F335022

General Info

Members Datasets Scaffolds Average Seq Length
222 144 444 184

Family's Representative Sequence

Representative Sequence 3300053736|Ga0500599_000325|Ga0500599_000325_2478_3143
Length 221
Sequence VRIFGIDPGSVRTGYGCVDRDGSRHRLVTCGAIAAPSRLSFPERLLLIHTSLAAIIAECRPDAVAVESLFHAVNARSALQLGHARGVALLAASQAGLTIAEYAPAAVKRAVVGYGRAEKPQVRHMIRLLLGIAADDEESLPGPHDVSDALAVAICHIHSLGIGTSAAGVLQREATLDSRRSRGGRGTSWRAFKVESLEVSRSASASATTPASVVRPRPGRR

Samples

Sample ID Description Type Environment
1 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
72 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
75 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
82 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
111 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
112 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
134 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
135 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.07
Nodule 0
Rhizoplane 0.45
Rhizosphere 77.48
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500599_000325 3300053736 Bacteria 4681
2 Ga0070683_100807741 3300005329 Bacteria 899
3 Ga0068869_100324639 3300005334 Bacteria 1249
4 Ga0070668_100208489 3300005347 Bacteria 1607
5 Ga0070675_100318531 3300005354 Bacteria 1373
6 Ga0070674_101342586 3300005356 Unclassified 639
7 Ga0070688_100454612 3300005365 Bacteria 958
8 Ga0070714_100005580 3300005435 Bacteria 9611
9 Ga0070701_10057268 3300005438 Bacteria 2042
10 Ga0070698_100347738 3300005471 Bacteria 1414
11 Ga0070696_100479840 3300005546 Bacteria 986
12 Ga0070665_100162130 3300005548 Bacteria 2238
13 Ga0068852_100151934 3300005616 Bacteria 2154
14 Ga0068859_100126142 3300005617 Bacteria 2629
15 Ga0068861_100139279 3300005719 Bacteria 1979
16 Ga0081539_10117859 3300005985 Bacteria 1324
17 Ga0070717_10808876 3300006028 Bacteria 853
18 Ga0075368_10008321 3300006042 Bacteria 3688
19 Ga0075368_10134928 3300006042 Bacteria 1027
20 Ga0075363_100148019 3300006048 Bacteria 1324
21 Ga0075364_10040078 3300006051 Bacteria 3038
22 Ga0075364_10432853 3300006051 Bacteria 898
23 Ga0075364_10432854 3300006051 Bacteria 898
24 Ga0070712_100988715 3300006175 Bacteria 728
25 Ga0075362_10122577 3300006177 Bacteria 1231
26 Ga0075367_10071468 3300006178 Bacteria 2087
27 Ga0075367_10111094 3300006178 Bacteria 1682
28 Ga0075367_10258731 3300006178 Bacteria 1092
29 Ga0075367_10628796 3300006178 Bacteria 682
30 Ga0075427_10049511 3300006194 Bacteria 721
31 Ga0075366_10002531 3300006195 Bacteria 9396
32 Ga0075366_10005295 3300006195 Bacteria 6987
33 Ga0075366_10043181 3300006195 Bacteria 2670
34 Ga0075366_10124807 3300006195 Bacteria 1552
35 Ga0075366_10222904 3300006195 Bacteria 1149
36 Ga0075370_10010509 3300006353 Bacteria 4841
37 Ga0075370_10091048 3300006353 Bacteria 1759
38 Ga0075370_10222984 3300006353 Bacteria 1114
39 Ga0075428_100003840 3300006844 Bacteria 16498
40 Ga0075430_100000961 3300006846 Bacteria 22714
41 Ga0075430_100299724 3300006846 Bacteria 1330
42 Ga0075429_100014206 3300006880 Bacteria 6902
43 Ga0075429_100025416 3300006880 Bacteria 5140
