F334504

General Info

Members Datasets Scaffolds Average Seq Length
222 177 207 164

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10016307|Ga0213872_100163073
Length 188
Sequence MNPTRHVGSGLLPPRRQNFPERPSQQHDVVIHGWTVFAHPLFLDQYEKLLGQVAELQAKDPEGYKKKNAAKRLAAIVSLAFDVIAQDPARPEYRQGNTLGDEHRHWLRAKFFQQYRLFFRFHAPSKVIVLAWVNDADTKRAYESDSDAYRVFRKMLASGHPPSDWELLLTEAQAQAARLRGATDSTPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
3 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
4 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
5 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
6 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
7 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
8 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
9 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
10 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
11 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
12 2919150387 Rahnella aceris 1817 Isolate Unclassified
13 2927143783 Rahnella sp. 2050 Isolate Unclassified
14 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
85 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
101 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
116 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
177 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0
Isolates 6.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.37
Nodule 1.8
Rhizoplane 2.25
Rhizosphere 54.95
Stem 0
Stem Tuber 0
Unclassified 21.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2511546 2162886007 Bacteria 2016
2 JGI25156J39149_1001197 3300002705 Bacteria 11529
3 JGI25162J39368_1000007 3300002737 Bacteria 403947
4 JGI25162J39368_1000567 3300002737 Bacteria 27104
5 JGI25157J39369_1001115 3300002741 Bacteria 11931
6 JGI25163J39215_1000746 3300002771 Bacteria 8211
7 JGI25164J39214_1000010 3300002772 Bacteria 288863
8 JGI25164J39214_1000016 3300002772 Bacteria 202035
9 JGI25164J39214_1000198 3300002772 Bacteria 51603
10 JGI25165J46597_1000354 3300003214 Bacteria 51605
11 rootL2_10353761 3300003322 Unclassified 1370
12 rootH1_10142832 3300003323 Bacteria 1138
13 rootH1_10324487 3300003323 Bacteria 2125
14 Ga0055538_1000006 3300003751 Bacteria 403947
15 Ga0055539_1000010 3300003752 Bacteria 403947
16 Ga0055533_1000013 3300003756 Bacteria 403947
17 Ga0055525_1000015 3300003759 Bacteria 403947
18 Ga0055527_1006447 3300003760 Bacteria 1469
19 Ga0055535_1000295 3300003761 Bacteria 51620
20 Ga0055542_1000180 3300003762 Bacteria 78192
21 Ga0055529_1000049 3300003763 Bacteria 208413
22 Ga0055524_1000671 3300003775 Bacteria 23984
23 Ga0055541_1000007 3300003841 Bacteria 403947
24 Ga0065704_10071245 3300005289 Bacteria 12263
25 Ga0065704_10304336 3300005289 Bacteria 879
26 Ga0070661_100594501 3300005344 Unclassified 894
27 Ga0070697_100057960 3300005536 Bacteria 3151
28 Ga0068859_100032839 3300005617 Bacteria 5214
29 Ga0068863_100008251 3300005841 Bacteria 10177
30 Ga0068860_100000545 3300005843 Bacteria 45914
31 Ga0068860_100492140 3300005843 Bacteria 1223
32 Ga0068862_100000092 3300005844 Bacteria 106896
33 Ga0097620_100032839 3300006931 Bacteria 5214
34 Ga0099823_1061649 3300006944 Bacteria 1925
35 Ga0079104_1082891 3300006946 Bacteria 658
36 Ga0099794_10004896 3300007265 Bacteria 5321
37 Ga0099794_10242695 3300007265 Bacteria 928
