F334073

General Info

Members Datasets Scaffolds Average Seq Length
222 140 444 417

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10115624|Ga0065715_101156243
Length 442
Sequence MTPEMKGFVLLSVIKLLFVFTVVMVGVALLTLMERKVSAWMQNRLGPNRVGPGGLLQPAADGLKNILKEETFPAEANPVLFTVAPALAFIPALMLSAVIPFAAPLPINSDDFGRDLGGFFARAIPVVGSAVGSVVTGAFHAIFGVMAHHGPMPMVVADVPVGFLFVLAIGSLGVYGIALAGWASNSKYSLLGGLRASAQLVSYEVALGLSLIPVLLLTGDVSFSRIVAFQQAGLWFVLPLFLSFFVFLVSGFAETNRLPFDLPEAESELIAGYHTEYSAMKFSFFFIAEYANVVTISAMLTTLFFGGWDIPFTTWDQHGGVLQTLATGVFFFAKLMFWIFFVMWIRWTLPRFRYDQLMALGWKFFMPVTLVYIMVVCVVLYASDRAGVHGVLPTHLVLTGLSVILAIALFLVLDRGHLLSGSAGRRARAAAARQAQRLAASS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.11
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10115624 3300005293 Bacteria 2409
2 Ga0065715_10095370 3300005293 Bacteria 4100
3 Ga0070658_10044511 3300005327 Bacteria 3587
4 Ga0070658_10096879 3300005327 Bacteria 2436
5 Ga0070683_100063663 3300005329 Bacteria 3431
6 Ga0070680_100006769 3300005336 Bacteria 8733
7 Ga0070660_100059348 3300005339 Bacteria 2966
8 Ga0070660_100065588 3300005339 Bacteria 2826
9 Ga0070660_100090737 3300005339 Bacteria 2409
10 Ga0070691_10056675 3300005341 Bacteria 1879
11 Ga0070668_100125777 3300005347 Bacteria 2053
12 Ga0070714_100015478 3300005435 Bacteria 6136
13 Ga0070711_100005417 3300005439 Bacteria 7630
14 Ga0070711_100056731 3300005439 Bacteria 2710
15 Ga0070705_100012045 3300005440 Bacteria 4382
16 Ga0070705_100016019 3300005440 Bacteria 3886
17 Ga0070708_100003233 3300005445 Bacteria 12711
18 Ga0070708_100157403 3300005445 Bacteria 2116
19 Ga0070663_100002625 3300005455 Bacteria 10164
20 Ga0070662_100209404 3300005457 Bacteria 1551
21 Ga0070681_10028388 3300005458 Bacteria 5625
22 Ga0070706_100007941 3300005467 Bacteria 9908
23 Ga0070706_100129383 3300005467 Bacteria 2356
24 Ga0070707_100172445 3300005468 Bacteria 2108
25 Ga0070707_100237089 3300005468 Bacteria 1776
26 Ga0070698_100096887 3300005471 Bacteria 2926
27 Ga0070698_100104949 3300005471 Bacteria 2796
28 Ga0070699_100000224 3300005518 Bacteria 56041
29 Ga0070699_100005020 3300005518 Bacteria 11653
30 Ga0070699_100021845 3300005518 Bacteria 5516
31 Ga0070679_100216102 3300005530 Bacteria 1879
32 Ga0070697_100075818 3300005536 Bacteria 2765
33 Ga0070695_100045386 3300005545 Bacteria 2801
34 Ga0070696_100001799 3300005546 Bacteria 14064
35 Ga0070696_100034017 3300005546 Bacteria 3505
36 Ga0070704_100002973 3300005549 Bacteria 9635
37 Ga0070704_100003943 3300005549 Bacteria 8542
38 Ga0068854_100147804 3300005578 Bacteria 1809
39 Ga0068852_100010293 3300005616 Bacteria 6980
40 Ga0068852_100181410 3300005616 Bacteria 1980
41 Ga0068859_100178946 3300005617 Bacteria 2203
42 Ga0068862_100222448 3300005844 Bacteria 1709
43 Ga0081455_10036305 3300005937 Bacteria 4390
44 Ga0081538_10034194 3300005981 Bacteria 3365
45 Ga0075428_100103164 3300006844 Bacteria 3111
46 Ga0075430_100008807 3300006846 Bacteria 8517
47 Ga0075431_100106698 3300006847 Bacteria 2890
48 Ga0075433_10067112 3300006852 Bacteria 3148
