F334725

General Info

Members Datasets Scaffolds Average Seq Length
222 175 198 353

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0008088|Ga0451577_0008088_4097_5278
Length 393
Sequence MAQRIALITGVTGQDGAYLSEYLLKKGYMVHGIKRRSSLFNTDRIDHLYEDPHVENRHFKLHYGDLTDSMNLTRIIQETQPDEIYNLAAMSHVAVSFETPEYTGNADGLGTLRILEAVRLLGMIPKTRIYQASTSELYGMVQQVPQTEKTPFYPRSPYAVAKMYAYWITVNYREAYQMHASNGILFNHESPVRGETFVTRKITRAISRIALGMQDQLFLGNLSSKRDWGHAKDYVRAMYLILQQDQPDDYVIATGITTTIRDFIKMACNEIGLEIAFQGEGANEKGLIVGIDDKVFIEKVGEHYLAGIKARMVPDAVDKGLSKSIVSVDPKYFRPTEVDLLIGDPTKAKTKLGWEPKYDLQGLVTDMMQSDIKVMKKDTWLREGGYRTLNYFE

Samples

Sample ID Description Type Environment
1 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
2 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
3 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
6 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
7 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
8 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
9 2831426010 Nostoc sp. 106C Isolate Unclassified
10 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
11 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
12 2849660919 Nostoc sp. T09 Isolate Unclassified
13 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
14 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
15 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
16 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
17 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
18 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
19 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
128 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
132 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
135 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
136 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
174 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
175 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.74
Metatranscriptomes 0.45
Isolates 10.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 0
Rhizoplane 0.45
Rhizosphere 73.87
Stem 0
Stem Tuber 0
Unclassified 14.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10144356 3300003320 Bacteria 4021
2 Ga0055526_1001231 3300003771 Bacteria 18409
3 Ga0055524_1000051 3300003775 Bacteria 146215
4 Ga0055531_10001513 3300003794 Bacteria 17069
5 Ga0065715_10094172 3300005293 Bacteria 4422
6 Ga0070676_10016784 3300005328 Bacteria 4047
7 Ga0070683_100000417 3300005329 Bacteria 29450
8 Ga0070690_100008216 3300005330 Bacteria 6004
9 Ga0070690_100016645 3300005330 Bacteria 4409
10 Ga0070670_100144217 3300005331 Bacteria 2060
11 Ga0070680_100219155 3300005336 Bacteria 1606
12 Ga0068868_100005331 3300005338 Bacteria 9027
13 Ga0070668_100066617 3300005347 Bacteria 2795
14 Ga0070674_100025109 3300005356 Bacteria 3875
15 Ga0070674_100044823 3300005356 Bacteria 3019
16 Ga0070713_100059033 3300005436 Bacteria 3202
17 Ga0070678_100106673 3300005456 Bacteria 2183
18 Ga0070684_100161573 3300005535 Bacteria 2032
19 Ga0068853_100029097 3300005539 Bacteria 4653
20 Ga0070695_100223846 3300005545 Bacteria 1357
21 Ga0070696_100057360 3300005546 Bacteria 2718
22 Ga0068855_100005031 3300005563 Bacteria 16133
23 Ga0068855_100108375 3300005563 Bacteria 3190
24 Ga0070664_100002176 3300005564 Bacteria 15740