44 Ga0097620_100126141 3300006931 Bacteria 2629
45 Ga0105240_10029559 3300009093 Bacteria 7136
46 Ga0105240_10118771 3300009093 Bacteria 3186
47 Ga0111539_10000870 3300009094 Bacteria 39436
48 Ga0111539_10426997 3300009094 Bacteria 1543
49 Ga0111539_11523728 3300009094 Bacteria 775
50 Ga0105247_10009654 3300009101 Bacteria 5853
51 Ga0114129_10000857 3300009147 Bacteria 39461
52 Ga0114129_10024472 3300009147 Bacteria 8555
53 Ga0114129_10245658 3300009147 Bacteria 2404
54 Ga0105237_10067887 3300009545 Bacteria 3559
55 Ga0157370_10462689 3300013104 Bacteria 1166
56 Ga0157375_10350326 3300013308 Bacteria 1642
57 Ga0163163_11731567 3300014325 Bacteria 686
58 Ga0157377_10187120 3300014745 Bacteria 1306
59 Ga0207710_10006090 3300025900 Bacteria 5166
60 Ga0207688_10158655 3300025901 Bacteria 1340
61 Ga0207680_10341556 3300025903 Bacteria 1050
62 Ga0207645_10423824 3300025907 Bacteria 897
63 Ga0207707_10067600 3300025912 Bacteria 3113
64 Ga0207681_10100223 3300025923 Bacteria 2088
65 Ga0207659_10220779 3300025926 Bacteria 1524
66 Ga0207691_10339207 3300025940 Bacteria 1287
67 Ga0207689_10164587 3300025942 Bacteria 1828
68 Ga0207668_10027164 3300025972 Bacteria 3727
69 Ga0207678_10914828 3300026067 Bacteria 776
70 Ga0207675_100510599 3300026118 Bacteria 1197
71 Ga0207675_100621267 3300026118 Bacteria 1085
72 Ga0207683_10221923 3300026121 Bacteria 1722
73 Ga0207698_10151658 3300026142 Bacteria 2013
74 Ga0209813_10020617 3300027866 Bacteria 1846
75 Ga0209813_10039490 3300027866 Bacteria 1431
76 Ga0207428_10001407 3300027907 Bacteria 25352
77 Ga0207428_10120655 3300027907 Bacteria 2010
78 Ga0207428_10644064 3300027907 Bacteria 761
79 Ga0268266_10171856 3300028379 Bacteria 1967
80 Ga0307408_100007220 3300031548 Bacteria 7348
81 Ga0307408_100108344 3300031548 Bacteria 2129
82 Ga0307408_100197500 3300031548 Unclassified 1625
83 Ga0307408_100260683 3300031548 Bacteria 1434
84 Ga0307405_10188354 3300031731 Bacteria 1488
85 Ga0307413_10138396 3300031824 Bacteria 1678
86 Ga0307413_10855905 3300031824 Bacteria 769
87 Ga0307410_10013809 3300031852 Bacteria 4727
88 Ga0307410_10556427 3300031852 Bacteria 951
89 Ga0307407_10079679 3300031903 Bacteria 1977
90 Ga0307412_10120582 3300031911 Bacteria 1887
91 Ga0307412_10257279 3300031911 Bacteria 1359
92 Ga0307412_10274804 3300031911 Bacteria 1320
93 Ga0307409_100027858 3300031995 Bacteria 4013
94 Ga0307409_100065126 3300031995 Bacteria 2866
95 Ga0307409_101750004 3300031995 Bacteria 650
96 Ga0307416_100005385 3300032002 Bacteria 7857
97 Ga0307416_100024794 3300032002 Bacteria 4385
98 Ga0307416_100046391 3300032002 Bacteria 3428
99 Ga0307416_100147717 3300032002 Bacteria 2150
100 Ga0307416_100229856 3300032002 Bacteria 1787
101 Ga0307416_101084222 3300032002 Bacteria 905
102 Ga0307416_101232219 3300032002 Bacteria 854
103 Ga0307414_10345751 3300032004 Bacteria 1275
104 Ga0307411_10015778 3300032005 Bacteria 4255
105 Ga0307411_10231288 3300032005 Bacteria 1441
106 Ga0307411_10255829 3300032005 Bacteria 1380
107 Ga0307411_10508285 3300032005 Bacteria 1020
108 Ga0307411_11003503 3300032005 Bacteria 747
109 Ga0307415_100045149 3300032126 Bacteria 2952