49 Ga0075433_10110517 3300006852 Bacteria 2439
50 Ga0075433_10221496 3300006852 Bacteria 1680
51 Ga0075429_100119107 3300006880 Bacteria 2307
52 Ga0075429_100134233 3300006880 Bacteria 2165
53 Ga0097620_100178959 3300006931 Bacteria 2203
54 Ga0105240_10068790 3300009093 Bacteria 4385
55 Ga0105240_10281549 3300009093 Bacteria 1910
56 Ga0114129_10000112 3300009147 Bacteria 80956
57 Ga0114129_10109513 3300009147 Bacteria 3813
58 Ga0114129_10305012 3300009147 Bacteria 2121
59 Ga0105241_10000025 3300009174 Bacteria 132929
60 Ga0105248_10148328 3300009177 Bacteria 2646
61 Ga0105249_10018617 3300009553 Bacteria 6184
62 Ga0105239_10003966 3300010375 Bacteria 17933
63 Ga0105239_10165607 3300010375 Bacteria 2471
64 Ga0105239_10321110 3300010375 Bacteria 1746
65 Ga0105239_10419232 3300010375 Bacteria 1516
66 Ga0157371_10095789 3300013102 Bacteria 2103
67 Ga0157370_10038484 3300013104 Bacteria 4626
68 Ga0157370_10328119 3300013104 Bacteria 1411
69 Ga0157369_10019853 3300013105 Bacteria 7519
70 Ga0163162_10048371 3300013306 Bacteria 4260
71 Ga0163163_10100730 3300014325 Bacteria 2911
72 Ga0213876_10031398 3300021384 Bacteria 2803
73 Ga0207688_10047937 3300025901 Bacteria 2386
74 Ga0207699_10131951 3300025906 Bacteria 1631
75 Ga0207705_10004637 3300025909 Bacteria 10371
76 Ga0207654_10000187 3300025911 Bacteria 38292
77 Ga0207707_10004621 3300025912 Bacteria 12097
78 Ga0207695_10208214 3300025913 Bacteria 1868
79 Ga0207663_10076432 3300025916 Bacteria 2176
80 Ga0207657_10007210 3300025919 Bacteria 11415
81 Ga0207657_10037892 3300025919 Bacteria 4299
82 Ga0207652_10027601 3300025921 Bacteria 4731
83 Ga0207652_10104482 3300025921 Bacteria 2506
84 Ga0207646_10069294 3300025922 Bacteria 3150
85 Ga0207646_10155758 3300025922 Bacteria 2061
86 Ga0207646_10229777 3300025922 Bacteria 1676
87 Ga0207664_10022238 3300025929 Bacteria 4732
88 Ga0207667_10173197 3300025949 Bacteria 2218
89 Ga0207712_10092481 3300025961 Bacteria 2230
90 Ga0207640_10095061 3300025981 Bacteria 2074
91 Ga0207640_10229327 3300025981 Bacteria 1427
92 Ga0207678_10000466 3300026067 Bacteria 36698
93 Ga0207676_10014848 3300026095 Bacteria 5611
94 Ga0207676_10032844 3300026095 Bacteria 3916
95 Ga0209974_10024496 3300027876 Bacteria 1997
96 Ga0316576_10000863 3300031727 Bacteria 15358
97 Ga0316576_10036444 3300031727 Bacteria 3517
98 Ga0316576_10107316 3300031727 Bacteria 2091
99 Ga0316578_10000004 3300031728 Bacteria 48576
100 Ga0307405_10103891 3300031731 Bacteria 1911
101 Ga0316577_10000555 3300031733 Bacteria 15196
102 Ga0307413_10009285 3300031824 Bacteria 4699
103 Ga0307413_10107522 3300031824 Bacteria 1859
104 Ga0307410_10003108 3300031852 Bacteria 8236
105 Ga0307410_10005206 3300031852 Bacteria 6852
106 Ga0307410_10016499 3300031852 Bacteria 4407
107 Ga0307406_10040747 3300031901 Bacteria 2890
108 Ga0307407_10006430 3300031903 Bacteria 5221
109 Ga0307407_10092774 3300031903 Bacteria 1855
110 Ga0307412_10019625 3300031911 Bacteria 4099
111 Ga0307409_100010854 3300031995 Bacteria 5700
112 Ga0307409_100084484 3300031995 Bacteria 2577
