F335430

General Info

Members Datasets Scaffolds Average Seq Length
223 149 446 215

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10004382|Ga0081539_1000438214
Length 215
Sequence VRILVIDNYDSFVFNLVQYLGQLGAECEVRRNDEITVRDVGGFGAAGVLLSPGPGTPERAGITMEVISAYAGKLPIFGVCLGHQAIGAAFGATVTRAPELLHGKTSVVHHTGAGVLSGLPDPFTATRYHSLAVVRDTLPPEIEVTGWTGSGVVMALRHRELPVEGVQFHPESVLTEGGHTMLANWLAECGLPAALDRAPALAAEVETRRRAAFAA

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
142 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
143 2643221597 Microbacterium sp. Root180 Isolate Unclassified
144 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
145 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
146 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
147 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
148 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
149 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 1.79
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 4.04
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10004382 3300005985 Bacteria 15698
2 Ga0006562J51391_1092071 3300003578 Bacteria 13000
3 Ga0006562J51391_1092072 3300003578 Bacteria 8642
4 Ga0070658_10240463 3300005327 Bacteria 1534
5 Ga0070658_10815323 3300005327 Bacteria 811
6 Ga0070670_100100388 3300005331 Bacteria 2491
7 Ga0070670_100299869 3300005331 Bacteria 1405
8 Ga0070682_100020412 3300005337 Bacteria 3897
9 Ga0070682_100097902 3300005337 Bacteria 1931
10 Ga0070660_100126109 3300005339 Bacteria 2046
11 Ga0070689_100095247 3300005340 Bacteria 2351
12 Ga0070689_100260757 3300005340 Bacteria 1432
13 Ga0070661_100008229 3300005344 Bacteria 7197
14 Ga0070661_100074767 3300005344 Bacteria 2495
15 Ga0070692_10049085 3300005345 Bacteria 2188
16 Ga0070668_100056924 3300005347 Bacteria 3020
17 Ga0070675_100586304 3300005354 Bacteria 1010
18 Ga0070674_100110131 3300005356 Bacteria 2020
19 Ga0070674_100502949 3300005356 Bacteria 1009
20 Ga0070667_100007818 3300005367 Bacteria 8867
21 Ga0070667_100217539 3300005367 Bacteria 1699
22 Ga0070714_100000007 3300005435 Bacteria 285654
23 Ga0070714_101100717 3300005435 Bacteria 774
24 Ga0070711_100294692 3300005439 Bacteria 1288
25 Ga0070663_100196968 3300005455 Bacteria 1570
26 Ga0068867_100103801 3300005459 Bacteria 2174
27 Ga0070685_10043752 3300005466 Bacteria 2561
28 Ga0070685_10099275 3300005466 Bacteria 1775
29 Ga0070684_100169410 3300005535 Bacteria 1983
30 Ga0070684_100236656 3300005535 Bacteria 1668
31 Ga0070684_100338364 3300005535 Bacteria 1383
32 Ga0070693_100377796 3300005547 Bacteria 977
33 Ga0070665_100658190 3300005548 Bacteria 1060
34 Ga0068855_100220909 3300005563 Bacteria 2125
35 Ga0068857_100085374 3300005577 Bacteria 2821
36 Ga0068854_100172583 3300005578 Bacteria 1683
37 Ga0068856_100096672 3300005614 Bacteria 2942
38 Ga0068852_100098979 3300005616 Bacteria 2627
39 Ga0068864_100127449 3300005618 Bacteria 2282
40 Ga0068866_10022056 3300005718 Bacteria 2943
41 Ga0068851_10018671 3300005834 Bacteria 3343
42 Ga0068863_100959819 3300005841 Bacteria 857