110 Ga0373936_0065651 3300035113 Bacteria 1489
111 Ga0373931_0114339 3300035691 Bacteria 1535
112 Ga0373937_0251481 3300036401 Bacteria 1666
113 Ga0439441_010631 3300042001 Bacteria 1548
114 Ga0439457_032267 3300042014 Bacteria 1163
115 Ga0439434_0126045 3300042435 Unclassified 838
116 Ga0439435_0004113 3300042436 Bacteria 3105
117 Ga0439435_0017097 3300042436 Bacteria 1829
118 Ga0439460_0163345 3300042461 Bacteria 747
119 Ga0451577_0155434 3300042876 Bacteria 2058
120 Ga0453684_0023641 3300044712 Bacteria 9032
121 Ga0466967_0735776 3300045976 Bacteria 978
122 Ga0495638_0001740 3300046460 Bacteria 19123
123 Ga0495667_0238149 3300046559 Bacteria 1160
124 Ga0495647_0032043 3300046681 Bacteria 1957
125 Ga0495593_0147704 3300047673 Bacteria 1190
126 Ga0496104_0916868 3300048907 Unclassified 781
127 Ga0501298_009755 3300049521 Bacteria 1639
128 Ga0501032_0008205 3300049569 Bacteria 7610
129 Ga0501033_0020881 3300049570 Bacteria 4943
130 Ga0501034_0072351 3300049571 Bacteria 3456
131 Ga0501036_0005695 3300049572 Bacteria 10106
132 Ga0501036_0086542 3300049572 Bacteria 2649
133 Ga0501036_0242358 3300049572 Bacteria 1512
134 Ga0501036_0844613 3300049572 Bacteria 753
135 Ga0501037_0001960 3300049573 Bacteria 14869
136 Ga0501037_0496412 3300049573 Bacteria 828
137 Ga0501038_0063672 3300049574 Bacteria 3146
138 Ga0501039_0024578 3300049575 Bacteria 4628
139 Ga0501039_0874178 3300049575 Bacteria 700
140 Ga0501040_0093119 3300049576 Bacteria 2096
141 Ga0501040_0152277 3300049576 Bacteria 1632
142 Ga0501040_0175828 3300049576 Bacteria 1517
143 Ga0501041_0081483 3300049577 Bacteria 1993
144 Ga0501042_0031405 3300049578 Bacteria 3756
145 Ga0501043_0013132 3300049579 Bacteria 6476
146 Ga0501046_0023436 3300049580 Bacteria 5078
147 Ga0501047_0071928 3300049581 Bacteria 3328
148 Ga0501048_0008075 3300049582 Bacteria 7966
149 Ga0501067_0001385 3300049583 Bacteria 13146
150 Ga0501068_0012541 3300049584 Bacteria 4810
151 Ga0501069_0003738 3300049585 Bacteria 7819
152 Ga0501070_0022268 3300049586 Bacteria 5309
153 Ga0501071_0019087 3300049587 Bacteria 4757
154 Ga0501071_0629214 3300049587 Bacteria 825
155 Ga0501072_0209254 3300049588 Bacteria 1554
156 Ga0501072_0700069 3300049588 Bacteria 796
157 Ga0501073_0008693 3300049589 Bacteria 7520
158 Ga0501074_0003931 3300049590 Bacteria 10589
159 Ga0501074_0014603 3300049590 Bacteria 5714
160 Ga0501074_0309230 3300049590 Bacteria 1123
161 Ga0501075_0014357 3300049591 Bacteria 5675
162 Ga0501075_0205775 3300049591 Bacteria 1501
163 Ga0501076_0327979 3300049592 Bacteria 1256
164 Ga0501077_0025618 3300049593 Bacteria 3745
165 Ga0501233_013818 3300049668 Bacteria 1643
166 Ga0501243_018890 3300049675 Bacteria 1127
167 Ga0501221_072288 3300049704 Bacteria 816
168 Ga0501079_0389300 3300049741 Bacteria 1093
169 Ga0501080_0061022 3300049742 Bacteria 3510
170 Ga0501083_0026727 3300049744 Bacteria 3987
171 Ga0501083_0442583 3300049744 Bacteria 846
172 Ga0501283_016788 3300049779 Bacteria 1139
173 Ga0501035_0027160 3300049822 Bacteria 5233
174 Ga0501044_0009040 3300049823 Bacteria 10890