25 Ga0068854_100087578 3300005578 Bacteria 2311
26 Ga0068856_100072705 3300005614 Bacteria 3404
27 Ga0068856_100079526 3300005614 Bacteria 3251
28 Ga0068852_100002758 3300005616 Bacteria 12170
29 Ga0068864_100006488 3300005618 Bacteria 9584
30 Ga0068866_10102649 3300005718 Bacteria 1580
31 Ga0068851_10003287 3300005834 Bacteria 7176
32 Ga0068862_100008486 3300005844 Bacteria 8498
33 Ga0075368_10008530 3300006042 Bacteria 3654
34 Ga0070715_10061034 3300006163 Bacteria 1655
35 Ga0075362_10013477 3300006177 Bacteria 3273
36 Ga0075367_10006856 3300006178 Bacteria 5794
37 Ga0075366_10009679 3300006195 Bacteria 5386
38 Ga0097621_100075796 3300006237 Bacteria 2789
39 Ga0075370_10001286 3300006353 Bacteria 10717
40 Ga0075370_10002050 3300006353 Bacteria 9157
41 Ga0068871_100002507 3300006358 Bacteria 12529
42 Ga0068871_100097403 3300006358 Bacteria 2459
43 Ga0075429_100173860 3300006880 Bacteria 1887
44 Ga0099794_10006043 3300007265 Bacteria 4888
45 Ga0099795_10044748 3300007788 Bacteria 1589
46 Ga0105240_10022072 3300009093 Bacteria 8448
47 Ga0105240_10376549 3300009093 Bacteria 1604
48 Ga0111539_10029878 3300009094 Bacteria 6629
49 Ga0111539_10070711 3300009094 Bacteria 4119
50 Ga0105247_10367425 3300009101 Bacteria 1016
51 Ga0114129_10031645 3300009147 Bacteria 7478
52 Ga0105237_10002324 3300009545 Bacteria 23602
53 Ga0105237_10141463 3300009545 Bacteria 2400
54 Ga0105238_10064888 3300009551 Bacteria 3652
55 Ga0105238_10231198 3300009551 Bacteria 1826
56 Ga0105249_10430738 3300009553 Bacteria 1355
57 Ga0105239_10087024 3300010375 Bacteria 3444
58 Ga0105239_10143032 3300010375 Bacteria 2667
59 Ga0157371_10024729 3300013102 Bacteria 4382
60 Ga0157370_10005565 3300013104 Bacteria 14122
61 Ga0157370_10184713 3300013104 Bacteria 1936
62 Ga0157378_10131320 3300013297 Bacteria 2318
63 Ga0163162_10172262 3300013306 Bacteria 2289
64 Ga0157375_10197685 3300013308 Bacteria 2166
65 Ga0182008_10000054 3300014497 Bacteria 102738
66 Ga0182008_10001315 3300014497 Bacteria 16973
67 Ga0157376_10018423 3300014969 Bacteria 5353
68 Ga0182006_1011462 3300015261 Bacteria 3897
69 Ga0213876_10003317 3300021384 Bacteria 9232
70 Ga0209675_1000459 3300025291 Bacteria 31303
71 Ga0209564_1000048 3300025295 Bacteria 364806
72 Ga0209256_1000041 3300025299 Bacteria 364827
73 Ga0207647_10036915 3300025904 Bacteria 3102
74 Ga0207645_10012085 3300025907 Bacteria 5868
75 Ga0207654_10158442 3300025911 Bacteria 1460
76 Ga0207695_10017140 3300025913 Bacteria 8443
77 Ga0207671_10013679 3300025914 Bacteria 6447
78 Ga0207671_10095765 3300025914 Bacteria 2242
79 Ga0207662_10084801 3300025918 Bacteria 1939
80 Ga0207649_10235362 3300025920 Bacteria 1312
81 Ga0207694_10154961 3300025924 Bacteria 1847
82 Ga0207650_10001545 3300025925 Bacteria 16493
83 Ga0207650_10034123 3300025925 Bacteria 3689
84 Ga0207687_10249019 3300025927 Bacteria 1411
85 Ga0207664_10000023 3300025929 Bacteria 204730
86 Ga0207690_10057025 3300025932 Bacteria 2638
87 Ga0207706_10010240 3300025933 Bacteria 8573
88 Ga0207670_10137876 3300025936 Bacteria 1796
89 Ga0207669_10008638 3300025937 Bacteria 4795
90 Ga0207665_10100998 3300025939 Bacteria 2014
91 Ga0207691_10001514 3300025940 Bacteria 23111
92 Ga0207711_10001204 3300025941 Bacteria 24487
93 Ga0207679_10002751 3300025945 Bacteria 10879
94 Ga0207667_10002976 3300025949 Bacteria 21053