38 Ga0105251_10064012 3300009011 Bacteria 1725
39 Ga0105251_10093907 3300009011 Bacteria 1376
40 Ga0105251_10131547 3300009011 Bacteria 1134
41 Ga0105244_10006688 3300009036 Bacteria 7421
42 Ga0105244_10050483 3300009036 Bacteria 2121
43 Ga0105250_10055415 3300009092 Bacteria 1591
44 Ga0105247_10008202 3300009101 Bacteria 6374
45 Ga0105243_10340110 3300009148 Bacteria 1374
46 Ga0105248_10551323 3300009177 Bacteria 1300
47 Ga0105238_10336846 3300009551 Unclassified 1496
48 Ga0105249_10000100 3300009553 Bacteria 119358
49 Ga0105239_10639950 3300010375 Unclassified 1214
50 Ga0157371_10000044 3300013102 Bacteria 194689
51 Ga0157380_11857644 3300014326 Unclassified 662
52 Ga0182008_10000231 3300014497 Bacteria 43471
53 Ga0182006_1000004 3300015261 Bacteria 622190
54 Ga0182007_10000018 3300015262 Bacteria 198916
55 Ga0213872_10016307 3300021361 Bacteria 3449
56 Ga0209760_100484 3300025207 Bacteria 8480
57 Ga0209784_100022 3300025224 Bacteria 403999
58 Ga0209566_100021 3300025225 Bacteria 403999
59 Ga0209674_100038 3300025226 Bacteria 403999
60 Ga0209672_100239 3300025228 Bacteria 41496
61 Ga0209563_100042 3300025230 Bacteria 403999
62 Ga0207427_100027 3300025231 Bacteria 403999
63 Ga0207427_100213 3300025231 Bacteria 51669
64 Ga0209437_100049 3300025233 Bacteria 403999
65 Ga0209437_100381 3300025233 Bacteria 43879
66 Ga0209258_100118 3300025242 Bacteria 183558
67 Ga0209646_1001043 3300025246 Bacteria 8360
68 Ga0209026_1000785 3300025250 Bacteria 17557
69 Ga0209677_100025 3300025253 Bacteria 403999
70 Ga0209148_1000024 3300025254 Bacteria 669890
71 Ga0209759_1000779 3300025256 Bacteria 26706
72 Ga0209233_1000323 3300025261 Bacteria 51669
73 Ga0209233_1002834 3300025261 Bacteria 6221
74 Ga0209455_1000025 3300025272 Bacteria 670673
75 Ga0209256_1001155 3300025299 Bacteria 29900
76 Ga0207696_1039346 3300025711 Bacteria 1391
77 Ga0207655_1000124 3300025728 Bacteria 153097
78 Ga0207655_1127579 3300025728 Bacteria 833
79 Ga0207713_1038245 3300025735 Bacteria 2037
80 Ga0207713_1066110 3300025735 Bacteria 1355
81 Ga0207713_1167278 3300025735 Bacteria 696
82 Ga0207713_1239799 3300025735 Bacteria 538
83 Ga0207686_10288642 3300025934 Bacteria 1214
84 Ga0207709_10236318 3300025935 Bacteria 1327
85 Ga0207711_10405294 3300025941 Bacteria 1267
86 Ga0207712_10000008 3300025961 Bacteria 527957
87 Ga0207641_10003152 3300026088 Bacteria 14783
88 Ga0209389_1092938 3300027296 Bacteria 1229
89 Ga0209282_1000080 3300027666 Bacteria 73508
90 Ga0209588_1047109 3300027671 Bacteria 1394
91 Ga0268265_10000091 3300028380 Bacteria 115237
92 Ga0268264_10000425 3300028381 Bacteria 58711
93 Ga0268264_10000871 3300028381 Bacteria 31966
94 Ga0307515_10221576 3300028794 Bacteria 1708
95 Ga0307512_10286664 3300030522 Bacteria 781
96 Ga0307509_10002634 3300031507 Bacteria 28706
97 Ga0307509_10120320 3300031507 Bacteria 2605
98 Ga0307408_100015375 3300031548 Bacteria 5093
99 Ga0307414_10160345 3300032004 Bacteria 1786
100 Ga0395899_0088844 3300037312 Bacteria 2242
101 Ga0395900_0110245 3300037418 Bacteria 2827
102 Ga0395898_0237003 3300037466 Bacteria 1740
103 Ga0395905_0021640 3300037471 Bacteria 6082
104 Ga0395905_0054988 3300037471 Bacteria 3725
105 Ga0395905_0469633 3300037471 Bacteria 1157
106 Ga0436364_0855635 3300037853 Bacteria 1952
107 Ga0395901_0079599 3300038443 Bacteria 3422