175 Ga0501045_0036031 3300049824 Bacteria 3592
176 Ga0501045_0770832 3300049824 Bacteria 709
177 nmdc:mga03n38_48078_c1 3300050490 Bacteria 1891
178 nmdc:mga00v17_172457_c1 3300050491 Bacteria 1395
179 nmdc:mga00v17_296714_c1 3300050491 Bacteria 1050
180 nmdc:mga00v17_343596_c1 3300050491 Bacteria 970
181 nmdc:mga00v17_385062_c1 3300050491 Bacteria 912
182 nmdc:mga00v17_536965_c1 3300050491 Bacteria 757
183 nmdc:mga0k408_17316_c1 3300050493 Bacteria 4014
184 nmdc:mga0k408_19933_c1 3300050493 Bacteria 3754
185 nmdc:mga0k408_246105_c1 3300050493 Bacteria 1068
186 nmdc:mga0k408_25943_c1 3300050493 Bacteria 3321
187 nmdc:mga0k408_42504_c1 3300050493 Bacteria 2618
188 nmdc:mga06z11_133009_c1 3300050494 Bacteria 1399
189 nmdc:mga06z11_16358_c1 3300050494 Bacteria 3339
190 nmdc:mga06z11_21219_c1 3300050494 Bacteria 3015
191 nmdc:mga06z11_265644_c1 3300050494 Bacteria 1014
192 nmdc:mga04h51_12514_c1 3300050495 Bacteria 2383
193 nmdc:mga04h51_316857_c1 3300050495 Bacteria 639
194 nmdc:mga07m45_12720_c1 3300050496 Bacteria 4451
195 nmdc:mga07m45_26856_c1 3300050496 Bacteria 3167
196 nmdc:mga07m45_48197_c1 3300050496 Bacteria 2183
197 nmdc:mga05p37_135829_c1 3300050507 Bacteria 3016
198 nmdc:mga05p37_31095_c1 3300050507 Bacteria 6519
199 nmdc:mga05p37_436754_c1 3300050507 Bacteria 1519
200 nmdc:mga09592_3601_c1 3300050508 Bacteria 12502
201 nmdc:mga09592_3762_c1 3300050508 Bacteria 12226
202 nmdc:mga0qj67_255166_c1 3300050509 Bacteria 1423
203 nmdc:mga0qj67_7314_c1 3300050509 Bacteria 8161
204 nmdc:mga06r32_476928_c1 3300050510 Unclassified 1226
205 nmdc:mga08y16_40211_c1 3300050511 Bacteria 4902
206 nmdc:mga08y16_57474_c1 3300050511 Bacteria 4065
207 nmdc:mga08y16_650846_c1 3300050511 Bacteria 1058
208 nmdc:mga08y16_735_c1 3300050511 Bacteria 31112
209 Ga0495595_0172484 3300053084 Bacteria 1071
210 Ga0500651_0147928 3300053093 Bacteria 1412
211 Ga0500555_000060 3300053103 Bacteria 55800
212 Ga0500592_026411 3300053116 Bacteria 936
213 Ga0500628_015533 3300053129 Bacteria 1458
214 Ga0500568_0001557 3300053139 Bacteria 14538
215 Ga0500616_0000336 3300053153 Bacteria 67042
216 Ga0500645_001532 3300053730 Bacteria 11553
217 Ga0501084_0007476 3300054114 Bacteria 9007
218 Ga0590071_008874 3300059421 Bacteria 2363
219 Ga0590075_018192 3300059424 Unclassified 1737
220 Ga0590077_007691 3300059426 Bacteria 2203
221 Ga0501082_0003063 3300060353 Bacteria 14588
222 Ga0530510_0128750 3300061734 Bacteria 1862
223 Ga0500599_000325
224 Ga0070683_100807741
225 Ga0068869_100324639
226 Ga0070668_100208489
227 Ga0070675_100318531
228 Ga0070674_101342586
229 Ga0070688_100454612
230 Ga0070714_100005580
231 Ga0070701_10057268
232 Ga0070698_100347738
233 Ga0070696_100479840
234 Ga0070665_100162130
235 Ga0068852_100151934
236 Ga0068859_100126142
237 Ga0068861_100139279
238 Ga0081539_10117859
239 Ga0070717_10808876
240 Ga0075368_10008321
241 Ga0075368_10134928
242 Ga0075363_100148019
243 Ga0075364_10040078
244 Ga0075364_10432853
245 Ga0075364_10432854
246 Ga0070712_100988715
247 Ga0075362_10122577
248 Ga0075367_10071468
249 Ga0075367_10111094
250 Ga0075367_10258731
251 Ga0075367_10628796
