0265316_10059817 3300031344 Bacteria 2962
146 Ga0265316_10361535 3300031344 Bacteria 1049
147 Ga0265316_10949847 3300031344 Bacteria 599
148 Ga0265313_10004629 3300031595 Bacteria 10427
149 Ga0265313_10008833 3300031595 Bacteria 6634
150 Ga0265313_10372841 3300031595 Unclassified 563
151 Ga0265314_10007575 3300031711 Bacteria 9406
152 Ga0265314_10131495 3300031711 Bacteria 1561
153 Ga0265342_10037344 3300031712 Bacteria 2963
154 Ga0265342_10041054 3300031712 Bacteria 2803
155 Ga0265342_10046365 3300031712 Bacteria 2612
156 Ga0265342_10690350 3300031712 Unclassified 511
157 Ga0373944_0281697 3300035089 Bacteria 620
158 Ga0373923_0097061 3300035111 Bacteria 1296
159 Ga0373945_0432625 3300035116 Unclassified 580
160 Ga0373954_0289299 3300035118 Bacteria 808
161 Ga0373957_0095221 3300035120 Unclassified 1187
162 Ga0373955_0039656 3300035172 Bacteria 2515
163 Ga0373924_0028670 3300035410 Bacteria 2220
164 Ga0373935_0559839 3300035692 Bacteria 834
165 Ga0373927_0330264 3300035695 Bacteria 1004
166 Ga0373927_0401497 3300035695 Bacteria 904
167 Ga0373933_0007662 3300035724 Bacteria 5895
168 Ga0373933_0232068 3300035724 Bacteria 1185
169 Ga0373947_0745650 3300035725 Bacteria 668
170 Ga0373937_0003696 3300036401 Bacteria 12921
171 Ga0316584_0015616 3300036712 Bacteria 5432
172 Ga0373925_0090929 3300037068 Bacteria 2334
173 Ga0373925_0411590 3300037068 Bacteria 1104
174 Ga0395901_0989450 3300038443 Bacteria 818
175 Ga0436365_1008527 3300039437 Bacteria 3614
176 Ga0436365_1346650 3300039437 Bacteria 1378
177 Ga0436360_1269461 3300039438 Bacteria 4667
178 Ga0436362_0908296 3300039453 Bacteria 1307
179 Ga0451577_0008988 3300042876 Bacteria 9656
180 Ga0451577_0105543 3300042876 Bacteria 2518
181 Ga0451577_0521633 3300042876 Bacteria 1079
182 Ga0453683_1126729 3300044673 Bacteria 524
183 Ga0453684_0966669 3300044712 Bacteria 908
184 Ga0451576_0040369 3300045051 Bacteria 4940
185 Ga0451576_0894734 3300045051 Bacteria 931
186 Ga0466967_1296020 3300045976 Bacteria 726
187 Ga0495651_0408657 3300046462 Unclassified 885
188 Ga0495652_0395329 3300046529 Unclassified 980
189 Ga0495667_0255618 3300046559 Unclassified 1115
190 Ga0495667_0474532 3300046559 Unclassified 785
191 Ga0495659_0099135 3300046664 Bacteria 1127
192 Ga0495657_0273854 3300046675 Unclassified 1012
193 Ga0495657_0524150 3300046675 Unclassified 690
194 Ga0495599_0239115 3300046678 Bacteria 1108
195 Ga0495599_0246697 3300046678 Bacteria 1088
196 Ga0495646_0432683 3300046680 Unclassified 681
197 Ga0495674_0144586 3300047319 Bacteria 1997
198 Ga0495675_0026614 3300047444 Unclassified 3689
199 Ga0495684_0370150 3300047471 Bacteria 1013
200 Ga0495602_0047938 3300048088 Bacteria 3845
201 Ga0495602_0674405 3300048088 Bacteria 704
202 Ga0496100_1452809 3300048903 Unclassified 541
203 Ga0496101_0173320 3300048904 Bacteria 1659
204 Ga0496104_0083116 3300048907 Unclassified 3054
205 Ga0496105_0109552 3300048908 Unclassified 2280
206 Ga0496108_0793764 3300048911 Bacteria 817
207 Ga0496111_0304659 3300048914 Bacteria 1181
208 Ga0496112_0016096 3300048915 Bacteria 6993
209 Ga0496112_0881529 3300048915 Bacteria 817
210 Ga0496113_0089938 3300048916 Bacteria 2364
211 Ga0496114_0023037 3300048917 Bacteria 5077
212 Ga0496115_0004905 3300048918 Bacteria 9712
213 Ga0501039_1026092 3300049575 Unclassified 640
214 Ga0501043_0591053 3300049579 Bacteria 821
215 Ga0501047_0169701 3300049581 Bacteria 2051