108 Ga0400484_10294 3300038725 Bacteria 1699
109 Ga0400484_26991 3300038725 Unclassified 3679
110 Ga0400491_06130 3300038727 Bacteria 1390
111 Ga0400483_224509 3300039062 Bacteria 1510
112 Ga0400483_263096 3300039062 Bacteria 5854
113 Ga0436361_0268202 3300039447 Bacteria 49775
114 Ga0436363_1126895 3300039450 Bacteria 1877
115 Ga0439436_0009144 3300041404 Bacteria 3039
116 Ga0439438_005772 3300041405 Bacteria 4494
117 Ga0439447_000819 3300041407 Bacteria 11401
118 Ga0439466_0002143 3300041411 Bacteria 7734
119 Ga0451804_0124169 3300041463 Bacteria 1101
120 Ga0439431_0008673 3300041997 Bacteria 2288
121 Ga0439448_0013110 3300042005 Bacteria 2488
122 Ga0439432_002203 3300042006 Bacteria 7363
123 Ga0439449_0289146 3300042007 Bacteria 618
124 Ga0439452_003937 3300042010 Bacteria 5088
125 Ga0450919_029397 3300042121 Bacteria 628
126 Ga0450904_000249 3300042139 Bacteria 11733
127 Ga0439446_0007622 3300042156 Bacteria 2851
128 Ga0439434_0001464 3300042435 Bacteria 6786
129 Ga0450893_0006431 3300042532 Bacteria 1899
130 Ga0451577_0197741 3300042876 Bacteria 1815
131 Ga0453683_0069881 3300044673 Bacteria 2196
132 Ga0453684_0055498 3300044712 Bacteria 5150
133 Ga0453684_0203555 3300044712 Bacteria 2306
134 Ga0451576_0330499 3300045051 Bacteria 1595
135 Ga0495590_0276433 3300046457 Bacteria 628
136 Ga0495650_0000039 3300046471 Bacteria 375501
137 Ga0495605_0001399 3300046474 Bacteria 15873
138 Ga0495584_0040537 3300046491 Bacteria 2352
139 Ga0495596_0001492 3300046500 Bacteria 13378
140 Ga0495607_0013627 3300046501 Bacteria 5322
141 Ga0495607_0017843 3300046501 Bacteria 4542
142 Ga0495607_0049765 3300046501 Bacteria 2442
143 Ga0495606_0091286 3300046507 Bacteria 1873
144 Ga0495610_0002608 3300046512 Bacteria 14929
145 Ga0495616_0025938 3300046513 Bacteria 3125
146 Ga0495643_0000344 3300046522 Bacteria 63135
147 Ga0495648_0004418 3300046524 Bacteria 12013
148 Ga0495648_0012592 3300046524 Bacteria 6299
149 Ga0495642_0111494 3300046528 Bacteria 1170
150 Ga0495609_0008159 3300046538 Bacteria 5145
151 Ga0495597_0198967 3300046542 Bacteria 803
152 Ga0495656_0034354 3300046615 Bacteria 2076
153 Ga0495611_0152107 3300046648 Bacteria 1080
154 Ga0495625_0025574 3300046660 Bacteria 4475
155 Ga0495659_0114938 3300046664 Bacteria 1054
156 Ga0495661_0042323 3300046665 Bacteria 2808
157 Ga0495661_0145937 3300046665 Bacteria 1282
158 Ga0495671_0003579 3300046692 Bacteria 9489
159 Ga0495671_0037138 3300046692 Bacteria 2465
160 Ga0495649_0167045 3300046694 Bacteria 1152
161 Ga0495660_0000023 3300046810 Bacteria 272605
162 Ga0495636_0102103 3300047318 Bacteria 1255
163 Ga0495672_0003776 3300047320 Bacteria 12762
164 Ga0495672_0005039 3300047320 Bacteria 10563
165 Ga0495672_0032170 3300047320 Bacteria 3267
166 Ga0495677_0028962 3300047445 Bacteria 2013
167 Ga0495626_0009905 3300048091 Bacteria 5121
168 Ga0496102_1376111 3300048905 Bacteria 625
169 Ga0496104_0000208 3300048907 Bacteria 52252
170 Ga0496114_0005748 3300048917 Bacteria 9734
171 Ga0496116_0000112 3300048919 Bacteria 181946
172 Ga0496116_0053206 3300048919 Bacteria 2675
173 Ga0496116_0077248 3300048919 Bacteria 2082
174 Ga0496116_0190821 3300048919 Bacteria 1085
175 Ga0496117_0000011 3300048920 Bacteria 610930
176 Ga0496117_0008287 3300048920 Bacteria 9892
177 Ga0496118_0000010 3300048921 Bacteria 610930