95 Ga0207667_10134560 3300025949 Bacteria 2545
96 Ga0207712_10016632 3300025961 Bacteria 4768
97 Ga0207712_10022684 3300025961 Bacteria 4136
98 Ga0207712_10272132 3300025961 Bacteria 1378
99 Ga0207640_10033230 3300025981 Bacteria 3208
100 Ga0207658_10016056 3300025986 Bacteria 5143
101 Ga0207639_10091067 3300026041 Bacteria 2441
102 Ga0207702_10074912 3300026078 Bacteria 2923
103 Ga0207676_10043166 3300026095 Bacteria 3470
104 Ga0207674_10019780 3300026116 Bacteria 7286
105 Ga0207698_10056379 3300026142 Bacteria 3034
106 Ga0209813_10034650 3300027866 Bacteria 1508
107 Ga0268266_10001367 3300028379 Bacteria 29455
108 Ga0268266_10004177 3300028379 Bacteria 13928
109 Ga0268265_10004570 3300028380 Bacteria 9574
110 Ga0268264_10000814 3300028381 Bacteria 33650
111 Ga0268264_10015695 3300028381 Bacteria 6203
112 Ga0307511_10015499 3300030521 Bacteria 7385
113 Ga0265330_10015226 3300031235 Bacteria 3559
114 Ga0265331_10004203 3300031250 Bacteria 9020
115 Ga0265327_10000135 3300031251 Bacteria 162683
116 Ga0265313_10031294 3300031595 Bacteria 2729
117 Ga0316579_10054322 3300031691 Bacteria 1878
118 Ga0316578_10055239 3300031728 Bacteria 2330
119 Ga0316577_10021693 3300031733 Bacteria 3564
120 Ga0316577_10075262 3300031733 Bacteria 1885
121 Ga0307414_10008212 3300032004 Bacteria 5906
122 Ga0307414_10021991 3300032004 Bacteria 4013
123 Ga0307414_10058162 3300032004 Bacteria 2722
124 Ga0373945_0101835 3300035116 Bacteria 1125
125 Ga0373953_0018870 3300035117 Bacteria 2558
126 Ga0373955_0018775 3300035172 Bacteria 3446
127 Ga0373935_0200677 3300035692 Bacteria 1378
128 Ga0373927_0046194 3300035695 Bacteria 2818
129 Ga0373937_0009927 3300036401 Bacteria 8300
130 Ga0316582_0029062 3300036647 Bacteria 3355
131 Ga0400486_10724 3300038742 Bacteria 6162
132 Ga0400483_095539 3300039062 Bacteria 26062
133 Ga0400483_180499 3300039062 Bacteria 14955
134 Ga0436365_1399871 3300039437 Bacteria 18429
135 Ga0436363_0257496 3300039450 Bacteria 2713
136 Ga0451833_0496165 3300041491 Bacteria 24618
137 Ga0451835_0135447 3300041492 Bacteria 21169
138 Ga0451837_1008086 3300041494 Bacteria 23146
139 Ga0451845_0258812 3300041501 Bacteria 24581
140 Ga0451847_0703683 3300041503 Bacteria 2641
141 Ga0451851_0203132 3300041507 Bacteria 10301
142 Ga0451853_0412421 3300041512 Bacteria 24211
143 Ga0439441_002002 3300042001 Bacteria 2803
144 Ga0439460_0014802 3300042461 Bacteria 2055
145 Ga0451577_0000066 3300042876 Bacteria 257650
146 Ga0451577_0008088 3300042876 Bacteria 10264
147 Ga0451577_0086389 3300042876 Bacteria 2799
148 Ga0451577_0107199 3300042876 Bacteria 2497
149 Ga0451577_0158510 3300042876 Bacteria 2037
150 Ga0453683_0034511 3300044673 Bacteria 3189
151 Ga0453683_0038538 3300044673 Bacteria 3004
152 Ga0453683_0073072 3300044673 Bacteria 2147
153 Ga0453684_0000051 3300044712 Bacteria 551033
154 Ga0453684_0000226 3300044712 Bacteria 244912
155 Ga0453684_0001932 3300044712 Bacteria 53485
156 Ga0453684_0003254 3300044712 Bacteria 37126
157 Ga0453684_0004080 3300044712 Bacteria 31722
158 Ga0453684_0008486 3300044712 Bacteria 18374
159 Ga0453684_0036879 3300044712 Bacteria 6726
160 Ga0453684_0079478 3300044712 Bacteria 4099
161 Ga0453684_0346150 3300044712 Bacteria 1677
162 Ga0451576_0025089 3300045051 Bacteria 6428
163 Ga0451576_0344779 3300045051 Bacteria 1560