216 Ga0501080_0028744 3300049742 Bacteria 5176
217 Ga0501083_0368270 3300049744 Bacteria 934
218 Ga0501083_0714096 3300049744 Bacteria 652
219 Ga0501035_0004287 3300049822 Bacteria 13543
220 nmdc:mga05p37_29395_c1 3300050507 Bacteria 6706
221 Ga0495619_0148410 3300053085 Bacteria 1617
222 Ga0495619_0186233 3300053085 Bacteria 1437
223 Ga0495619_0784848 3300053085 Unclassified 645
224 2514592583 2513237351 Bacteria 6968952
225 Ga0070708_101161628
226 SwRhRL3b_contig_1739289
227 SwRhRL3b_contig_3759297
228 Ga0065707_10021638
229 Ga0070690_100362547
230 Ga0070670_100925405
231 Ga0070677_10904783
232 Ga0068868_100019170
233 Ga0070660_100721936
234 Ga0070689_100002848
235 Ga0070689_101006666
236 Ga0070668_100222612
237 Ga0070713_100037188
238 Ga0070710_10275156
239 Ga0070711_100008530
240 Ga0070711_100728527
241 Ga0070705_101405521
242 Ga0070708_100527515
243 Ga0070663_101206754
244 Ga0070685_10643370
245 Ga0070685_10794860
246 Ga0070706_100129080
247 Ga0070706_100268784
248 Ga0070706_100689378
249 Ga0070707_100113118
250 Ga0070698_100000532
251 Ga0070698_100578927
252 Ga0070699_100248607
253 Ga0070699_100288208
254 Ga0070697_100072614
255 Ga0070697_100276593
256 Ga0070686_101589463
257 Ga0068855_100015661
258 Ga0068855_100108407
259 Ga0068857_100024074
260 Ga0068857_101207704
261 Ga0068854_102007176
262 Ga0070702_100104380
263 Ga0068852_101289241
264 Ga0068859_100285600
265 Ga0068859_100388496
266 Ga0068863_100207971
267 Ga0068858_100214425
268 Ga0081455_10018271
269 Ga0081455_10279510
270 Ga0081455_10984891
271 Ga0070715_10938038
272 Ga0070712_100046451
273 Ga0070712_100096095
274 Ga0070712_100396245
275 Ga0070712_101018191
276 Ga0097621_100824605
277 Ga0068871_100361495
278 Ga0075428_100222667
279 Ga0068865_100522987
280 Ga0068865_101021296
281 Ga0097620_100285586
282 Ga0097620_100388478
283 Ga0099794_10014484
284 Ga0099794_10036916
285 Ga0099794_10070442
286 Ga0105240_10006339
287 Ga0105240_10080795
288 Ga0111539_10077443
289 Ga0105245_10606666
290 Ga0114129_10298736
291 Ga0114129_10506044
292 Ga0114129_12280134
293 Ga0105237_11321868
294 Ga0099796_10186849
295 Ga0105239_10582503
296 Ga0157369_12100671
297 Ga0157369_12602917
298 Ga0171462_1018
299 Ga0157374_10348310
300 Ga0157374_11360875
301 Ga0157378_11127380
302 Ga0163162_10265244
303 Ga0213876_10027054
304 Ga0209148_1000463
305 Ga0209455_1000550
306 Ga0207684_10195783
307 Ga0207707_11083476
308 Ga0207695_10000270
309 Ga0207695_10002531
310 Ga0207695_10852403
311 Ga0207693_10113289
312 Ga0207693_10509286
313 Ga0207693_10617764
314 Ga0207663_10052907
315 Ga0207663_10445009
316 Ga0207652_10013642
317 Ga0207646_10434127
318 Ga0207687_10560334
319 Ga0207670_10000858
320 Ga0207704_10460439
321 Ga0207667_10731328
322 Ga0207667_11793568
323 Ga0207651_10860326
324 Ga0207668_10639839
325 Ga0207677_10055819
326 Ga0207703_10863318
327 Ga0207641_10184642
328 Ga0207674_10028412
329 Ga0209588_1154457
330 Ga0265337_1000509
331 Ga0265337_1005867
332 Ga0265319_1000897
333 Ga0265319_1002709
334 Ga0265319_1004107
335 Ga0265334_10021108
336 Ga0265334_10100105
337 Ga0265318_10004508
338 Ga0265318_10007931
339 Ga0265318_10011009
340 Ga0265323_10159425
341 Ga0265322_10022997
342 Ga0265336_10002066
343 Ga0265336_10041972
344 Ga0265338_10000082
345 Ga0265338_10004541
346 Ga0265338_10015896
347 Ga0265338_10023694
348 Ga0265338_10080656
349 Ga0265324_10002459
350 Ga0265324_10010332
351 Ga0265324_10040658