43 Ga0068858_100096129 3300005842 Bacteria 2760
44 Ga0068858_100357455 3300005842 Bacteria 1399
45 Ga0068862_100196863 3300005844 Bacteria 1815
46 Ga0081539_10059406 3300005985 Bacteria 2105
47 Ga0097621_100182503 3300006237 Bacteria 1813
48 Ga0068871_100243729 3300006358 Bacteria 1563
49 Ga0105251_10024769 3300009011 Bacteria 3078
50 Ga0111539_10078812 3300009094 Bacteria 3875
51 Ga0105245_10041241 3300009098 Bacteria 4114
52 Ga0105245_10153726 3300009098 Bacteria 2178
53 Ga0105247_10470031 3300009101 Bacteria 910
54 Ga0105239_10103214 3300010375 Bacteria 3155
55 Ga0105246_10280257 3300011119 Bacteria 1337
56 Ga0157370_10769238 3300013104 Bacteria 877
57 Ga0157374_10418631 3300013296 Bacteria 1338
58 Ga0157378_10684836 3300013297 Bacteria 1043
59 Ga0163162_11280069 3300013306 Bacteria 833
60 Ga0157372_10102226 3300013307 Bacteria 3273
61 Ga0157375_10085220 3300013308 Bacteria 3209
62 Ga0157375_10237981 3300013308 Bacteria 1980
63 Ga0157380_10060956 3300014326 Bacteria 3017
64 Ga0157379_10157799 3300014968 Bacteria 2047
65 Ga0163161_10192107 3300017792 Bacteria 1570
66 Ga0206354_10688300 3300020081 Bacteria 1430
67 Ga0206353_11426955 3300020082 Bacteria 4070
68 Ga0213875_10001820 3300021388 Bacteria 13264
69 Ga0207688_10066318 3300025901 Bacteria 2041
70 Ga0207680_10038177 3300025903 Bacteria 2779
71 Ga0207647_10091545 3300025904 Bacteria 1813
72 Ga0207645_10120609 3300025907 Bacteria 1702
73 Ga0207643_10004047 3300025908 Bacteria 7894
74 Ga0207705_10462920 3300025909 Bacteria 984
75 Ga0207705_10523001 3300025909 Bacteria 922
76 Ga0207671_10110189 3300025914 Bacteria 2094
77 Ga0207660_10162040 3300025917 Bacteria 1726
78 Ga0207657_10118742 3300025919 Bacteria 2177
79 Ga0207652_10311033 3300025921 Bacteria 1422
80 Ga0207694_10122795 3300025924 Bacteria 2075
81 Ga0207650_10759480 3300025925 Bacteria 821
82 Ga0207687_10076252 3300025927 Bacteria 2408
83 Ga0207664_10000014 3300025929 Bacteria 249865
84 Ga0207664_10554130 3300025929 Bacteria 1031
85 Ga0207664_10907896 3300025929 Bacteria 791
86 Ga0207690_10172058 3300025932 Bacteria 1623
87 Ga0207686_10056117 3300025934 Bacteria 2475
88 Ga0207709_10001612 3300025935 Bacteria 15367
89 Ga0207670_10032628 3300025936 Bacteria 3350
90 Ga0207669_10322186 3300025937 Bacteria 1183
91 Ga0207704_10217733 3300025938 Bacteria 1410
92 Ga0207691_10023492 3300025940 Bacteria 5805
93 Ga0207711_10277703 3300025941 Bacteria 1542
94 Ga0207689_10230592 3300025942 Bacteria 1530
95 Ga0207661_10024345 3300025944 Bacteria 4588
96 Ga0207679_10503423 3300025945 Bacteria 1081
97 Ga0207667_10152269 3300025949 Bacteria 2380
98 Ga0207712_10120307 3300025961 Bacteria 1986
99 Ga0207668_10106999 3300025972 Bacteria 2090
100 Ga0207640_10062969 3300025981 Bacteria 2463
101 Ga0207703_10791318 3300026035 Bacteria 905
102 Ga0207639_10767426 3300026041 Bacteria 897
103 Ga0207678_10090867 3300026067 Bacteria 2609
104 Ga0207702_10374987 3300026078 Bacteria 1367
105 Ga0207648_10264445 3300026089 Bacteria 1535
106 Ga0207674_10227213 3300026116 Bacteria 1814
107 Ga0207675_100338223 3300026118 Bacteria 1473