164 Ga0495638_0000293 3300046460 Bacteria 65718
165 Ga0495580_0004180 3300046472 Bacteria 12147
166 Ga0495662_0010483 3300046476 Bacteria 4537
167 Ga0495608_0005617 3300046511 Bacteria 8962
168 Ga0495628_0038554 3300046516 Bacteria 3824
169 Ga0495628_0314637 3300046516 Bacteria 1156
170 Ga0495630_0018367 3300046517 Bacteria 5138
171 Ga0495630_0050278 3300046517 Bacteria 3120
172 Ga0495640_0012774 3300046533 Bacteria 6409
173 Ga0495586_0005806 3300046535 Bacteria 6599
174 Ga0495622_0006393 3300046557 Bacteria 5469
175 Ga0495667_0041065 3300046559 Bacteria 3069
176 Ga0495634_0011307 3300046642 Bacteria 6499
177 Ga0495634_0189194 3300046642 Bacteria 1285
178 Ga0495613_0009248 3300046689 Bacteria 7309
179 Ga0495604_0030538 3300047317 Bacteria 4279
180 Ga0495680_0007630 3300047322 Bacteria 9880
181 Ga0501323_007778 3300049539 Bacteria 1231
182 Ga0501038_0193241 3300049574 Bacteria 1637
183 Ga0501249_002229 3300049679 Bacteria 3937
184 Ga0501083_0066554 3300049744 Bacteria 2399
185 Ga0501044_0109827 3300049823 Bacteria 2767
186 nmdc:mga0k408_1024_c1 3300050493 Bacteria 10916
187 nmdc:mga0k408_67953_c1 3300050493 Bacteria 2078
188 nmdc:mga0k408_8767_c1 3300050493 Bacteria 5443
189 nmdc:mga06z11_5923_c1 3300050494 Bacteria 4938
190 nmdc:mga07m45_6582_c1 3300050496 Bacteria 3305
191 nmdc:mga07m45_7612_c1 3300050496 Bacteria 5540
192 nmdc:mga05p37_27395_c1 3300050507 Bacteria 6937
193 nmdc:mga09592_492003_c1 3300050508 Bacteria 1056
194 Ga0500644_0015538 3300053088 Bacteria 2174
195 Ga0500646_0026307 3300053090 Bacteria 1576
196 Ga0500641_0000007 3300053096 Bacteria 206510
197 Ga0500616_0000074 3300053153 Bacteria 222910
198 Ga0500622_0000303 3300053156 Bacteria 50358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10367425 Ga0105247_103674251 293
2 3300050493 nmdc:mga0k408_67953_c1 nmdc:mga0k408_67953_c1_49_987 312
3 3300050508 nmdc:mga09592_492003_c1 nmdc:mga09592_492003_c1_86_1036 316
4 3300044712 Ga0453684_0346150 Ga0453684_0346150_689_1648 319
5 3300005330 Ga0070690_100008216 Ga0070690_1000082165 320
6 3300005338 Ga0068868_100005331 Ga0068868_1000053312 320
7 3300005347 Ga0070668_100066617 Ga0070668_1000666172 320
8 3300005356 Ga0070674_100025109 Ga0070674_1000251092 320
9 3300005456 Ga0070678_100106673 Ga0070678_1001066732 320
10 3300005539 Ga0068853_100029097 Ga0068853_1000290974 320
11 3300005545 Ga0070695_100223846 Ga0070695_1002238462 320
12 3300005564 Ga0070664_100002176 Ga0070664_1000021763 320
13 3300005578 Ga0068854_100087578 Ga0068854_1000875783 320
14 3300005618 Ga0068864_100006488 Ga0068864_1000064883 320
15 3300005718 Ga0068866_10102649 Ga0068866_101026492 320
16 3300005844 Ga0068862_100008486 Ga0068862_1000084868 320
17 3300009551 Ga0105238_10231198 Ga0105238_102311982 320
18 3300010375 Ga0105239_10087024 Ga0105239_100870242 320
19 3300013102 Ga0157371_10024729 Ga0157371_100247294 320
20 3300013297 Ga0157378_10131320 Ga0157378_101313202 320
21 3300025904 Ga0207647_10036915 Ga0207647_100369151 320
22 3300025907 Ga0207645_10012085 Ga0207645_100120854 320
23 3300025911 Ga0207654_10158442 Ga0207654_101584422 320
24 3300025918 Ga0207662_10084801 Ga0207662_100848012 320
25 3300025920 Ga0207649_10235362 Ga0207649_102353622 320
26 3300025924 Ga0207694_10154961 Ga0207694_101549612 320
27 3300025925 Ga0207650_10001545 Ga0207650_100015456 320
