F335257

General Info

Members Datasets Scaffolds Average Seq Length
223 175 223 119

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100184077|Ga0070671_1001840772
Length 120
Sequence MSYIDGFVIAVPEGNKQKFIEHAKRGDSAFLEHGARRVLECWADDVKDGKVTDFRRAVAAKDGEAVVFSWIEWPDKATRDAAMAKVMNDPRLNPQSNPMPFDGKRMIFGGFAPVVELGGA

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
109 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
112 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.94
Nodule 0
Rhizoplane 1.79
Rhizosphere 74.44
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c003027 3300000041 Bacteria 1508
2 ARcpr5yngRDRAFT_c012136 3300000043 Bacteria 727
3 ARCol0yngRDRAFT_1015832 3300000652 Bacteria 570
4 JGI24739J22299_10024094 3300001989 Bacteria 2148
5 JGI25150J39212_1042851 3300002774 Bacteria 579
6 JGI25153J46596_10026000 3300003215 Bacteria 2081
7 JGI25153J46596_10066559 3300003215 Bacteria 953
8 Ga0055537_1002465 3300003773 Bacteria 6191
9 Ga0055524_1000210 3300003775 Bacteria 62927
10 Ga0055528_1074274 3300003790 Bacteria 608
11 Ga0055530_10007397 3300003791 Bacteria 4637
12 Ga0055530_10016610 3300003791 Bacteria 2343
13 Ga0055531_10003220 3300003794 Bacteria 10469
14 Ga0055531_10012906 3300003794 Bacteria 3891
15 Ga0065165_1004346 3300005262 Bacteria 8891
16 Ga0065165_1022943 3300005262 Bacteria 2126
17 Ga0070670_100256241 3300005331 Bacteria 1525
18 Ga0070666_10256814 3300005335 Bacteria 1238
19 Ga0070680_100000382 3300005336 Bacteria 30040
20 Ga0070668_100673643 3300005347 Bacteria 910
21 Ga0070671_100184077 3300005355 Bacteria 1769
22 Ga0070659_100239832 3300005366 Bacteria 1500
23 Ga0070667_100178015 3300005367 Bacteria 1880
24 Ga0070709_10441656 3300005434 Bacteria 979
25 Ga0070714_100433548 3300005435 Bacteria 1246
26 Ga0070713_100430988 3300005436 Bacteria 1235
27 Ga0070711_101699317 3300005439 Bacteria 553
28 Ga0070681_10000001 3300005458 Bacteria 946857
29 Ga0070679_100002185 3300005530 Bacteria 17650
30 Ga0068853_100303575 3300005539 Bacteria 1476
31 Ga0068857_101556424 3300005577 Unclassified 645
32 Ga0068856_101073342 3300005614 Bacteria 823
33 Ga0068852_101100465 3300005616 Unclassified 815
34 Ga0068852_101227273 3300005616 Bacteria 771
35 Ga0068861_100879380 3300005719 Bacteria 847
36 Ga0068863_100528184 3300005841 Bacteria 1164
37 Ga0068862_100201508 3300005844 Bacteria 1795
38 Ga0070717_10137895 3300006028 Bacteria 2102
39 Ga0070716_101624035 3300006173 Bacteria 531
40 Ga0075370_10996961 3300006353 Bacteria 513
41 Ga0105240_11648681 3300009093 Bacteria 670
42 Ga0105245_12341466 3300009098 Bacteria 588
43 Ga0105241_10316725 3300009174 Bacteria 1344
44 Ga0105241_12514186 3300009174 Unclassified 516
45 Ga0105248_10000112 3300009177 Bacteria 91321
46 Ga0105237_10784795 3300009545 Bacteria 959
47 Ga0105238_10089040 3300009551 Bacteria 3073
48 Ga0105238_10101088 3300009551 Bacteria 2866
49 Ga0105238_10388875 3300009551 Bacteria 1387
50 Ga0105249_10372175 3300009553 Unclassified 1453
51 Ga0105239_10236530 3300010375 Bacteria 2050
52 Ga0157378_10848968 3300013297 Bacteria 941
53 Ga0163162_10073204 3300013306 Bacteria 3482
54 Ga0163162_12377867 3300013306 Bacteria 609
55 Ga0157372_12488476 3300013307 Bacteria 594
56 Ga0163163_10036107 3300014325 Bacteria 4798