108 Ga0207683_10130004 3300026121 Bacteria 2264
109 Ga0207698_10188020 3300026142 Bacteria 1836
110 Ga0207428_10101025 3300027907 Bacteria 2229
111 Ga0268266_10082459 3300028379 Bacteria 2805
112 Ga0268264_10332331 3300028381 Bacteria 1440
113 Ga0307515_10086984 3300028794 Bacteria 3975
114 Ga0307513_10288982 3300031456 Bacteria 1412
115 Ga0307408_100125965 3300031548 Bacteria 1992
116 Ga0307408_100516972 3300031548 Bacteria 1048
117 Ga0307408_100710386 3300031548 Bacteria 904
118 Ga0307413_10002981 3300031824 Bacteria 7013
119 Ga0307413_10346175 3300031824 Bacteria 1145
120 Ga0307413_10372973 3300031824 Bacteria 1109
121 Ga0307518_10081566 3300031838 Bacteria 2335
122 Ga0307410_10024586 3300031852 Bacteria 3766
123 Ga0307410_10074534 3300031852 Bacteria 2364
124 Ga0307410_10255506 3300031852 Bacteria 1364
125 Ga0307410_10607094 3300031852 Bacteria 913
126 Ga0326468_10002055 3300031889 Bacteria 1678
127 Ga0307406_10054435 3300031901 Bacteria 2554
128 Ga0307406_10076614 3300031901 Bacteria 2210
129 Ga0307406_10114207 3300031901 Bacteria 1865
130 Ga0307406_10295158 3300031901 Bacteria 1242
131 Ga0307406_10318099 3300031901 Bacteria 1203
132 Ga0307407_10119835 3300031903 Bacteria 1666
133 Ga0307407_10162943 3300031903 Bacteria 1461
134 Ga0307407_10225510 3300031903 Bacteria 1269
135 Ga0307407_10488521 3300031903 Bacteria 900
136 Ga0307412_10019477 3300031911 Bacteria 4111
137 Ga0307412_10307762 3300031911 Bacteria 1255
138 Ga0307409_100042768 3300031995 Bacteria 3396
139 Ga0307409_100080074 3300031995 Bacteria 2635
140 Ga0307409_100088373 3300031995 Bacteria 2530
141 Ga0307409_100150478 3300031995 Bacteria 2020
142 Ga0307409_100162775 3300031995 Bacteria 1954
143 Ga0307409_100176527 3300031995 Bacteria 1886
144 Ga0307409_100267749 3300031995 Bacteria 1572
145 Ga0307409_100316182 3300031995 Bacteria 1459
146 Ga0307409_100477925 3300031995 Bacteria 1208
147 Ga0307409_100656196 3300031995 Bacteria 1043
148 Ga0307416_100015698 3300032002 Bacteria 5240
149 Ga0307416_100027763 3300032002 Bacteria 4197
150 Ga0307416_100055347 3300032002 Bacteria 3194
151 Ga0307416_100147200 3300032002 Bacteria 2153
152 Ga0307416_100424032 3300032002 Bacteria 1375
153 Ga0307414_10287436 3300032004 Bacteria 1385
154 Ga0307411_10204384 3300032005 Bacteria 1520
155 Ga0307415_100033276 3300032126 Bacteria 3345
156 Ga0307415_100034948 3300032126 Bacteria 3278
157 Ga0307415_100069214 3300032126 Bacteria 2474
158 Ga0307415_100119441 3300032126 Bacteria 1973
159 Ga0307415_100169846 3300032126 Bacteria 1699
160 Ga0307415_100242052 3300032126 Bacteria 1460
161 Ga0307415_100276589 3300032126 Bacteria 1378
162 Ga0307415_100579003 3300032126 Bacteria 995
163 Ga0395899_0132088 3300037312 Bacteria 1782
164 Ga0395899_0182752 3300037312 Bacteria 1471
165 Ga0395900_0088788 3300037418 Bacteria 3178
166 Ga0395900_0139686 3300037418 Bacteria 2481
167 Ga0395900_0281976 3300037418 Bacteria 1653
168 Ga0395898_0056894 3300037466 Bacteria 3811
169 Ga0436364_0687857 3300037853 Bacteria 39085
170 Ga0395901_0003609 3300038443 Bacteria 15605