28 3300025932 Ga0207690_10057025 Ga0207690_100570252 320
29 3300025933 Ga0207706_10010240 Ga0207706_100102405 320
30 3300025936 Ga0207670_10137876 Ga0207670_101378762 320
31 3300025940 Ga0207691_10001514 Ga0207691_1000151417 320
32 3300025941 Ga0207711_10001204 Ga0207711_1000120420 320
33 3300025945 Ga0207679_10002751 Ga0207679_1000275110 320
34 3300025961 Ga0207712_10016632 Ga0207712_100166323 320
35 3300025961 Ga0207712_10022684 Ga0207712_100226843 320
36 3300025981 Ga0207640_10033230 Ga0207640_100332302 320
37 3300025986 Ga0207658_10016056 Ga0207658_100160564 320
38 3300026041 Ga0207639_10091067 Ga0207639_100910672 320
39 3300026095 Ga0207676_10043166 Ga0207676_100431663 320
40 3300026116 Ga0207674_10019780 Ga0207674_100197802 320
41 3300028379 Ga0268266_10001367 Ga0268266_100013676 320
42 3300028379 Ga0268266_10004177 Ga0268266_100041773 320
43 3300028380 Ga0268265_10004570 Ga0268265_100045703 320
44 3300028381 Ga0268264_10000814 Ga0268264_1000081412 320
45 3300028381 Ga0268264_10015695 Ga0268264_100156955 320
46 3300009147 Ga0114129_10031645 Ga0114129_100316453 325
47 3300009553 Ga0105249_10430738 Ga0105249_104307381 325
48 3300025961 Ga0207712_10272132 Ga0207712_102721321 325
49 3300050507 nmdc:mga05p37_27395_c1 nmdc:mga05p37_27395_c1_1607_2596 325
50 3300031728 Ga0316578_10055239 Ga0316578_100552392 326
51 3300046557 Ga0495622_0006393 Ga0495622_0006393_31_1023 326
52 3300005331 Ga0070670_100144217 Ga0070670_1001442172 332
53 3300025925 Ga0207650_10034123 Ga0207650_100341233 332
54 3300044673 Ga0453683_0073072 Ga0453683_0073072_531_1559 333
55 3300005614 Ga0068856_100079526 Ga0068856_1000795263 334
56 3300007265 Ga0099794_10006043 Ga0099794_100060434 334
57 3300007788 Ga0099795_10044748 Ga0099795_100447482 334
58 3300009093 Ga0105240_10376549 Ga0105240_103765492 334
59 3300026078 Ga0207702_10074912 Ga0207702_100749123 334
60 3300031733 Ga0316577_10075262 Ga0316577_100752622 334
61 3300035692 Ga0373935_0200677 Ga0373935_0200677_172_1188 334
62 3300036647 Ga0316582_0029062 Ga0316582_0029062_2212_3231 334
63 3300046516 Ga0495628_0314637 Ga0495628_0314637_104_1111 334
64 3300046642 Ga0495634_0189194 Ga0495634_0189194_216_1241 339
65 3300013104 Ga0157370_10184713 Ga0157370_101847133 340
66 iso_pu_bacteria 2617270889 2617913923 341
67 iso_pu_bacteria 2831426010 2831429301 341
68 iso_pu_bacteria 2848694841 2848702565 341
69 iso_pu_bacteria 2849660919 2849661325 341
70 iso_pu_bacteria 2849660919 2849665203 341
71 iso_pu_bacteria 2886627955 2886632415 341
72 iso_pu_bacteria 2913844669 2913845521 341
73 iso_pu_bacteria 2913912277 2913913864 341
74 iso_pu_bacteria 2913912277 2913918375 341
75 iso_pu_bacteria 2913939268 2913944377 341
76 iso_pu_bacteria 642555144 642602481 341
77 3300039450 Ga0436363_0257496 Ga0436363_0257496_1228_2307 342
78 3300044712 Ga0453684_0004080 Ga0453684_0004080_11768_12847 342
79 3300045051 Ga0451576_0025089 Ga0451576_0025089_153_1235 342
80 3300042001 Ga0439441_002002 Ga0439441_002002_672_1772 343
81 3300035116 Ga0373945_0101835 Ga0373945_0101835_58_1092 344
82 3300006237 Ga0097621_100075796 Ga0097621_1000757962 346
83 3300006358 Ga0068871_100097403 Ga0068871_1000974032 346
84 3300049744 Ga0501083_0066554 Ga0501083_0066554_1286_2338 348
85 iso_pu_bacteria 2643221552 2643780017 348
86 iso_pu_bacteria 2585428095 2587865866 349