178 Ga0496118_0141480 3300048921 Bacteria 1524
179 Ga0496119_0211836 3300048922 Bacteria 996
180 Ga0496120_0382253 3300048923 Bacteria 626
181 Ga0496121_0022713 3300048924 Bacteria 6071
182 Ga0496121_0032347 3300048924 Bacteria 4756
183 Ga0496121_0268634 3300048924 Bacteria 1173
184 Ga0496122_0001986 3300048925 Bacteria 30522
185 Ga0496122_0204572 3300048925 Bacteria 1150
186 Ga0496123_0004976 3300048926 Bacteria 13616
187 Ga0496123_0172845 3300048926 Bacteria 1137
188 Ga0496123_0326388 3300048926 Bacteria 722
189 Ga0496124_0000362 3300048927 Bacteria 82902
190 Ga0496124_0009073 3300048927 Bacteria 10289
191 Ga0496124_0375532 3300048927 Bacteria 996
192 Ga0496125_0000183 3300048928 Bacteria 137652
193 Ga0496125_0101902 3300048928 Bacteria 2111
194 Ga0496126_0352535 3300048929 Bacteria 1203
195 Ga0496126_0507013 3300048929 Bacteria 963
196 Ga0501034_0000501 3300049571 Bacteria 63366
197 Ga0501035_0269332 3300049822 Bacteria 1442
198 Ga0501044_0070806 3300049823 Bacteria 3547
199 Ga0500610_0277506 3300053079 Bacteria 754
200 Ga0500644_0022432 3300053088 Bacteria 1904
201 Ga0500583_0131864 3300053092 Unclassified 1240
202 Ga0500651_0008746 3300053093 Bacteria 5982
203 Ga0500641_0005318 3300053096 Bacteria 4555
204 Ga0500618_022249 3300053125 Bacteria 1541
205 Ga0500568_0017706 3300053139 Bacteria 3139
206 Ga0500588_0001058 3300053146 Bacteria 4996
207 Ga0500616_0000130 3300053153 Bacteria 132948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053079 Ga0500610_0277506 Ga0500610_0277506_252_710 150
2 3300053092 Ga0500583_0131864 Ga0500583_0131864_765_1223 150
3 3300053146 Ga0500588_0001058 Ga0500588_0001058_706_1164 150
4 iso_pu_bacteria 2881412998 2881415950 151
5 3300015262 Ga0182007_10000018 Ga0182007_100000188 153
6 iso_pu_bacteria 2887375801 2887379198 153
7 iso_pu_bacteria 2904479285 2904479737 153
8 3300005289 Ga0065704_10304336 Ga0065704_103043362 154
9 3300006944 Ga0099823_1061649 Ga0099823_10616492 154
10 3300009011 Ga0105251_10093907 Ga0105251_100939073 154
11 3300009092 Ga0105250_10055415 Ga0105250_100554152 154
12 3300009551 Ga0105238_10336846 Ga0105238_103368462 154
13 3300010375 Ga0105239_10639950 Ga0105239_106399502 154
14 3300025711 Ga0207696_1039346 Ga0207696_10393462 154
15 3300025735 Ga0207713_1239799 Ga0207713_12397991 154
16 3300027296 Ga0209389_1092938 Ga0209389_10929382 154
17 3300046522 Ga0495643_0000344 Ga0495643_0000344_54066_54533 154
18 3300049571 Ga0501034_0000501 Ga0501034_0000501_55619_56086 154
19 iso_pu_bacteria 2667528173 2671109213 154
20 iso_pu_bacteria 2904474040 2904477508 154
21 iso_pu_bacteria 2919150387 2919153783 154
22 iso_pu_bacteria 2927143783 2927147201 154
23 3300009036 Ga0105244_10050483 Ga0105244_100504834 155
24 3300025728 Ga0207655_1127579 Ga0207655_11275792 155
25 3300048926 Ga0496123_0326388 Ga0496123_0326388_201_671 155
26 3300048929 Ga0496126_0352535 Ga0496126_0352535_177_650 155
27 iso_pu_bacteria 2585427591 2585826551 155
28 iso_pu_bacteria 2585427592 2585832654 155
29 iso_pu_bacteria 3007803356 3007806133 155
30 3300048917 Ga0496114_0005748 Ga0496114_0005748_8377_8850 156
31 3300002737 JGI25162J39368_1000007 JGI25162J39368_1000007133 157
32 3300002771 JGI25163J39215_1000746 JGI25163J39215_100074610 157
33 3300002772 JGI25164J39214_1000010 JGI25164J39214_1000010243 157