171 Ga0395901_1149211 3300038443 Bacteria 745
172 Ga0436365_0901309 3300039437 Bacteria 1340
173 Ga0439440_0069082 3300042993 Bacteria 916
174 Ga0466965_0152964 3300044683 Bacteria 1206
175 Ga0466961_0144691 3300044693 Bacteria 1487
176 Ga0466961_0229845 3300044693 Bacteria 1142
177 Ga0466961_0234809 3300044693 Bacteria 1128
178 Ga0466963_0153645 3300044694 Bacteria 1599
179 Ga0466970_0056614 3300044765 Bacteria 2095
180 Ga0466957_0118214 3300044842 Bacteria 1688
181 Ga0466957_0162695 3300044842 Bacteria 1450
182 Ga0466960_0016964 3300044901 Bacteria 3168
183 Ga0466960_0151631 3300044901 Bacteria 1239
184 Ga0466960_0289914 3300044901 Bacteria 919
185 Ga0466959_0141208 3300045049 Bacteria 1702
186 Ga0466959_0188014 3300045049 Bacteria 1442
187 Ga0466959_0265869 3300045049 Bacteria 1180
188 Ga0466958_0023995 3300045836 Bacteria 3586
189 Ga0466958_0108109 3300045836 Bacteria 1735
190 Ga0466958_0240276 3300045836 Bacteria 1157
191 Ga0466967_0000404 3300045976 Bacteria 20299
192 Ga0466967_0017555 3300045976 Bacteria 5687
193 Ga0466967_0076230 3300045976 Bacteria 3016
194 Ga0466967_0831948 3300045976 Bacteria 917
195 Ga0466967_0946991 3300045976 Bacteria 857
196 Ga0466967_0985829 3300045976 Bacteria 839
197 Ga0495580_0433726 3300046472 Bacteria 883
198 Ga0495631_0093833 3300046518 Bacteria 1292
199 Ga0495665_0021082 3300046531 Bacteria 3501
200 Ga0495581_0171124 3300047315 Bacteria 1270
201 Ga0496106_0090237 3300048909 Bacteria 2365
202 Ga0496108_0679221 3300048911 Bacteria 894
203 Ga0496109_0127266 3300048912 Bacteria 2375
204 Ga0496111_0383565 3300048914 Bacteria 1039
205 Ga0496112_0563262 3300048915 Bacteria 1073
206 Ga0496112_0565985 3300048915 Bacteria 1070
207 Ga0496113_0289305 3300048916 Bacteria 1311
208 Ga0496114_0401344 3300048917 Bacteria 1214
209 Ga0496115_0568256 3300048918 Bacteria 905
210 Ga0501036_0373145 3300049572 Bacteria 1191
211 nmdc:mga08y16_273317_c1 3300050511 Bacteria 1744
212 Ga0500622_0135727 3300053156 Bacteria 1179
213 Ga0466962_0136802 3300061719 Bacteria 1186
214 Ga0466962_0198648 3300061719 Bacteria 979
215 2523384294 2523231044 Bacteria 6434991
216 2623501519 2622736605 Bacteria 4992138
217 2643997365 2643221597 Bacteria 3347721
218 2738891880 2738541308 Bacteria 7020677
219 2739205731 2738543005 Bacteria 5278128
220 2791911195 2791354901 Bacteria 8322202
221 2919714899 2919713450 Bacteria 7431245
222 2974319785 2974315732 Bacteria 4602776
223 2984523655 2984523437 Bacteria 4508481
224 Ga0081539_10004382
225 Ga0006562J51391_1092071
226 Ga0006562J51391_1092072
227 Ga0070658_10240463
228 Ga0070658_10815323
229 Ga0070670_100100388
230 Ga0070670_100299869
231 Ga0070682_100020412
232 Ga0070682_100097902
233 Ga0070660_100126109
234 Ga0070689_100095247
235 Ga0070689_100260757
236 Ga0070661_100008229
237 Ga0070661_100074767
238 Ga0070692_10049085
239 Ga0070668_100056924
240 Ga0070675_100586304
241 Ga0070674_100110131
242 Ga0070674_100502949
243 Ga0070667_100007818
244 Ga0070667_100217539
245 Ga0070714_100000007
246 Ga0070714_101100717
247 Ga0070711_100294692