57 Ga0163163_10621394 3300014325 Bacteria 1144
58 Ga0182008_10677487 3300014497 Unclassified 587
59 Ga0163161_10258835 3300017792 Bacteria 1358
60 Ga0213874_10002411 3300021377 Bacteria 4024
61 Ga0209436_115051 3300025208 Bacteria 1210
62 Ga0207425_1013373 3300025245 Bacteria 1899
63 Ga0209148_1020438 3300025254 Bacteria 1088
64 Ga0209233_1010207 3300025261 Bacteria 2824
65 Ga0209565_1000029 3300025263 Bacteria 340335
66 Ga0209673_1005926 3300025273 Bacteria 6032
67 Ga0209675_1006906 3300025291 Bacteria 4458
68 Ga0209758_1003549 3300025297 Bacteria 14028
69 Ga0209758_1010479 3300025297 Bacteria 5540
70 Ga0209050_1000098 3300025298 Bacteria 236717
71 Ga0209050_1009161 3300025298 Bacteria 5120
72 Ga0209256_1000008 3300025299 Bacteria 975723
73 Ga0209257_1000235 3300025304 Bacteria 129620
74 Ga0209257_1004106 3300025304 Bacteria 11637
75 Ga0207697_10510263 3300025315 Bacteria 530
76 Ga0207692_10886631 3300025898 Bacteria 586
77 Ga0207710_10644407 3300025900 Unclassified 554
78 Ga0207680_10324018 3300025903 Bacteria 1078
79 Ga0207705_10949194 3300025909 Bacteria 665
80 Ga0207707_10000048 3300025912 Bacteria 117799
81 Ga0207671_10470630 3300025914 Bacteria 1001
82 Ga0207660_10000072 3300025917 Bacteria 52074
83 Ga0207652_10000509 3300025921 Bacteria 39514
84 Ga0207694_10043454 3300025924 Bacteria 3469
85 Ga0207694_10131680 3300025924 Bacteria 2005
86 Ga0207694_10300720 3300025924 Bacteria 1321
87 Ga0207650_11307137 3300025925 Bacteria 617
88 Ga0207700_10051771 3300025928 Bacteria 3066
89 Ga0207644_10253504 3300025931 Bacteria 1405
90 Ga0207690_10816535 3300025932 Unclassified 771
91 Ga0207686_10457461 3300025934 Bacteria 983
92 Ga0207711_10000155 3300025941 Bacteria 73463
93 Ga0207712_10282294 3300025961 Bacteria 1356
94 Ga0207712_10392096 3300025961 Bacteria 1165
95 Ga0207658_10469958 3300025986 Bacteria 1116
96 Ga0207639_10166988 3300026041 Bacteria 1860
97 Ga0207675_100433218 3300026118 Bacteria 1300
98 Ga0207698_10528497 3300026142 Bacteria 1152
99 Ga0265338_10043971 3300028800 Bacteria 4131
100 Ga0265338_10067260 3300028800 Bacteria 3095
101 Ga0265338_10150597 3300028800 Bacteria 1808
102 Ga0265760_10289694 3300031090 Bacteria 578
103 Ga0265332_10013523 3300031238 Bacteria 3616
104 Ga0265325_10282715 3300031241 Bacteria 744
105 Ga0265329_10022989 3300031242 Bacteria 2080
106 Ga0265329_10041445 3300031242 Bacteria 1476
107 Ga0265340_10004532 3300031247 Bacteria 7744
108 Ga0265340_10054470 3300031247 Bacteria 1928
109 Ga0265339_10016667 3300031249 Bacteria 4372
110 Ga0265331_10020969 3300031250 Bacteria 3348
111 Ga0265331_10022781 3300031250 Bacteria 3192
112 Ga0265316_10230390 3300031344 Bacteria 1364
113 Ga0265313_10113499 3300031595 Bacteria 1189
114 Ga0265314_10011976 3300031711 Bacteria 7112
115 Ga0265314_10224890 3300031711 Unclassified 1092
116 Ga0265314_10472142 3300031711 Bacteria 665
117 Ga0265314_10631609 3300031711 Bacteria 548
118 Ga0265342_10000178 3300031712 Bacteria 70648
119 Ga0265342_10307933 3300031712 Bacteria 833
120 Ga0307405_10754924 3300031731 Bacteria 811
121 Ga0307407_11132615 3300031903 Bacteria 609
122 Ga0307510_10051415 3300033180 Bacteria 4358
123 Ga0307510_10193869 3300033180 Bacteria 1576
124 Ga0373955_0315509 3300035172 Bacteria 944