34 3300002772 JGI25164J39214_1000016 JGI25164J39214_100001657 157
35 3300003322 rootL2_10353761 rootL2_103537612 157
36 3300003323 rootH1_10324487 rootH1_103244874 157
37 3300003751 Ga0055538_1000006 Ga0055538_1000006133 157
38 3300003752 Ga0055539_1000010 Ga0055539_1000010133 157
39 3300003756 Ga0055533_1000013 Ga0055533_1000013133 157
40 3300003759 Ga0055525_1000015 Ga0055525_1000015133 157
41 3300003841 Ga0055541_1000007 Ga0055541_1000007242 157
42 3300005617 Ga0068859_100032839 Ga0068859_1000328396 157
43 3300005841 Ga0068863_100008251 Ga0068863_1000082517 157
44 3300005843 Ga0068860_100492140 Ga0068860_1004921403 157
45 3300005844 Ga0068862_100000092 Ga0068862_10000009229 157
46 3300006931 Ga0097620_100032839 Ga0097620_1000328396 157
47 3300006946 Ga0079104_1082891 Ga0079104_10828911 157
48 3300009011 Ga0105251_10064012 Ga0105251_100640124 157
49 3300009036 Ga0105244_10006688 Ga0105244_100066887 157
50 3300009101 Ga0105247_10008202 Ga0105247_100082025 157
51 3300009553 Ga0105249_10000100 Ga0105249_1000010028 157
52 3300014326 Ga0157380_11857644 Ga0157380_118576442 157
53 3300025207 Ga0209760_100484 Ga0209760_10048410 157
54 3300025224 Ga0209784_100022 Ga0209784_100022239 157
55 3300025225 Ga0209566_100021 Ga0209566_100021239 157
56 3300025226 Ga0209674_100038 Ga0209674_100038239 157
57 3300025230 Ga0209563_100042 Ga0209563_100042239 157
58 3300025231 Ga0207427_100027 Ga0207427_100027239 157
59 3300025233 Ga0209437_100049 Ga0209437_100049239 157
60 3300025253 Ga0209677_100025 Ga0209677_100025239 157
61 3300025261 Ga0209233_1002834 Ga0209233_10028344 157
62 3300025728 Ga0207655_1000124 Ga0207655_10001245 157
63 3300025735 Ga0207713_1167278 Ga0207713_11672782 157
64 3300025961 Ga0207712_10000008 Ga0207712_10000008104 157
65 3300026088 Ga0207641_10003152 Ga0207641_100031528 157
66 3300028380 Ga0268265_10000091 Ga0268265_1000009178 157
67 3300028381 Ga0268264_10000425 Ga0268264_1000042569 157
68 3300039450 Ga0436363_1126895 Ga0436363_1126895_568_1050 157
69 3300042532 Ga0450893_0006431 Ga0450893_0006431_1191_1667 157
70 3300045051 Ga0451576_0330499 Ga0451576_0330499_677_1189 157
71 3300048907 Ga0496104_0000208 Ga0496104_0000208_41014_41490 157
72 3300048919 Ga0496116_0000112 Ga0496116_0000112_117114_117590 157
73 3300048920 Ga0496117_0008287 Ga0496117_0008287_2530_3006 157
74 3300048928 Ga0496125_0000183 Ga0496125_0000183_74613_75089 157
75 3300003775 Ga0055524_1000671 Ga0055524_100067117 158
76 3300009177 Ga0105248_10551323 Ga0105248_105513232 158
77 3300013102 Ga0157371_10000044 Ga0157371_1000004482 158
78 3300025299 Ga0209256_1001155 Ga0209256_100115515 158
79 3300025941 Ga0207711_10405294 Ga0207711_104052942 158
80 3300037471 Ga0395905_0469633 Ga0395905_0469633_365_862 158
81 3300042876 Ga0451577_0197741 Ga0451577_0197741_500_979 158
82 3300044712 Ga0453684_0055498 Ga0453684_0055498_2442_2921 158
83 3300046471 Ga0495650_0000039 Ga0495650_0000039_277370_277849 158
84 3300046810 Ga0495660_0000023 Ga0495660_0000023_130526_131005 158
85 3300048921 Ga0496118_0141480 Ga0496118_0141480_176_655 158
86 3300048927 Ga0496124_0000362 Ga0496124_0000362_51974_52453 158
87 3300025735 Ga0207713_1038245 Ga0207713_10382452 159
88 3300046501 Ga0495607_0049765 Ga0495607_0049765_1518_2006 159
89 3300005344 Ga0070661_100594501 Ga0070661_1005945012 160