87 3300046460 Ga0495638_0000293 Ga0495638_0000293_34482_35555 351
88 3300003771 Ga0055526_1001231 Ga0055526_10012314 352
89 3300003775 Ga0055524_1000051 Ga0055524_100005168 352
90 3300025291 Ga0209675_1000459 Ga0209675_10004593 352
91 3300025295 Ga0209564_1000048 Ga0209564_1000048196 352
92 3300025299 Ga0209256_1000041 Ga0209256_1000041196 352
93 3300031235 Ga0265330_10015226 Ga0265330_100152262 352
94 3300031595 Ga0265313_10031294 Ga0265313_100312943 352
95 3300049539 Ga0501323_007778 Ga0501323_007778_93_1166 352
96 3300014497 Ga0182008_10000054 Ga0182008_1000005469 353
97 3300044712 Ga0453684_0008486 Ga0453684_0008486_7418_8479 353
98 3300049574 Ga0501038_0193241 Ga0501038_0193241_364_1437 353
99 3300049823 Ga0501044_0109827 Ga0501044_0109827_311_1384 353
100 iso_pu_bacteria 2848858292 2848865086 355
101 iso_pu_bacteria 2667528175 2671124395 356
102 iso_pu_bacteria 2721755487 2722725810 358
103 3300005336 Ga0070680_100219155 Ga0070680_1002191551 360
104 3300005535 Ga0070684_100161573 Ga0070684_1001615731 360
105 3300005546 Ga0070696_100057360 Ga0070696_1000573602 360
106 3300005563 Ga0068855_100005031 Ga0068855_1000050313 360
107 3300005563 Ga0068855_100108375 Ga0068855_1001083752 360
108 3300005614 Ga0068856_100072705 Ga0068856_1000727054 360
109 3300005616 Ga0068852_100002758 Ga0068852_10000275810 360
110 3300005834 Ga0068851_10003287 Ga0068851_100032874 360
111 3300009093 Ga0105240_10022072 Ga0105240_100220723 360
112 3300009094 Ga0111539_10029878 Ga0111539_100298783 360
113 3300009551 Ga0105238_10064888 Ga0105238_100648882 360
114 3300010375 Ga0105239_10143032 Ga0105239_101430321 360
115 3300013104 Ga0157370_10005565 Ga0157370_1000556514 360
116 3300025913 Ga0207695_10017140 Ga0207695_100171403 360
117 3300025949 Ga0207667_10002976 Ga0207667_100029763 360
118 3300025949 Ga0207667_10134560 Ga0207667_101345603 360
119 3300026142 Ga0207698_10056379 Ga0207698_100563793 360
120 3300031250 Ga0265331_10004203 Ga0265331_100042038 360
121 3300031251 Ga0265327_10000135 Ga0265327_1000013513 360
122 3300035117 Ga0373953_0018870 Ga0373953_0018870_234_1322 360
123 3300036401 Ga0373937_0009927 Ga0373937_0009927_507_1595 360
124 3300041491 Ga0451833_0496165 Ga0451833_0496165_2588_3670 360
125 3300041492 Ga0451835_0135447 Ga0451835_0135447_1274_2356 360
126 3300041494 Ga0451837_1008086 Ga0451837_1008086_19421_20503 360
127 3300041501 Ga0451845_0258812 Ga0451845_0258812_20843_21925 360
128 3300041503 Ga0451847_0703683 Ga0451847_0703683_1532_2614 360
129 3300041507 Ga0451851_0203132 Ga0451851_0203132_1274_2356 360
130 3300041512 Ga0451853_0412421 Ga0451853_0412421_2403_3485 360
131 3300042461 Ga0439460_0014802 Ga0439460_0014802_793_1881 360
132 3300042876 Ga0451577_0086389 Ga0451577_0086389_391_1479 360
133 3300046476 Ga0495662_0010483 Ga0495662_0010483_2214_3302 360
134 3300046511 Ga0495608_0005617 Ga0495608_0005617_7153_8241 360
135 3300046516 Ga0495628_0038554 Ga0495628_0038554_2086_3174 360
136 3300046517 Ga0495630_0018367 Ga0495630_0018367_2870_3958 360
137 3300046533 Ga0495640_0012774 Ga0495640_0012774_4276_5364 360
138 3300046535 Ga0495586_0005806 Ga0495586_0005806_1227_2315 360
139 3300046559 Ga0495667_0041065 Ga0495667_0041065_106_1194 360
140 3300046642 Ga0495634_0011307 Ga0495634_0011307_4001_5089 360