125 Ga0373933_1145065 3300035724 Bacteria 513
126 Ga0395900_0007990 3300037418 Bacteria 10887
127 Ga0395898_0082584 3300037466 Bacteria 3097
128 Ga0395905_0026855 3300037471 Bacteria 5430
129 Ga0395905_0057232 3300037471 Bacteria 3647
130 Ga0395905_0478642 3300037471 Bacteria 1144
131 Ga0395905_1576240 3300037471 Bacteria 561
132 Ga0395901_1074829 3300038443 Bacteria 776
133 Ga0436361_0240108 3300039447 Bacteria 639
134 Ga0436361_0655254 3300039447 Bacteria 679
135 Ga0436363_0273296 3300039450 Bacteria 14906
136 Ga0439461_0002098 3300041410 Bacteria 3154
137 Ga0439465_0004006 3300041413 Bacteria 4800
138 Ga0439431_0006130 3300041997 Bacteria 2656
139 Ga0439433_0013419 3300041999 Bacteria 1799
140 Ga0439445_0016769 3300042004 Bacteria 1805
141 Ga0439432_148471 3300042006 Bacteria 688
142 Ga0439452_083093 3300042010 Bacteria 696
143 Ga0439457_005332 3300042014 Bacteria 3250
144 Ga0439462_0011654 3300042015 Bacteria 2242
145 Ga0439434_0021819 3300042435 Bacteria 1924
146 Ga0466966_0307929 3300044684 Bacteria 952
147 Ga0466957_1088087 3300044842 Unclassified 576
148 Ga0495592_0168823 3300046454 Bacteria 1500
149 Ga0495638_0148366 3300046460 Bacteria 1362
150 Ga0495651_0784836 3300046462 Bacteria 589
151 Ga0495650_0000174 3300046471 Bacteria 142519
152 Ga0495664_0312385 3300046477 Bacteria 948
153 Ga0495583_0000111 3300046506 Bacteria 138300
154 Ga0495583_0092565 3300046506 Bacteria 1299
155 Ga0495610_0175768 3300046512 Bacteria 894
156 Ga0495631_0012442 3300046518 Bacteria 4154
157 Ga0495637_0068915 3300046520 Bacteria 1432
158 Ga0495643_0072104 3300046522 Bacteria 1812
159 Ga0495648_0099624 3300046524 Bacteria 1607
160 Ga0495663_0002052 3300046525 Bacteria 6170
161 Ga0495652_0377936 3300046529 Bacteria 1008
162 Ga0495645_0021073 3300046543 Bacteria 4710
163 Ga0495645_0082549 3300046543 Bacteria 2305
164 Ga0495611_0015981 3300046648 Bacteria 3208
165 Ga0495611_0111375 3300046648 Bacteria 1274
166 Ga0495625_0258208 3300046660 Bacteria 1128
167 Ga0495625_0878750 3300046660 Unclassified 515
168 Ga0495599_0348739 3300046678 Bacteria 888
169 Ga0495669_0000934 3300046684 Bacteria 12237
170 Ga0495649_0106636 3300046694 Bacteria 1487
171 Ga0495649_0240671 3300046694 Bacteria 932
172 Ga0495660_0140712 3300046810 Bacteria 1201
173 Ga0495683_0016371 3300047323 Bacteria 3852
174 Ga0495687_000470 3300047443 Bacteria 48865
175 Ga0495687_001894 3300047443 Bacteria 18026
176 Ga0495686_0304868 3300047472 Bacteria 878
177 Ga0496101_1454125 3300048904 Bacteria 534
178 Ga0496104_1054706 3300048907 Bacteria 716
179 Ga0496106_0484546 3300048909 Bacteria 994
180 Ga0496112_0111301 3300048915 Bacteria 2708
181 Ga0496119_0016791 3300048922 Bacteria 5545
182 Ga0496120_0148587 3300048923 Bacteria 1180
183 Ga0496121_0072852 3300048924 Bacteria 2756
184 Ga0496121_0120333 3300048924 Bacteria 1984
185 Ga0496122_0443889 3300048925 Bacteria 646
186 Ga0496125_0034564 3300048928 Bacteria 4453
187 Ga0496126_0001024 3300048929 Bacteria 47517
188 Ga0496126_1009110 3300048929 Bacteria 624
189 Ga0496126_1214371 3300048929 Bacteria 554
190 Ga0501032_0167804 3300049569 Bacteria 1440
191 Ga0501037_0633555 3300049573 Bacteria 716
192 Ga0501047_0002685 3300049581 Bacteria 16927
193 Ga0501047_0147916 3300049581 Bacteria 2226