90 3300042007 Ga0439449_0289146 Ga0439449_0289146_83_577 160
91 iso_pu_bacteria 2721755763 2723878902 160
92 iso_pu_bacteria 640427133 640489401 160
93 iso_pu_bacteria 8056120720 8056121691 160
94 3300037853 Ga0436364_0855635 Ga0436364_0855635_684_1181 161
95 3300003323 rootH1_10142832 rootH1_101428322 162
96 3300005536 Ga0070697_100057960 Ga0070697_1000579603 162
97 3300007265 Ga0099794_10004896 Ga0099794_100048967 162
98 3300027671 Ga0209588_1047109 Ga0209588_10471093 162
99 3300032004 Ga0307414_10160345 Ga0307414_101603452 162
100 3300037471 Ga0395905_0021640 Ga0395905_0021640_4914_5423 162
101 3300037471 Ga0395905_0054988 Ga0395905_0054988_457_966 162
102 3300038725 Ga0400484_10294 Ga0400484_10294_982_1482 162
103 3300038725 Ga0400484_26991 Ga0400484_26991_2974_3477 162
104 3300038727 Ga0400491_06130 Ga0400491_06130_22_525 162
105 3300039062 Ga0400483_224509 Ga0400483_224509_207_707 162
106 3300039062 Ga0400483_263096 Ga0400483_263096_461_964 162
107 3300041463 Ga0451804_0124169 Ga0451804_0124169_185_685 162
108 3300046524 Ga0495648_0004418 Ga0495648_0004418_9655_10158 162
109 3300046665 Ga0495661_0145937 Ga0495661_0145937_110_610 162
110 3300048922 Ga0496119_0211836 Ga0496119_0211836_51_542 162
111 3300048923 Ga0496120_0382253 Ga0496120_0382253_108_599 162
112 3300048924 Ga0496121_0268634 Ga0496121_0268634_551_1042 162
113 3300048925 Ga0496122_0204572 Ga0496122_0204572_123_614 162
114 3300048926 Ga0496123_0172845 Ga0496123_0172845_125_616 162
115 3300048927 Ga0496124_0375532 Ga0496124_0375532_393_890 162
116 3300053096 Ga0500641_0005318 Ga0500641_0005318_2050_2556 162
117 2162886007 SwRhRL2b_contig_2511546 SwRhRL2b_0947.00000440 164
118 3300002705 JGI25156J39149_1001197 JGI25156J39149_10011978 164
119 3300002737 JGI25162J39368_1000567 JGI25162J39368_100056710 164
120 3300002741 JGI25157J39369_1001115 JGI25157J39369_10011158 164
121 3300002772 JGI25164J39214_1000198 JGI25164J39214_100019828 164
122 3300003214 JGI25165J46597_1000354 JGI25165J46597_100035428 164
123 3300003760 Ga0055527_1006447 Ga0055527_10064472 164
124 3300003761 Ga0055535_1000295 Ga0055535_100029525 164
125 3300003762 Ga0055542_1000180 Ga0055542_100018010 164
126 3300003763 Ga0055529_1000049 Ga0055529_100004954 164
127 3300005289 Ga0065704_10071245 Ga0065704_100712452 164
128 3300005843 Ga0068860_100000545 Ga0068860_10000054518 164
129 3300007265 Ga0099794_10242695 Ga0099794_102426951 164
130 3300009011 Ga0105251_10131547 Ga0105251_101315472 164
131 3300009148 Ga0105243_10340110 Ga0105243_103401103 164
132 3300014497 Ga0182008_10000231 Ga0182008_1000023132 164
133 3300015261 Ga0182006_1000004 Ga0182006_1000004363 164
134 3300021361 Ga0213872_10016307 Ga0213872_100163073 164
135 3300025228 Ga0209672_100239 Ga0209672_1002393 164
136 3300025231 Ga0207427_100213 Ga0207427_10021322 164
137 3300025233 Ga0209437_100381 Ga0209437_10038127 164
138 3300025242 Ga0209258_100118 Ga0209258_10011834 164
139 3300025246 Ga0209646_1001043 Ga0209646_10010439 164
140 3300025250 Ga0209026_1000785 Ga0209026_10007858 164
141 3300025254 Ga0209148_1000024 Ga0209148_1000024319 164
142 3300025256 Ga0209759_1000779 Ga0209759_100077915 164
143 3300025261 Ga0209233_1000323 Ga0209233_100032322 164
144 3300025272 Ga0209455_1000025 Ga0209455_1000025319 164
145 3300025735 Ga0207713_1066110 Ga0207713_10661103 164