141 3300046689 Ga0495613_0009248 Ga0495613_0009248_2133_3221 360
142 3300047317 Ga0495604_0030538 Ga0495604_0030538_998_2086 360
143 3300047322 Ga0495680_0007630 Ga0495680_0007630_7956_9044 360
144 3300005436 Ga0070713_100059033 Ga0070713_1000590332 361
145 3300006163 Ga0070715_10061034 Ga0070715_100610342 361
146 3300006358 Ga0068871_100002507 Ga0068871_10000250711 361
147 3300009545 Ga0105237_10002324 Ga0105237_100023243 361
148 3300013306 Ga0163162_10172262 Ga0163162_101722622 361
149 3300013308 Ga0157375_10197685 Ga0157375_101976852 361
150 3300014969 Ga0157376_10018423 Ga0157376_100184232 361
151 3300025914 Ga0207671_10013679 Ga0207671_100136795 361
152 3300030521 Ga0307511_10015499 Ga0307511_100154992 361
153 3300031733 Ga0316577_10021693 Ga0316577_100216932 361
154 3300035695 Ga0373927_0046194 Ga0373927_0046194_1624_2712 361
155 3300038742 Ga0400486_10724 Ga0400486_10724_1349_2434 361
156 3300039062 Ga0400483_095539 Ga0400483_095539_9331_10416 361
157 3300039062 Ga0400483_180499 Ga0400483_180499_13626_14711 361
158 3300042876 Ga0451577_0158510 Ga0451577_0158510_694_1839 361
159 3300044712 Ga0453684_0001932 Ga0453684_0001932_18357_19502 361
160 3300046472 Ga0495580_0004180 Ga0495580_0004180_10699_11787 361
161 3300046517 Ga0495630_0050278 Ga0495630_0050278_214_1302 361
162 3300053153 Ga0500616_0000074 Ga0500616_0000074_2808_3896 361
163 iso_pu_bacteria 2739367857 2740002582 366
164 iso_pu_bacteria 2739367858 2740007398 366
165 iso_pu_bacteria 2857618242 2857620484 366
166 iso_pu_bacteria 2929150217 2929154787 366
167 3300021384 Ga0213876_10003317 Ga0213876_100033172 367
168 3300039437 Ga0436365_1399871 Ga0436365_1399871_9530_10633 367
169 iso_pu_bacteria 2643221667 2644372796 367
170 3300006042 Ga0075368_10008530 Ga0075368_100085302 368
171 3300006177 Ga0075362_10013477 Ga0075362_100134773 368
172 3300006178 Ga0075367_10006856 Ga0075367_100068563 368
173 3300006195 Ga0075366_10009679 Ga0075366_100096793 368
174 3300006353 Ga0075370_10001286 Ga0075370_100012867 368
175 3300006353 Ga0075370_10002050 Ga0075370_100020509 368
176 3300009545 Ga0105237_10141463 Ga0105237_101414632 368
177 3300025914 Ga0207671_10095765 Ga0207671_100957652 368
178 3300025927 Ga0207687_10249019 Ga0207687_102490191 368
179 3300027866 Ga0209813_10034650 Ga0209813_100346502 368
180 3300050493 nmdc:mga0k408_1024_c1 nmdc:mga0k408_1024_c1_3875_4984 368
181 3300050493 nmdc:mga0k408_8767_c1 nmdc:mga0k408_8767_c1_3116_4225 368
182 3300050494 nmdc:mga06z11_5923_c1 nmdc:mga06z11_5923_c1_3759_4868 368
183 3300050496 nmdc:mga07m45_6582_c1 nmdc:mga07m45_6582_c1_115_1224 368
184 3300050496 nmdc:mga07m45_7612_c1 nmdc:mga07m45_7612_c1_2593_3702 368
185 3300003794 Ga0055531_10001513 Ga0055531_100015133 369
186 3300014497 Ga0182008_10001315 Ga0182008_1000131511 369
187 3300015261 Ga0182006_1011462 Ga0182006_10114623 369
188 3300025929 Ga0207664_10000023 Ga0207664_10000023144 369
189 3300003320 rootH2_10144356 rootH2_101443563 370
190 3300005293 Ga0065715_10094172 Ga0065715_100941722 370
191 3300005328 Ga0070676_10016784 Ga0070676_100167843 370
192 3300005329 Ga0070683_100000417 Ga0070683_10000041729 370
193 3300005330 Ga0070690_100016645 Ga0070690_1000166452 370
194 3300005356 Ga0070674_100044823 Ga0070674_1000448232 370
195 3300006880 Ga0075429_100173860 Ga0075429_1001738601 370