194 Ga0501047_0524454 3300049581 Bacteria 1010
195 Ga0501047_0731617 3300049581 Bacteria 806
196 Ga0501047_1081657 3300049581 Bacteria 615
197 Ga0501067_0001557 3300049583 Bacteria 12517
198 Ga0501070_0065751 3300049586 Bacteria 3003
199 Ga0501070_0158399 3300049586 Bacteria 1867
200 Ga0501072_0004954 3300049588 Bacteria 10128
201 Ga0501073_0014653 3300049589 Bacteria 5696
202 Ga0501259_132342 3300049688 Bacteria 603
203 Ga0501079_0031925 3300049741 Bacteria 4047
204 Ga0501079_1297294 3300049741 Unclassified 573
205 Ga0501080_0559395 3300049742 Bacteria 1018
206 Ga0501083_0267436 3300049744 Bacteria 1112
207 nmdc:mga07m45_590602_c1 3300050496 Bacteria 641
208 Ga0500610_0001132 3300053079 Bacteria 8786
209 Ga0495655_0137348 3300053083 Bacteria 758
210 Ga0500643_054179 3300053087 Bacteria 1139
211 Ga0500555_005985 3300053103 Bacteria 3451
212 Ga0500595_005331 3300053119 Bacteria 5627
213 Ga0500595_043274 3300053119 Bacteria 1435
214 Ga0500618_029573 3300053125 Bacteria 1292
215 Ga0500559_0170586 3300053136 Bacteria 1023
216 Ga0500616_0188657 3300053153 Bacteria 922
217 Ga0500636_0046172 3300053177 Bacteria 2568
218 Ga0500636_0046486 3300053177 Bacteria 2559
219 Ga0500645_000062 3300053730 Bacteria 85561
220 Ga0500601_001114 3300053737 Bacteria 3039
221 Ga0501084_0000472 3300054114 Bacteria 30948
222 Ga0501084_0051662 3300054114 Bacteria 3441
223 Ga0501082_1526083 3300060353 Bacteria 583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1074829 Ga0395901_1074829_31_354 104
2 3300025932 Ga0207690_10816535 Ga0207690_108165351 115
3 3300049581 Ga0501047_0731617 Ga0501047_0731617_263_619 116
4 3300014497 Ga0182008_10677487 Ga0182008_106774871 117
5 3300031247 Ga0265340_10004532 Ga0265340_100045327 117
6 3300037471 Ga0395905_1576240 Ga0395905_1576240_74_427 117
7 3300046543 Ga0495645_0082549 Ga0495645_0082549_1319_1675 117
8 3300048925 Ga0496122_0443889 Ga0496122_0443889_235_588 117
9 3300049581 Ga0501047_0524454 Ga0501047_0524454_237_590 117
10 3300053125 Ga0500618_029573 Ga0500618_029573_513_866 117
11 3300000041 ARcpr5oldR_c003027 ARcpr5oldR_0030272 118
12 3300000043 ARcpr5yngRDRAFT_c012136 ARcpr5yngRDRAFT_0121362 118
13 3300000652 ARCol0yngRDRAFT_1015832 ARCol0yngRDRAFT_10158322 118
14 3300001989 JGI24739J22299_10024094 JGI24739J22299_100240943 118
15 3300002774 JGI25150J39212_1042851 JGI25150J39212_10428512 118
16 3300003215 JGI25153J46596_10026000 JGI25153J46596_100260002 118
17 3300003215 JGI25153J46596_10066559 JGI25153J46596_100665592 118
18 3300003773 Ga0055537_1002465 Ga0055537_10024652 118
19 3300003775 Ga0055524_1000210 Ga0055524_100021064 118
20 3300003790 Ga0055528_1074274 Ga0055528_10742742 118
21 3300003791 Ga0055530_10007397 Ga0055530_100073973 118
22 3300003791 Ga0055530_10016610 Ga0055530_100166104 118
23 3300003794 Ga0055531_10003220 Ga0055531_100032207 118
24 3300003794 Ga0055531_10012906 Ga0055531_100129064 118
25 3300005262 Ga0065165_1004346 Ga0065165_100434610 118
26 3300005262 Ga0065165_1022943 Ga0065165_10229432 118
27 3300005331 Ga0070670_100256241 Ga0070670_1002562412 118
28 3300005335 Ga0070666_10256814 Ga0070666_102568143 118
29 3300005336 Ga0070680_100000382 Ga0070680_10000038221 118
30 3300005347 Ga0070668_100673643 Ga0070668_1006736431 118