146 3300025934 Ga0207686_10288642 Ga0207686_102886422 164
147 3300025935 Ga0207709_10236318 Ga0207709_102363182 164
148 3300027666 Ga0209282_1000080 Ga0209282_100008043 164
149 3300028381 Ga0268264_10000871 Ga0268264_1000087117 164
150 3300028794 Ga0307515_10221576 Ga0307515_102215762 164
151 3300030522 Ga0307512_10286664 Ga0307512_102866642 164
152 3300031507 Ga0307509_10002634 Ga0307509_1000263411 164
153 3300031507 Ga0307509_10120320 Ga0307509_101203202 164
154 3300031548 Ga0307408_100015375 Ga0307408_1000153753 164
155 3300037312 Ga0395899_0088844 Ga0395899_0088844_260_766 164
156 3300037418 Ga0395900_0110245 Ga0395900_0110245_1888_2394 164
157 3300037466 Ga0395898_0237003 Ga0395898_0237003_962_1468 164
158 3300038443 Ga0395901_0079599 Ga0395901_0079599_2455_2961 164
159 3300039447 Ga0436361_0268202 Ga0436361_0268202_20037_20603 164
160 3300041404 Ga0439436_0009144 Ga0439436_0009144_1309_1812 164
161 3300041405 Ga0439438_005772 Ga0439438_005772_1532_2035 164
162 3300041407 Ga0439447_000819 Ga0439447_000819_2151_2654 164
163 3300041411 Ga0439466_0002143 Ga0439466_0002143_4668_5171 164
164 3300041997 Ga0439431_0008673 Ga0439431_0008673_1670_2173 164
165 3300042005 Ga0439448_0013110 Ga0439448_0013110_195_707 164
166 3300042006 Ga0439432_002203 Ga0439432_002203_768_1271 164
167 3300042010 Ga0439452_003937 Ga0439452_003937_2797_3300 164
168 3300042121 Ga0450919_029397 Ga0450919_029397_19_522 164
169 3300042139 Ga0450904_000249 Ga0450904_000249_2991_3500 164
170 3300042156 Ga0439446_0007622 Ga0439446_0007622_726_1229 164
171 3300042435 Ga0439434_0001464 Ga0439434_0001464_4225_4728 164
172 3300044673 Ga0453683_0069881 Ga0453683_0069881_1453_1959 164
173 3300044712 Ga0453684_0203555 Ga0453684_0203555_275_790 164
174 3300046457 Ga0495590_0276433 Ga0495590_0276433_27_545 164
175 3300046474 Ga0495605_0001399 Ga0495605_0001399_8898_9416 164
176 3300046491 Ga0495584_0040537 Ga0495584_0040537_1437_1955 164
177 3300046500 Ga0495596_0001492 Ga0495596_0001492_10811_11329 164
178 3300046501 Ga0495607_0013627 Ga0495607_0013627_988_1506 164
179 3300046501 Ga0495607_0017843 Ga0495607_0017843_846_1352 164
180 3300046507 Ga0495606_0091286 Ga0495606_0091286_1146_1664 164
181 3300046512 Ga0495610_0002608 Ga0495610_0002608_12392_12910 164
182 3300046513 Ga0495616_0025938 Ga0495616_0025938_1654_2172 164
183 3300046524 Ga0495648_0012592 Ga0495648_0012592_1048_1566 164
184 3300046528 Ga0495642_0111494 Ga0495642_0111494_644_1153 164
185 3300046538 Ga0495609_0008159 Ga0495609_0008159_3565_4083 164
186 3300046542 Ga0495597_0198967 Ga0495597_0198967_148_666 164
187 3300046615 Ga0495656_0034354 Ga0495656_0034354_760_1278 164
188 3300046648 Ga0495611_0152107 Ga0495611_0152107_198_716 164
189 3300046660 Ga0495625_0025574 Ga0495625_0025574_2580_3086 164
190 3300046664 Ga0495659_0114938 Ga0495659_0114938_152_658 164
191 3300046665 Ga0495661_0042323 Ga0495661_0042323_1297_1815 164
192 3300046692 Ga0495671_0003579 Ga0495671_0003579_8935_9453 164
193 3300046692 Ga0495671_0037138 Ga0495671_0037138_1009_1515 164
194 3300046694 Ga0495649_0167045 Ga0495649_0167045_510_1028 164
195 3300047318 Ga0495636_0102103 Ga0495636_0102103_690_1196 164
196 3300047320 Ga0495672_0003776 Ga0495672_0003776_9045_9557 164
197 3300047320 Ga0495672_0005039 Ga0495672_0005039_4953_5459 164