248 Ga0070663_100196968
249 Ga0068867_100103801
250 Ga0070685_10043752
251 Ga0070685_10099275
252 Ga0070684_100169410
253 Ga0070684_100236656
254 Ga0070684_100338364
255 Ga0070693_100377796
256 Ga0070665_100658190
257 Ga0068855_100220909
258 Ga0068857_100085374
259 Ga0068854_100172583
260 Ga0068856_100096672
261 Ga0068852_100098979
262 Ga0068864_100127449
263 Ga0068866_10022056
264 Ga0068851_10018671
265 Ga0068863_100959819
266 Ga0068858_100096129
267 Ga0068858_100357455
268 Ga0068862_100196863
269 Ga0081539_10059406
270 Ga0097621_100182503
271 Ga0068871_100243729
272 Ga0105251_10024769
273 Ga0111539_10078812
274 Ga0105245_10041241
275 Ga0105245_10153726
276 Ga0105247_10470031
277 Ga0105239_10103214
278 Ga0105246_10280257
279 Ga0157370_10769238
280 Ga0157374_10418631
281 Ga0157378_10684836
282 Ga0163162_11280069
283 Ga0157372_10102226
284 Ga0157375_10085220
285 Ga0157375_10237981
286 Ga0157380_10060956
287 Ga0157379_10157799
288 Ga0163161_10192107
289 Ga0206354_10688300
290 Ga0206353_11426955
291 Ga0213875_10001820
292 Ga0207688_10066318
293 Ga0207680_10038177
294 Ga0207647_10091545
295 Ga0207645_10120609
296 Ga0207643_10004047
297 Ga0207705_10462920
298 Ga0207705_10523001
299 Ga0207671_10110189
300 Ga0207660_10162040
301 Ga0207657_10118742
302 Ga0207652_10311033
303 Ga0207694_10122795
304 Ga0207650_10759480
305 Ga0207687_10076252
306 Ga0207664_10000014
307 Ga0207664_10554130
308 Ga0207664_10907896
309 Ga0207690_10172058
310 Ga0207686_10056117
311 Ga0207709_10001612
312 Ga0207670_10032628
313 Ga0207669_10322186
314 Ga0207704_10217733
315 Ga0207691_10023492
316 Ga0207711_10277703
317 Ga0207689_10230592
318 Ga0207661_10024345
319 Ga0207679_10503423
320 Ga0207667_10152269
321 Ga0207712_10120307
322 Ga0207668_10106999
323 Ga0207640_10062969
324 Ga0207703_10791318
325 Ga0207639_10767426
326 Ga0207678_10090867
327 Ga0207702_10374987
328 Ga0207648_10264445
329 Ga0207674_10227213
330 Ga0207675_100338223
331 Ga0207683_10130004
332 Ga0207698_10188020
333 Ga0207428_10101025
334 Ga0268266_10082459
335 Ga0268264_10332331
336 Ga0307515_10086984
337 Ga0307513_10288982
338 Ga0307408_100125965
339 Ga0307408_100516972
340 Ga0307408_100710386
341 Ga0307413_10002981
342 Ga0307413_10346175
343 Ga0307413_10372973
344 Ga0307518_10081566
345 Ga0307410_10024586
346 Ga0307410_10074534
347 Ga0307410_10255506
348 Ga0307410_10607094
349 Ga0326468_10002055
350 Ga0307406_10054435
351 Ga0307406_10076614
352 Ga0307406_10114207
353 Ga0307406_10295158
354 Ga0307406_10318099
355 Ga0307407_10119835
356 Ga0307407_10162943
357 Ga0307407_10225510
358 Ga0307407_10488521
359 Ga0307412_10019477
360 Ga0307412_10307762
361 Ga0307409_100042768
362 Ga0307409_100080074
363 Ga0307409_100088373
364 Ga0307409_100150478
365 Ga0307409_100162775
366 Ga0307409_100176527
367 Ga0307409_100267749
368 Ga0307409_100316182
369 Ga0307409_100477925
370 Ga0307409_100656196
371 Ga0307416_100015698
372 Ga0307416_100027763
373 Ga0307416_100055347
374 Ga0307416_100147200
375 Ga0307416_100424032
376 Ga0307414_10287436
377 Ga0307411_10204384
378 Ga0307415_100033276