252 Ga0075427_10049511
253 Ga0075366_10002531
254 Ga0075366_10005295
255 Ga0075366_10043181
256 Ga0075366_10124807
257 Ga0075366_10222904
258 Ga0075370_10010509
259 Ga0075370_10091048
260 Ga0075370_10222984
261 Ga0075428_100003840
262 Ga0075430_100000961
263 Ga0075430_100299724
264 Ga0075429_100014206
265 Ga0075429_100025416
266 Ga0097620_100126141
267 Ga0105240_10029559
268 Ga0105240_10118771
269 Ga0111539_10000870
270 Ga0111539_10426997
271 Ga0111539_11523728
272 Ga0105247_10009654
273 Ga0114129_10000857
274 Ga0114129_10024472
275 Ga0114129_10245658
276 Ga0105237_10067887
277 Ga0157370_10462689
278 Ga0157375_10350326
279 Ga0163163_11731567
280 Ga0157377_10187120
281 Ga0207710_10006090
282 Ga0207688_10158655
283 Ga0207680_10341556
284 Ga0207645_10423824
285 Ga0207707_10067600
286 Ga0207681_10100223
287 Ga0207659_10220779
288 Ga0207691_10339207
289 Ga0207689_10164587
290 Ga0207668_10027164
291 Ga0207678_10914828
292 Ga0207675_100510599
293 Ga0207675_100621267
294 Ga0207683_10221923
295 Ga0207698_10151658
296 Ga0209813_10020617
297 Ga0209813_10039490
298 Ga0207428_10001407
299 Ga0207428_10120655
300 Ga0207428_10644064
301 Ga0268266_10171856
302 Ga0307408_100007220
303 Ga0307408_100108344
304 Ga0307408_100197500
305 Ga0307408_100260683
306 Ga0307405_10188354
307 Ga0307413_10138396
308 Ga0307413_10855905
309 Ga0307410_10013809
310 Ga0307410_10556427
311 Ga0307407_10079679
312 Ga0307412_10120582
313 Ga0307412_10257279
314 Ga0307412_10274804
315 Ga0307409_100027858
316 Ga0307409_100065126
317 Ga0307409_101750004
318 Ga0307416_100005385
319 Ga0307416_100024794
320 Ga0307416_100046391
321 Ga0307416_100147717
322 Ga0307416_100229856
323 Ga0307416_101084222
324 Ga0307416_101232219
325 Ga0307414_10345751
326 Ga0307411_10015778
327 Ga0307411_10231288
328 Ga0307411_10255829
329 Ga0307411_10508285
330 Ga0307411_11003503
331 Ga0307415_100045149
332 Ga0373936_0065651
333 Ga0373931_0114339
334 Ga0373937_0251481
335 Ga0439441_010631
336 Ga0439457_032267
337 Ga0439434_0126045
338 Ga0439435_0004113
339 Ga0439435_0017097
340 Ga0439460_0163345
341 Ga0451577_0155434
342 Ga0453684_0023641
343 Ga0466967_0735776
344 Ga0495638_0001740
345 Ga0495667_0238149
346 Ga0495647_0032043
347 Ga0495593_0147704
348 Ga0496104_0916868
349 Ga0501298_009755
350 Ga0501032_0008205
351 Ga0501033_0020881
352 Ga0501034_0072351
353 Ga0501036_0005695
354 Ga0501036_0086542
355 Ga0501036_0242358
356 Ga0501036_0844613
357 Ga0501037_0001960
358 Ga0501037_0496412
359 Ga0501038_0063672
360 Ga0501039_0024578
361 Ga0501039_0874178
362 Ga0501040_0093119
363 Ga0501040_0152277
364 Ga0501040_0175828
365 Ga0501041_0081483
366 Ga0501042_0031405
367 Ga0501043_0013132
368 Ga0501046_0023436
369 Ga0501047_0071928
370 Ga0501048_0008075
371 Ga0501067_0001385
372 Ga0501068_0012541
373 Ga0501069_0003738
374 Ga0501070_0022268
375 Ga0501071_0019087
376 Ga0501071_0629214
377 Ga0501072_0209254
378 Ga0501072_0700069
379 Ga0501073_0008693
380 Ga0501074_0003931
381 Ga0501074_0014603
382 Ga0501074_0309230
383 Ga0501075_0014357
384 Ga0501075_0205775
385 Ga0501076_0327979
386 Ga0501077_0025618