196 3300009094 Ga0111539_10070711 Ga0111539_100707113 370
197 3300025937 Ga0207669_10008638 Ga0207669_100086384 370
198 3300025939 Ga0207665_10100998 Ga0207665_101009982 370
199 3300031691 Ga0316579_10054322 Ga0316579_100543222 370
200 3300032004 Ga0307414_10008212 Ga0307414_100082127 370
201 3300032004 Ga0307414_10021991 Ga0307414_100219912 370
202 3300032004 Ga0307414_10058162 Ga0307414_100581621 370
203 3300035172 Ga0373955_0018775 Ga0373955_0018775_892_2004 370
204 3300042876 Ga0451577_0000066 Ga0451577_0000066_254962_256158 370
205 3300042876 Ga0451577_0008088 Ga0451577_0008088_4097_5278 370
206 3300042876 Ga0451577_0107199 Ga0451577_0107199_614_1795 370
207 3300044673 Ga0453683_0034511 Ga0453683_0034511_43_1224 370
208 3300044673 Ga0453683_0038538 Ga0453683_0038538_878_2059 370
209 3300044712 Ga0453684_0000051 Ga0453684_0000051_100033_101214 370
210 3300044712 Ga0453684_0000226 Ga0453684_0000226_37663_38820 370
211 3300044712 Ga0453684_0003254 Ga0453684_0003254_20622_21743 370
212 3300044712 Ga0453684_0036879 Ga0453684_0036879_3775_4893 370
213 3300044712 Ga0453684_0079478 Ga0453684_0079478_159_1340 370
214 3300045051 Ga0451576_0344779 Ga0451576_0344779_224_1339 370
215 3300049679 Ga0501249_002229 Ga0501249_002229_2547_3659 370
216 3300053088 Ga0500644_0015538 Ga0500644_0015538_936_2051 370
217 3300053090 Ga0500646_0026307 Ga0500646_0026307_182_1297 370
218 3300053096 Ga0500641_0000007 Ga0500641_0000007_146108_147223 370
219 3300053156 Ga0500622_0000303 Ga0500622_0000303_32498_33637 370
220 iso_pu_bacteria 2919191525 2919191722 370
221 iso_pu_bacteria 8054307821 8054308371 370
222 iso_pu_bacteria 8055592153 8055593705 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

7

367

0.99

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

253

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uzh-assembly1.cif.gz_A crystal structure of a gdp-mannose dehydratase from naegleria fowleri 0.9726 1 353
6gpj-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man 0.9717 1 357
6q94-assembly3.cif.gz_H-2 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9714 1 356
6gpl-assembly1.cif.gz_B crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man 0.9706 1 357
6q94-assembly1.cif.gz_B-3 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9686 1 357
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9908 2 268 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9834 2 268 3.40.50.720
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9735 1 149 3.40.50.720
af_Q4CM81_8_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.97 2 133 3.40.50.720
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9668 1 149 3.40.50.720
ID Description Score Start End GO Terms
AF-Q9Z6I3-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9989 74 257 GO:0008446
GO:0042351
AF-A0A625RB69-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9988 59 191 GO:0008446
GO:0042351
AF-A0A382CEB6-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9951 60 228 GO:0008446
GO:0042351
AF-A0A759MKU1-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9906 1 258 GO:0008446
GO:0042351
AF-A0A3A4XPU5-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9898 2 269 GO:0008446
GO:0042351

Feature Viewer

pLDDT pTM Quality
92.36 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map