31 3300005355 Ga0070671_100184077 Ga0070671_1001840772 118
32 3300005366 Ga0070659_100239832 Ga0070659_1002398322 118
33 3300005367 Ga0070667_100178015 Ga0070667_1001780151 118
34 3300005434 Ga0070709_10441656 Ga0070709_104416562 118
35 3300005435 Ga0070714_100433548 Ga0070714_1004335481 118
36 3300005436 Ga0070713_100430988 Ga0070713_1004309882 118
37 3300005439 Ga0070711_101699317 Ga0070711_1016993171 118
38 3300005458 Ga0070681_10000001 Ga0070681_10000001313 118
39 3300005530 Ga0070679_100002185 Ga0070679_10000218515 118
40 3300005539 Ga0068853_100303575 Ga0068853_1003035751 118
41 3300005577 Ga0068857_101556424 Ga0068857_1015564242 118
42 3300005614 Ga0068856_101073342 Ga0068856_1010733422 118
43 3300005616 Ga0068852_101100465 Ga0068852_1011004651 118
44 3300005616 Ga0068852_101227273 Ga0068852_1012272731 118
45 3300005719 Ga0068861_100879380 Ga0068861_1008793802 118
46 3300005841 Ga0068863_100528184 Ga0068863_1005281841 118
47 3300005844 Ga0068862_100201508 Ga0068862_1002015083 118
48 3300006028 Ga0070717_10137895 Ga0070717_101378953 118
49 3300006173 Ga0070716_101624035 Ga0070716_1016240351 118
50 3300006353 Ga0075370_10996961 Ga0075370_109969612 118
51 3300009093 Ga0105240_11648681 Ga0105240_116486811 118
52 3300009098 Ga0105245_12341466 Ga0105245_123414661 118
53 3300009174 Ga0105241_10316725 Ga0105241_103167252 118
54 3300009174 Ga0105241_12514186 Ga0105241_125141861 118
55 3300009177 Ga0105248_10000112 Ga0105248_1000011297 118
56 3300009545 Ga0105237_10784795 Ga0105237_107847952 118
57 3300009551 Ga0105238_10089040 Ga0105238_100890404 118
58 3300009551 Ga0105238_10101088 Ga0105238_101010882 118
59 3300009551 Ga0105238_10388875 Ga0105238_103888752 118
60 3300009553 Ga0105249_10372175 Ga0105249_103721753 118
61 3300010375 Ga0105239_10236530 Ga0105239_102365303 118
62 3300013297 Ga0157378_10848968 Ga0157378_108489682 118
63 3300013306 Ga0163162_10073204 Ga0163162_100732043 118
64 3300013306 Ga0163162_12377867 Ga0163162_123778672 118
65 3300013307 Ga0157372_12488476 Ga0157372_124884762 118
66 3300014325 Ga0163163_10036107 Ga0163163_100361073 118
67 3300014325 Ga0163163_10621394 Ga0163163_106213942 118
68 3300017792 Ga0163161_10258835 Ga0163161_102588352 118
69 3300021377 Ga0213874_10002411 Ga0213874_100024114 118
70 3300025208 Ga0209436_115051 Ga0209436_1150512 118
71 3300025245 Ga0207425_1013373 Ga0207425_10133733 118
72 3300025254 Ga0209148_1020438 Ga0209148_10204382 118
73 3300025261 Ga0209233_1010207 Ga0209233_10102072 118
74 3300025263 Ga0209565_1000029 Ga0209565_10000297 118
75 3300025273 Ga0209673_1005926 Ga0209673_10059264 118
76 3300025291 Ga0209675_1006906 Ga0209675_10069067 118
77 3300025297 Ga0209758_1003549 Ga0209758_100354910 118
78 3300025297 Ga0209758_1010479 Ga0209758_10104797 118
79 3300025298 Ga0209050_1000098 Ga0209050_1000098104 118
80 3300025298 Ga0209050_1009161 Ga0209050_10091615 118
81 3300025299 Ga0209256_1000008 Ga0209256_1000008616 118
82 3300025304 Ga0209257_1000235 Ga0209257_10002357 118
83 3300025304 Ga0209257_1004106 Ga0209257_100410616 118
84 3300025315 Ga0207697_10510263 Ga0207697_105102632 118
85 3300025898 Ga0207692_10886631 Ga0207692_108866312 118
86 3300025900 Ga0207710_10644407 Ga0207710_106444071 118