113 Ga0307409_100097744 3300031995 Bacteria 2426
114 Ga0307409_100098415 3300031995 Bacteria 2419
115 Ga0307409_100163162 3300031995 Bacteria 1952
116 Ga0307416_100016376 3300032002 Bacteria 5151
117 Ga0307416_100053123 3300032002 Bacteria 3249
118 Ga0307416_100056341 3300032002 Bacteria 3172
119 Ga0307416_100073971 3300032002 Bacteria 2844
120 Ga0307416_100344281 3300032002 Bacteria 1505
121 Ga0307414_10046816 3300032004 Bacteria 2972
122 Ga0307414_10079838 3300032004 Bacteria 2390
123 Ga0307411_10006332 3300032005 Bacteria 5918
124 Ga0307411_10006918 3300032005 Bacteria 5721
125 Ga0307411_10013846 3300032005 Bacteria 4467
126 Ga0307411_10067270 3300032005 Bacteria 2410
127 Ga0307411_10118359 3300032005 Bacteria 1911
128 Ga0307411_10143181 3300032005 Bacteria 1765
129 Ga0316580_10006845 3300032139 Bacteria 3376
130 Ga0373961_0043090 3300035241 Bacteria 1311
131 Ga0373931_0017973 3300035691 Bacteria 3508
132 Ga0316582_0009110 3300036647 Bacteria 5372
133 Ga0316582_0026373 3300036647 Bacteria 3498
134 Ga0316584_0011549 3300036712 Bacteria 6210
135 Ga0395899_0009431 3300037312 Bacteria 7497
136 Ga0395900_0005542 3300037418 Bacteria 13217
137 Ga0395905_0017930 3300037471 Bacteria 6724
138 Ga0395901_0002031 3300038443 Bacteria 20807
139 Ga0436365_1632165 3300039437 Bacteria 3726
140 Ga0439434_0006030 3300042435 Bacteria 3535
141 Ga0453683_0090628 3300044673 Bacteria 1917
142 Ga0466964_0021757 3300044706 Bacteria 2482
143 Ga0495580_0022895 3300046472 Bacteria 4593
144 Ga0495582_0017485 3300046473 Bacteria 3923
145 Ga0495639_0003886 3300046475 Bacteria 6419
146 Ga0495662_0017422 3300046476 Bacteria 3477
147 Ga0495618_0021654 3300046514 Bacteria 3964
148 Ga0495640_0039092 3300046533 Bacteria 3332
149 Ga0495667_0109391 3300046559 Bacteria 1785
150 Ga0495647_0005043 3300046681 Bacteria 4324
151 Ga0495613_0004856 3300046689 Bacteria 10092
152 Ga0495624_0028526 3300046690 Bacteria 3647
153 Ga0495674_0010409 3300047319 Bacteria 8804
154 Ga0496102_0031875 3300048905 Bacteria 4732
155 Ga0496102_0040425 3300048905 Bacteria 4218
156 Ga0496104_0034288 3300048907 Bacteria 4731
157 Ga0496104_0095576 3300048907 Bacteria 2843
158 Ga0496105_0024919 3300048908 Bacteria 4863
159 Ga0496106_0044531 3300048909 Bacteria 3331
160 Ga0496106_0082038 3300048909 Bacteria 2478
161 Ga0496108_0001015 3300048911 Bacteria 21893
162 Ga0496108_0004278 3300048911 Bacteria 11495
163 Ga0496108_0144189 3300048911 Bacteria 2052
164 Ga0496109_0001618 3300048912 Bacteria 18825
165 Ga0496109_0026171 3300048912 Bacteria 5200
166 Ga0496110_0004611 3300048913 Bacteria 10705
167 Ga0496111_0065615 3300048914 Bacteria 2635
168 Ga0496112_0000777 3300048915 Bacteria 22477
169 Ga0496112_0001653 3300048915 Bacteria 17323
170 Ga0496112_0090310 3300048915 Bacteria 3032
171 Ga0496113_0000735 3300048916 Bacteria 16815
172 Ga0501034_0000957 3300049571 Bacteria 41717
173 Ga0501041_0011939 3300049577 Bacteria 5143
174 Ga0501042_0036520 3300049578 Bacteria 3486
175 Ga0501046_0084093 3300049580 Bacteria 2455
176 Ga0501048_0056669 3300049582 Bacteria 2780