352 Ga0265324_10288489
353 Ga0265760_10358643
354 Ga0265330_10143947
355 Ga0265332_10267750
356 Ga0265332_10320318
357 Ga0265328_10237799
358 Ga0265320_10000309
359 Ga0265320_10000571
360 Ga0265320_10022038
361 Ga0265325_10012961
362 Ga0265325_10056475
363 Ga0265340_10018057
364 Ga0265339_10016332
365 Ga0265339_10023351
366 Ga0265339_10147785
367 Ga0265327_10011860
368 Ga0265316_10003494
369 Ga0265316_10059817
370 Ga0265316_10361535
371 Ga0265316_10949847
372 Ga0265313_10004629
373 Ga0265313_10008833
374 Ga0265313_10372841
375 Ga0265314_10007575
376 Ga0265314_10131495
377 Ga0265342_10037344
378 Ga0265342_10041054
379 Ga0265342_10046365
380 Ga0265342_10690350
381 Ga0373944_0281697
382 Ga0373923_0097061
383 Ga0373945_0432625
384 Ga0373954_0289299
385 Ga0373957_0095221
386 Ga0373955_0039656
387 Ga0373924_0028670
388 Ga0373935_0559839
389 Ga0373927_0330264
390 Ga0373927_0401497
391 Ga0373933_0007662
392 Ga0373933_0232068
393 Ga0373947_0745650
394 Ga0373937_0003696
395 Ga0316584_0015616
396 Ga0373925_0090929
397 Ga0373925_0411590
398 Ga0395901_0989450
399 Ga0436365_1008527
400 Ga0436365_1346650
401 Ga0436360_1269461
402 Ga0436362_0908296
403 Ga0451577_0008988
404 Ga0451577_0105543
405 Ga0451577_0521633
406 Ga0453683_1126729
407 Ga0453684_0966669
408 Ga0451576_0040369
409 Ga0451576_0894734
410 Ga0466967_1296020
411 Ga0495651_0408657
412 Ga0495652_0395329
413 Ga0495667_0255618
414 Ga0495667_0474532
415 Ga0495659_0099135
416 Ga0495657_0273854
417 Ga0495657_0524150
418 Ga0495599_0239115
419 Ga0495599_0246697
420 Ga0495646_0432683
421 Ga0495674_0144586
422 Ga0495675_0026614
423 Ga0495684_0370150
424 Ga0495602_0047938
425 Ga0495602_0674405
426 Ga0496100_1452809
427 Ga0496101_0173320
428 Ga0496104_0083116
429 Ga0496105_0109552
430 Ga0496108_0793764
431 Ga0496111_0304659
432 Ga0496112_0016096
433 Ga0496112_0881529
434 Ga0496113_0089938
435 Ga0496114_0023037
436 Ga0496115_0004905
437 Ga0501039_1026092
438 Ga0501043_0591053
439 Ga0501047_0169701
440 Ga0501080_0028744
441 Ga0501083_0368270
442 Ga0501083_0714096
443 Ga0501035_0004287
444 nmdc:mga05p37_29395_c1
445 Ga0495619_0148410
446 Ga0495619_0186233
447 Ga0495619_0784848
448 2514592583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02641

DUF190

Uncharacterized ACR, COG1993

27

123

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.9532 6 106
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.9326 6 106
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.914 1 108
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.9051 1 108
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8888 1 105
ID Description Score Start End Superfamily
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9417 7 106 3.30.70.120
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9208 7 106 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8888 1 105 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8801 1 105 3.30.70.120
af_P95087_118_229_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8311 6 106 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A4R5BGI5-F1-model_v4 DUF190 domain-containing protein 0.9338 1 114
AF-A0A2H0LUP4-F1-model_v4 Uncharacterized protein 0.9337 1 109
AF-A0A2H0M287-F1-model_v4 Uncharacterized protein 0.9302 1 109
AF-A0A2H0LUP4-F1-model_v4 Uncharacterized protein 0.9254 1 109
AF-A0A178IKG0-F1-model_v4 Uncharacterized protein 0.9225 1 112

Map