87 3300025903 Ga0207680_10324018 Ga0207680_103240183 118
88 3300025909 Ga0207705_10949194 Ga0207705_109491942 118
89 3300025912 Ga0207707_10000048 Ga0207707_100000482 118
90 3300025914 Ga0207671_10470630 Ga0207671_104706302 118
91 3300025917 Ga0207660_10000072 Ga0207660_1000007229 118
92 3300025921 Ga0207652_10000509 Ga0207652_100005092 118
93 3300025924 Ga0207694_10043454 Ga0207694_100434545 118
94 3300025924 Ga0207694_10131680 Ga0207694_101316802 118
95 3300025924 Ga0207694_10300720 Ga0207694_103007203 118
96 3300025925 Ga0207650_11307137 Ga0207650_113071371 118
97 3300025928 Ga0207700_10051771 Ga0207700_100517713 118
98 3300025931 Ga0207644_10253504 Ga0207644_102535042 118
99 3300025934 Ga0207686_10457461 Ga0207686_104574612 118
100 3300025941 Ga0207711_10000155 Ga0207711_1000015559 118
101 3300025961 Ga0207712_10282294 Ga0207712_102822942 118
102 3300025961 Ga0207712_10392096 Ga0207712_103920962 118
103 3300025986 Ga0207658_10469958 Ga0207658_104699583 118
104 3300026041 Ga0207639_10166988 Ga0207639_101669882 118
105 3300026118 Ga0207675_100433218 Ga0207675_1004332182 118
106 3300026142 Ga0207698_10528497 Ga0207698_105284972 118
107 3300028800 Ga0265338_10043971 Ga0265338_100439712 118
108 3300028800 Ga0265338_10067260 Ga0265338_100672604 118
109 3300028800 Ga0265338_10150597 Ga0265338_101505972 118
110 3300031090 Ga0265760_10289694 Ga0265760_102896942 118
111 3300031238 Ga0265332_10013523 Ga0265332_100135232 118
112 3300031241 Ga0265325_10282715 Ga0265325_102827152 118
113 3300031242 Ga0265329_10022989 Ga0265329_100229892 118
114 3300031242 Ga0265329_10041445 Ga0265329_100414451 118
115 3300031247 Ga0265340_10054470 Ga0265340_100544702 118
116 3300031249 Ga0265339_10016667 Ga0265339_100166675 118
117 3300031250 Ga0265331_10020969 Ga0265331_100209692 118
118 3300031250 Ga0265331_10022781 Ga0265331_100227814 118
119 3300031344 Ga0265316_10230390 Ga0265316_102303902 118
120 3300031595 Ga0265313_10113499 Ga0265313_101134992 118
121 3300031711 Ga0265314_10011976 Ga0265314_100119764 118
122 3300031711 Ga0265314_10224890 Ga0265314_102248902 118
123 3300031711 Ga0265314_10472142 Ga0265314_104721421 118
124 3300031711 Ga0265314_10631609 Ga0265314_106316091 118
125 3300031712 Ga0265342_10000178 Ga0265342_1000017859 118
126 3300031712 Ga0265342_10307933 Ga0265342_103079332 118
127 3300031731 Ga0307405_10754924 Ga0307405_107549241 118
128 3300031903 Ga0307407_11132615 Ga0307407_111326151 118
129 3300033180 Ga0307510_10051415 Ga0307510_100514155 118
130 3300033180 Ga0307510_10193869 Ga0307510_101938692 118
131 3300035172 Ga0373955_0315509 Ga0373955_0315509_90_467 118
132 3300035724 Ga0373933_1145065 Ga0373933_1145065_57_434 118
133 3300037418 Ga0395900_0007990 Ga0395900_0007990_8342_8707 118
134 3300037466 Ga0395898_0082584 Ga0395898_0082584_2415_2780 118
135 3300037471 Ga0395905_0026855 Ga0395905_0026855_4531_4896 118
136 3300037471 Ga0395905_0057232 Ga0395905_0057232_3154_3519 118
137 3300037471 Ga0395905_0478642 Ga0395905_0478642_396_761 118
138 3300039447 Ga0436361_0240108 Ga0436361_0240108_223_579 118
139 3300039447 Ga0436361_0655254 Ga0436361_0655254_308_664 118
140 3300039450 Ga0436363_0273296 Ga0436363_0273296_9157_9522 118
141 3300041410 Ga0439461_0002098 Ga0439461_0002098_1683_2039 118