177 Ga0501048_0077280 3300049582 Bacteria 2350
178 Ga0501067_0001051 3300049583 Bacteria 14859
179 Ga0501067_0015493 3300049583 Bacteria 4219
180 Ga0501068_0000075 3300049584 Bacteria 39857
181 Ga0501068_0002185 3300049584 Bacteria 10424
182 Ga0501068_0008876 3300049584 Bacteria 5610
183 Ga0501069_0000201 3300049585 Bacteria 26361
184 Ga0501069_0000583 3300049585 Bacteria 16870
185 Ga0501069_0006547 3300049585 Bacteria 6092
186 Ga0501070_0002218 3300049586 Bacteria 17067
187 Ga0501070_0002776 3300049586 Bacteria 15278
188 Ga0501070_0027034 3300049586 Bacteria 4813
189 Ga0501071_0001022 3300049587 Bacteria 15424
190 Ga0501072_0030811 3300049588 Bacteria 4196
191 Ga0501072_0064869 3300049588 Bacteria 2880
192 Ga0501072_0125710 3300049588 Bacteria 2043
193 Ga0501073_0001702 3300049589 Bacteria 16308
194 Ga0501073_0010626 3300049589 Bacteria 6736
195 Ga0501074_0000981 3300049590 Bacteria 18483
196 Ga0501074_0003108 3300049590 Bacteria 11705
197 Ga0501076_0027461 3300049592 Bacteria 4415
198 Ga0501077_0000496 3300049593 Bacteria 23850
199 Ga0501077_0076735 3300049593 Bacteria 2117
200 Ga0501079_0001564 3300049741 Bacteria 16235
201 Ga0501079_0071089 3300049741 Bacteria 2688
202 Ga0501080_0006100 3300049742 Bacteria 10806
203 Ga0501080_0010181 3300049742 Bacteria 8598
204 Ga0501080_0160536 3300049742 Bacteria 2076
205 Ga0501081_0045796 3300049743 Bacteria 3004
206 Ga0501083_0000108 3300049744 Bacteria 55825
207 Ga0501083_0005191 3300049744 Bacteria 9215
208 nmdc:mga05p37_217432_c1 3300050507 Bacteria 2307
209 nmdc:mga05p37_2322_c1 3300050507 Bacteria 22147
210 nmdc:mga09592_111606_c1 3300050508 Bacteria 2346
211 nmdc:mga0qj67_42939_c1 3300050509 Bacteria 3560
212 nmdc:mga06r32_98227_c1 3300050510 Bacteria 2870
213 nmdc:mga0n895_114654_c1 3300050512 Bacteria 2713
214 nmdc:mga0n895_80249_c1 3300050512 Bacteria 3250
215 nmdc:mga0a205_64246_c1 3300050515 Bacteria 3545
216 Ga0501084_0006504 3300054114 Bacteria 9605
217 Ga0501084_0035475 3300054114 Bacteria 4169
218 Ga0501084_0251785 3300054114 Bacteria 1491
219 Ga0590071_000860 3300059421 Bacteria 8459
220 Ga0501082_0001928 3300060353 Bacteria 18242
221 Ga0501082_0058201 3300060353 Bacteria 3329
222 Ga0530510_0171744 3300061734 Bacteria 1606
223 Ga0065715_10115624
224 Ga0065715_10095370
225 Ga0070658_10044511
226 Ga0070658_10096879
227 Ga0070683_100063663
228 Ga0070680_100006769
229 Ga0070660_100059348
230 Ga0070660_100065588
231 Ga0070660_100090737
232 Ga0070691_10056675
233 Ga0070668_100125777
234 Ga0070714_100015478
235 Ga0070711_100005417
236 Ga0070711_100056731
237 Ga0070705_100012045
238 Ga0070705_100016019
239 Ga0070708_100003233
240 Ga0070708_100157403
241 Ga0070663_100002625
242 Ga0070662_100209404
243 Ga0070681_10028388
244 Ga0070706_100007941
245 Ga0070706_100129383
246 Ga0070707_100172445
247 Ga0070707_100237089
248 Ga0070698_100096887
249 Ga0070698_100104949
250 Ga0070699_100000224
251 Ga0070699_100005020
252 Ga0070699_100021845
253 Ga0070679_100216102
254 Ga0070697_100075818
255 Ga0070695_100045386
256 Ga0070696_100001799