387 Ga0501233_013818
388 Ga0501243_018890
389 Ga0501221_072288
390 Ga0501079_0389300
391 Ga0501080_0061022
392 Ga0501083_0026727
393 Ga0501083_0442583
394 Ga0501283_016788
395 Ga0501035_0027160
396 Ga0501044_0009040
397 Ga0501045_0036031
398 Ga0501045_0770832
399 nmdc:mga03n38_48078_c1
400 nmdc:mga00v17_172457_c1
401 nmdc:mga00v17_296714_c1
402 nmdc:mga00v17_343596_c1
403 nmdc:mga00v17_385062_c1
404 nmdc:mga00v17_536965_c1
405 nmdc:mga0k408_17316_c1
406 nmdc:mga0k408_19933_c1
407 nmdc:mga0k408_246105_c1
408 nmdc:mga0k408_25943_c1
409 nmdc:mga0k408_42504_c1
410 nmdc:mga06z11_133009_c1
411 nmdc:mga06z11_16358_c1
412 nmdc:mga06z11_21219_c1
413 nmdc:mga06z11_265644_c1
414 nmdc:mga04h51_12514_c1
415 nmdc:mga04h51_316857_c1
416 nmdc:mga07m45_12720_c1
417 nmdc:mga07m45_26856_c1
418 nmdc:mga07m45_48197_c1
419 nmdc:mga05p37_135829_c1
420 nmdc:mga05p37_31095_c1
421 nmdc:mga05p37_436754_c1
422 nmdc:mga09592_3601_c1
423 nmdc:mga09592_3762_c1
424 nmdc:mga0qj67_255166_c1
425 nmdc:mga0qj67_7314_c1
426 nmdc:mga06r32_476928_c1
427 nmdc:mga08y16_40211_c1
428 nmdc:mga08y16_57474_c1
429 nmdc:mga08y16_650846_c1
430 nmdc:mga08y16_735_c1
431 Ga0495595_0172484
432 Ga0500651_0147928
433 Ga0500555_000060
434 Ga0500592_026411
435 Ga0500628_015533
436 Ga0500568_0001557
437 Ga0500616_0000336
438 Ga0500645_001532
439 Ga0501084_0007476
440 Ga0590071_008874
441 Ga0590075_018192
442 Ga0590077_007691
443 Ga0501082_0003063
444 Ga0530510_0128750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

3

156

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lw3-assembly1.cif.gz_B crystal structure of ruvc from pseudomonas aeruginosa 0.9587 2 153
1hjr-assembly2.cif.gz_D atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli 0.9525 1 156
7xhj-assembly1.cif.gz_A crystal structure of ruvc from deinococcus radiodurans 0.9497 1 154
7w8d-assembly1.cif.gz_B the structure of deinococcus radiodurans ruvc 0.9467 1 155
6s16-assembly1.cif.gz_B t. thermophilus ruvc in complex with holliday junction substrate 0.9449 2 158
ID Description Score Start End Superfamily
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9544 1 159 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9524 1 158 3.30.420.10
4ld0B00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9415 1 157 3.30.420.10
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9373 1 159 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.935 1 158 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7C1K5F8-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9859 1 159 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A7V3AH78-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9829 1 154 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A0L0APH8-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9829 2 166 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A2H0P7L5-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9821 1 152 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A1V5S974-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.982 1 166 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476

Map