142 3300041413 Ga0439465_0004006 Ga0439465_0004006_602_958 118
143 3300041997 Ga0439431_0006130 Ga0439431_0006130_1731_2087 118
144 3300041999 Ga0439433_0013419 Ga0439433_0013419_37_393 118
145 3300042004 Ga0439445_0016769 Ga0439445_0016769_649_1005 118
146 3300042006 Ga0439432_148471 Ga0439432_148471_206_562 118
147 3300042010 Ga0439452_083093 Ga0439452_083093_86_442 118
148 3300042014 Ga0439457_005332 Ga0439457_005332_2267_2623 118
149 3300042015 Ga0439462_0011654 Ga0439462_0011654_1758_2114 118
150 3300042435 Ga0439434_0021819 Ga0439434_0021819_1003_1359 118
151 3300044684 Ga0466966_0307929 Ga0466966_0307929_422_796 118
152 3300044842 Ga0466957_1088087 Ga0466957_1088087_146_505 118
153 3300046454 Ga0495592_0168823 Ga0495592_0168823_436_792 118
154 3300046460 Ga0495638_0148366 Ga0495638_0148366_116_481 118
155 3300046462 Ga0495651_0784836 Ga0495651_0784836_190_567 118
156 3300046471 Ga0495650_0000174 Ga0495650_0000174_57531_57887 118
157 3300046477 Ga0495664_0312385 Ga0495664_0312385_91_447 118
158 3300046506 Ga0495583_0000111 Ga0495583_0000111_40551_40916 118
159 3300046506 Ga0495583_0092565 Ga0495583_0092565_663_1022 118
160 3300046512 Ga0495610_0175768 Ga0495610_0175768_500_856 118
161 3300046518 Ga0495631_0012442 Ga0495631_0012442_1587_1946 118
162 3300046520 Ga0495637_0068915 Ga0495637_0068915_689_1048 118
163 3300046522 Ga0495643_0072104 Ga0495643_0072104_1176_1532 118
164 3300046524 Ga0495648_0099624 Ga0495648_0099624_650_1006 118
165 3300046525 Ga0495663_0002052 Ga0495663_0002052_889_1245 118
166 3300046529 Ga0495652_0377936 Ga0495652_0377936_291_647 118
167 3300046543 Ga0495645_0021073 Ga0495645_0021073_342_698 118
168 3300046648 Ga0495611_0015981 Ga0495611_0015981_617_973 118
169 3300046648 Ga0495611_0111375 Ga0495611_0111375_225_584 118
170 3300046660 Ga0495625_0258208 Ga0495625_0258208_403_762 118
171 3300046660 Ga0495625_0878750 Ga0495625_0878750_94_450 118
172 3300046678 Ga0495599_0348739 Ga0495599_0348739_406_762 118
173 3300046684 Ga0495669_0000934 Ga0495669_0000934_765_1124 118
174 3300046694 Ga0495649_0106636 Ga0495649_0106636_301_660 118
175 3300046694 Ga0495649_0240671 Ga0495649_0240671_263_619 118
176 3300046810 Ga0495660_0140712 Ga0495660_0140712_325_684 118
177 3300047323 Ga0495683_0016371 Ga0495683_0016371_2393_2749 118
178 3300047443 Ga0495687_000470 Ga0495687_000470_5492_5851 118
179 3300047443 Ga0495687_001894 Ga0495687_001894_8774_9133 118
180 3300047472 Ga0495686_0304868 Ga0495686_0304868_135_491 118
181 3300048904 Ga0496101_1454125 Ga0496101_1454125_85_441 118
182 3300048907 Ga0496104_1054706 Ga0496104_1054706_282_644 118
183 3300048909 Ga0496106_0484546 Ga0496106_0484546_153_515 118
184 3300048915 Ga0496112_0111301 Ga0496112_0111301_293_649 118
185 3300048922 Ga0496119_0016791 Ga0496119_0016791_2081_2437 118
186 3300048923 Ga0496120_0148587 Ga0496120_0148587_607_963 118
187 3300048924 Ga0496121_0072852 Ga0496121_0072852_1101_1457 118
188 3300048924 Ga0496121_0120333 Ga0496121_0120333_1599_1970 118
189 3300048928 Ga0496125_0034564 Ga0496125_0034564_4073_4429 118
190 3300048929 Ga0496126_0001024 Ga0496126_0001024_40435_40791 118
191 3300048929 Ga0496126_1009110 Ga0496126_1009110_51_407 118
192 3300048929 Ga0496126_1214371 Ga0496126_1214371_174_530 118