198 3300047320 Ga0495672_0032170 Ga0495672_0032170_1712_2230 164
199 3300047445 Ga0495677_0028962 Ga0495677_0028962_383_889 164
200 3300048091 Ga0495626_0009905 Ga0495626_0009905_3280_3792 164
201 3300048905 Ga0496102_1376111 Ga0496102_1376111_73_579 164
202 3300048919 Ga0496116_0053206 Ga0496116_0053206_2072_2590 164
203 3300048919 Ga0496116_0077248 Ga0496116_0077248_1470_1976 164
204 3300048919 Ga0496116_0190821 Ga0496116_0190821_477_995 164
205 3300048920 Ga0496117_0000011 Ga0496117_0000011_401816_402322 164
206 3300048921 Ga0496118_0000010 Ga0496118_0000010_208609_209115 164
207 3300048924 Ga0496121_0022713 Ga0496121_0022713_5227_5733 164
208 3300048924 Ga0496121_0032347 Ga0496121_0032347_918_1436 164
209 3300048925 Ga0496122_0001986 Ga0496122_0001986_19398_19916 164
210 3300048926 Ga0496123_0004976 Ga0496123_0004976_10555_11073 164
211 3300048927 Ga0496124_0009073 Ga0496124_0009073_8334_8831 164
212 3300048928 Ga0496125_0101902 Ga0496125_0101902_1412_1930 164
213 3300048929 Ga0496126_0507013 Ga0496126_0507013_60_578 164
214 3300049822 Ga0501035_0269332 Ga0501035_0269332_96_608 164
215 3300049823 Ga0501044_0070806 Ga0501044_0070806_793_1305 164
216 3300053088 Ga0500644_0022432 Ga0500644_0022432_180_695 164
217 3300053093 Ga0500651_0008746 Ga0500651_0008746_4573_5079 164
218 3300053125 Ga0500618_022249 Ga0500618_022249_869_1384 164
219 3300053139 Ga0500568_0017706 Ga0500568_0017706_2518_3030 164
220 3300053153 Ga0500616_0000130 Ga0500616_0000130_80002_80514 164
221 iso_pu_bacteria 2856287931 2856290836 164
222 iso_pu_bacteria 2857357740 2857360204 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11663

Toxin_YhaV

Toxin with endonuclease activity, of toxin-antitoxin system

36

173

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g5o-assembly1.cif.gz_B the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.7688 13 115
3g5o-assembly1.cif.gz_B the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.7433 13 115
6x2m-assembly1.cif.gz_C crystal structure of unliganded crm1-ran-ranbp1 0.7306 22 57
3kvp-assembly1.cif.gz_B crystal structure of uncharacterized protein ymzc precursor from bacillus subtilis, northeast structural genomics consortium target sr378a 0.728 81 115
6bn9-assembly1.cif.gz_A crystal structure of ddb1-crbn-brd4(bd1) complex bound to dbet70 protac 0.7232 84 113
ID Description Score Start End Superfamily
af_P64594_12_151_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9259 16 151 3.30.2310.20
af_P64594_12_151_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8943 16 151 3.30.2310.20
3g5oB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.7688 13 115 3.30.2310.20
af_Q58573_1_88_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.7672 13 123 3.30.2310.20
af_Q54QH0_2_338_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7648 84 115 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A0V8A0S9-F1-model_v4 Toxin 0.999 7 163 GO:0004540
GO:0110001
AF-D6SMK2-F1-model_v4 Toxin YhaV 0.9953 8 151 GO:0004540
GO:0110001
AF-F2G806-F1-model_v4 Toxin 0.9935 8 153 GO:0004540
GO:0110001
AF-A0A5S4UW53-F1-model_v4 Type II toxin-antitoxin system YhaV family toxin 0.9935 8 150 GO:0004540
GO:0110001
AF-A0A2G2BTN0-F1-model_v4 deleted 0.9925 6 163

Feature Viewer

pLDDT pTM Quality
88.45 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map