257 Ga0070696_100034017
258 Ga0070704_100002973
259 Ga0070704_100003943
260 Ga0068854_100147804
261 Ga0068852_100010293
262 Ga0068852_100181410
263 Ga0068859_100178946
264 Ga0068862_100222448
265 Ga0081455_10036305
266 Ga0081538_10034194
267 Ga0075428_100103164
268 Ga0075430_100008807
269 Ga0075431_100106698
270 Ga0075433_10067112
271 Ga0075433_10110517
272 Ga0075433_10221496
273 Ga0075429_100119107
274 Ga0075429_100134233
275 Ga0097620_100178959
276 Ga0105240_10068790
277 Ga0105240_10281549
278 Ga0114129_10000112
279 Ga0114129_10109513
280 Ga0114129_10305012
281 Ga0105241_10000025
282 Ga0105248_10148328
283 Ga0105249_10018617
284 Ga0105239_10003966
285 Ga0105239_10165607
286 Ga0105239_10321110
287 Ga0105239_10419232
288 Ga0157371_10095789
289 Ga0157370_10038484
290 Ga0157370_10328119
291 Ga0157369_10019853
292 Ga0163162_10048371
293 Ga0163163_10100730
294 Ga0213876_10031398
295 Ga0207688_10047937
296 Ga0207699_10131951
297 Ga0207705_10004637
298 Ga0207654_10000187
299 Ga0207707_10004621
300 Ga0207695_10208214
301 Ga0207663_10076432
302 Ga0207657_10007210
303 Ga0207657_10037892
304 Ga0207652_10027601
305 Ga0207652_10104482
306 Ga0207646_10069294
307 Ga0207646_10155758
308 Ga0207646_10229777
309 Ga0207664_10022238
310 Ga0207667_10173197
311 Ga0207712_10092481
312 Ga0207640_10095061
313 Ga0207640_10229327
314 Ga0207678_10000466
315 Ga0207676_10014848
316 Ga0207676_10032844
317 Ga0209974_10024496
318 Ga0316576_10000863
319 Ga0316576_10036444
320 Ga0316576_10107316
321 Ga0316578_10000004
322 Ga0307405_10103891
323 Ga0316577_10000555
324 Ga0307413_10009285
325 Ga0307413_10107522
326 Ga0307410_10003108
327 Ga0307410_10005206
328 Ga0307410_10016499
329 Ga0307406_10040747
330 Ga0307407_10006430
331 Ga0307407_10092774
332 Ga0307412_10019625
333 Ga0307409_100010854
334 Ga0307409_100084484
335 Ga0307409_100097744
336 Ga0307409_100098415
337 Ga0307409_100163162
338 Ga0307416_100016376
339 Ga0307416_100053123
340 Ga0307416_100056341
341 Ga0307416_100073971
342 Ga0307416_100344281
343 Ga0307414_10046816
344 Ga0307414_10079838
345 Ga0307411_10006332
346 Ga0307411_10006918
347 Ga0307411_10013846
348 Ga0307411_10067270
349 Ga0307411_10118359
350 Ga0307411_10143181
351 Ga0316580_10006845
352 Ga0373961_0043090
353 Ga0373931_0017973
354 Ga0316582_0009110
355 Ga0316582_0026373
356 Ga0316584_0011549
357 Ga0395899_0009431
358 Ga0395900_0005542
359 Ga0395905_0017930
360 Ga0395901_0002031
361 Ga0436365_1632165
362 Ga0439434_0006030
363 Ga0453683_0090628
364 Ga0466964_0021757
365 Ga0495580_0022895
366 Ga0495582_0017485
367 Ga0495639_0003886
368 Ga0495662_0017422
369 Ga0495618_0021654
370 Ga0495640_0039092
371 Ga0495667_0109391
372 Ga0495647_0005043
373 Ga0495613_0004856
374 Ga0495624_0028526
375 Ga0495674_0010409
376 Ga0496102_0031875
377 Ga0496102_0040425
378 Ga0496104_0034288
379 Ga0496104_0095576
380 Ga0496105_0024919
381 Ga0496106_0044531
382 Ga0496106_0082038
383 Ga0496108_0001015
384 Ga0496108_0004278
385 Ga0496108_0144189
386 Ga0496109_0001618
387 Ga0496109_0026171
388 Ga0496110_0004611