379 Ga0307415_100034948
380 Ga0307415_100069214
381 Ga0307415_100119441
382 Ga0307415_100169846
383 Ga0307415_100242052
384 Ga0307415_100276589
385 Ga0307415_100579003
386 Ga0395899_0132088
387 Ga0395899_0182752
388 Ga0395900_0088788
389 Ga0395900_0139686
390 Ga0395900_0281976
391 Ga0395898_0056894
392 Ga0436364_0687857
393 Ga0395901_0003609
394 Ga0395901_1149211
395 Ga0436365_0901309
396 Ga0439440_0069082
397 Ga0466965_0152964
398 Ga0466961_0144691
399 Ga0466961_0229845
400 Ga0466961_0234809
401 Ga0466963_0153645
402 Ga0466970_0056614
403 Ga0466957_0118214
404 Ga0466957_0162695
405 Ga0466960_0016964
406 Ga0466960_0151631
407 Ga0466960_0289914
408 Ga0466959_0141208
409 Ga0466959_0188014
410 Ga0466959_0265869
411 Ga0466958_0023995
412 Ga0466958_0108109
413 Ga0466958_0240276
414 Ga0466967_0000404
415 Ga0466967_0017555
416 Ga0466967_0076230
417 Ga0466967_0831948
418 Ga0466967_0946991
419 Ga0466967_0985829
420 Ga0495580_0433726
421 Ga0495631_0093833
422 Ga0495665_0021082
423 Ga0495581_0171124
424 Ga0496106_0090237
425 Ga0496108_0679221
426 Ga0496109_0127266
427 Ga0496111_0383565
428 Ga0496112_0563262
429 Ga0496112_0565985
430 Ga0496113_0289305
431 Ga0496114_0401344
432 Ga0496115_0568256
433 Ga0501036_0373145
434 nmdc:mga08y16_273317_c1
435 Ga0500622_0135727
436 Ga0466962_0136802
437 Ga0466962_0198648
438 2523384294
439 2623501519
440 2643997365
441 2738891880
442 2739205731
443 2791911195
444 2919714899
445 2974319785
446 2984523655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

4

189

0.95

PF07722

Peptidase_C26

Peptidase C26

50

171

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9181 6 195
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9168 6 194
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.915 6 194
7d96-assembly1.cif.gz_A crystal structure of d110g mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9148 7 195
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9145 6 194
ID Description Score Start End Superfamily
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.976 6 195 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9529 7 192 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9414 6 192 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9381 7 192 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9234 6 195 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7C6VBG6-F1-model_v4 C26 family cysteine hydrolase domain-containing family 0.9779 5 208 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0016787
AF-A0A6V8PX78-F1-model_v4 Anthranilate synthase component II 0.9769 79 175 GO:0000162
GO:0004049
GO:0005829
AF-A0A533RQB3-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9762 7 173 GO:0000162
GO:0004049
GO:0005829
AF-A0A7W7D461-F1-model_v4 Para-aminobenzoate synthetase component 2 (EC 2.6.1.85) 0.9755 5 194 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0046820
AF-A0A7X7HDK9-F1-model_v4 C26 family cysteine hydrolase domain-containing family 0.9735 5 206 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0016787

Map