193 3300049569 Ga0501032_0167804 Ga0501032_0167804_85_441 118
194 3300049573 Ga0501037_0633555 Ga0501037_0633555_340_696 118
195 3300049581 Ga0501047_0002685 Ga0501047_0002685_15494_15850 118
196 3300049581 Ga0501047_0147916 Ga0501047_0147916_985_1341 118
197 3300049581 Ga0501047_1081657 Ga0501047_1081657_180_542 118
198 3300049583 Ga0501067_0001557 Ga0501067_0001557_11383_11739 118
199 3300049586 Ga0501070_0065751 Ga0501070_0065751_403_759 118
200 3300049586 Ga0501070_0158399 Ga0501070_0158399_411_767 118
201 3300049588 Ga0501072_0004954 Ga0501072_0004954_2338_2694 118
202 3300049589 Ga0501073_0014653 Ga0501073_0014653_4798_5154 118
203 3300049688 Ga0501259_132342 Ga0501259_132342_91_450 118
204 3300049741 Ga0501079_0031925 Ga0501079_0031925_3387_3743 118
205 3300049741 Ga0501079_1297294 Ga0501079_1297294_72_428 118
206 3300049742 Ga0501080_0559395 Ga0501080_0559395_62_418 118
207 3300049744 Ga0501083_0267436 Ga0501083_0267436_487_843 118
208 3300050496 nmdc:mga07m45_590602_c1 nmdc:mga07m45_590602_c1_131_487 118
209 3300053079 Ga0500610_0001132 Ga0500610_0001132_5367_5726 118
210 3300053083 Ga0495655_0137348 Ga0495655_0137348_26_382 118
211 3300053087 Ga0500643_054179 Ga0500643_054179_516_875 118
212 3300053103 Ga0500555_005985 Ga0500555_005985_1573_1938 118
213 3300053119 Ga0500595_005331 Ga0500595_005331_1136_1498 118
214 3300053119 Ga0500595_043274 Ga0500595_043274_423_779 118
215 3300053136 Ga0500559_0170586 Ga0500559_0170586_194_550 118
216 3300053153 Ga0500616_0188657 Ga0500616_0188657_340_696 118
217 3300053177 Ga0500636_0046172 Ga0500636_0046172_71_427 118
218 3300053177 Ga0500636_0046486 Ga0500636_0046486_1286_1642 118
219 3300053730 Ga0500645_000062 Ga0500645_000062_16604_16963 118
220 3300053737 Ga0500601_001114 Ga0500601_001114_747_1103 118
221 3300054114 Ga0501084_0000472 Ga0501084_0000472_9132_9488 118
222 3300054114 Ga0501084_0051662 Ga0501084_0051662_1203_1559 118
223 3300060353 Ga0501082_1526083 Ga0501082_1526083_137_493 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

2

103

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8937 2 115
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8928 2 113
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8429 2 113
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.7075 1 112
6qo0-assembly1.cif.gz_A i47w mutated sulfur oxygenase reductase from acidianus ambivaens 0.7021 2 84
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9014 2 115 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8721 2 115 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7378 2 94 3.30.70.100
af_Q9VXK0_45_165_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6989 2 118 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6856 1 116 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A521SEQ0-F1-model_v4 deleted 0.9194 1 110
AF-A0A521SEQ0-F1-model_v4 deleted 0.9113 1 110
AF-A0A2Z3I4M0-F1-model_v4 DUF1428 domain-containing protein 0.9063 1 118
AF-A0A0Q4Q0H1-F1-model_v4 RNA signal recognition particle 0.9032 2 115
AF-A0A7W5J2R1-F1-model_v4 Uncharacterized protein YbaA (DUF1428 family) 0.9028 2 117

Feature Viewer

pLDDT pTM Quality
90.5 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map