389 Ga0496111_0065615
390 Ga0496112_0000777
391 Ga0496112_0001653
392 Ga0496112_0090310
393 Ga0496113_0000735
394 Ga0501034_0000957
395 Ga0501041_0011939
396 Ga0501042_0036520
397 Ga0501046_0084093
398 Ga0501048_0056669
399 Ga0501048_0077280
400 Ga0501067_0001051
401 Ga0501067_0015493
402 Ga0501068_0000075
403 Ga0501068_0002185
404 Ga0501068_0008876
405 Ga0501069_0000201
406 Ga0501069_0000583
407 Ga0501069_0006547
408 Ga0501070_0002218
409 Ga0501070_0002776
410 Ga0501070_0027034
411 Ga0501071_0001022
412 Ga0501072_0030811
413 Ga0501072_0064869
414 Ga0501072_0125710
415 Ga0501073_0001702
416 Ga0501073_0010626
417 Ga0501074_0000981
418 Ga0501074_0003108
419 Ga0501076_0027461
420 Ga0501077_0000496
421 Ga0501077_0076735
422 Ga0501079_0001564
423 Ga0501079_0071089
424 Ga0501080_0006100
425 Ga0501080_0010181
426 Ga0501080_0160536
427 Ga0501081_0045796
428 Ga0501083_0000108
429 Ga0501083_0005191
430 nmdc:mga05p37_217432_c1
431 nmdc:mga05p37_2322_c1
432 nmdc:mga09592_111606_c1
433 nmdc:mga0qj67_42939_c1
434 nmdc:mga06r32_98227_c1
435 nmdc:mga0n895_114654_c1
436 nmdc:mga0n895_80249_c1
437 nmdc:mga0a205_64246_c1
438 Ga0501084_0006504
439 Ga0501084_0035475
440 Ga0501084_0251785
441 Ga0590071_000860
442 Ga0501082_0001928
443 Ga0501082_0058201
444 Ga0530510_0171744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

14

377

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zmh-assembly1.cif.gz_1 cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.7787 10 335
7p7m-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, inhibited by piericidin a, open state 0.7768 9 331
7arb-assembly1.cif.gz_H cryo-em structure of arabidopsis thaliana complex-i (complete composition) 0.7751 12 335
7ak5-assembly1.cif.gz_H cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a 0.7729 12 344
7z83-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, open state 0.7689 1 331
ID Description Score Start End Superfamily
af_O61528_1799_2003_1.20.900.10 Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain 0.3377 175 303 1.20.900.10
af_Q84K71_316_482_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3273 153 330 1.20.1250.20
af_Q84K71_316_482_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3172 153 330 1.20.1250.20
af_C0PE06_523_755_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3153 153 326 1.20.1250.20
af_P21503_7_181_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.309 137 328 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V9JGV4-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8614 151 392 GO:0003954
GO:0005886
GO:0009060
AF-A0A526YKR5-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 1.6.5.11) 0.8436 8 100 GO:0003954
GO:0005886
GO:0009060
AF-A0A3B8PYH2-F1-model_v4 Hydroxyacid dehydrogenase 0.8291 151 336 GO:0003954
GO:0005886
GO:0009060
AF-A0A7V9JGV4-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8247 151 392 GO:0003954
GO:0005886
GO:0009060
AF-A0A1Y2T4Y5-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8178 152 329 GO:0003954
GO:0005886
GO:0009060

Map