F333760

General Info

Members Datasets Scaffolds Average Seq Length
221 172 188 282

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0001332|Ga0495686_0001332_19792_20781
Length 329
Sequence MERPVTREFSFPMSRRQALIAGATASVVMAAPAFAAEKKNPPTLKGASPMAAEFVTTRDGVQIFYKDWGPKDAQPIVFHHGWPLSADDWDAQMLFFLDKGYRVVAHDRRGHGRSSQVSEGHDMDHYAADASAVVEHLNLRNAIHIGHSTGGGEVARYVAKYGQPQGRVAKAALVSAVPPLMLKTAANPEGTPIEVFDGLRAGLAANRAQFYIDVASGPFYGFNRAGAKVSQGIIDNWWRQGMMGSAKAHYEGIKAFSETDQTEDLKSITVPTLVTQGDDDQIVPYKDASLIQTKLLKNNTLKIYPGFPHGMLTTHAEVLNPDLLAFIKG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
5 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
6 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
7 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
8 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
9 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
10 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
11 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
12 2738541293 Rhizobium sp. GV031 Isolate Unclassified
13 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
14 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
15 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
16 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
17 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
20 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
23 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
24 2885198086 Variovorax sp. 679 Isolate Unclassified
25 2885211737 Variovorax sp. 553 Isolate Unclassified
26 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
27 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
28 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
29 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
30 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
101 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
170 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
171 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
172 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.62
Metatranscriptomes 0.45
Isolates 14.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.67
Nodule 0.45
Rhizoplane 0.9
Rhizosphere 64.25
Stem 0
Stem Tuber 0
Unclassified 21.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000164 3300001915 Bacteria 19069
2 JGI24740J21852_10020784 3300001979 Bacteria 2284
3 JGI24739J22299_10002282 3300001989 Bacteria 7371
4 JGI24737J22298_10001139 3300001990 Bacteria 9360
5 JGI24735J21928_10005577 3300002067 Bacteria 4170
6 JGI24735J21928_10005879 3300002067 Bacteria 4056
7 JGI24738J21930_10003755 3300002075 Bacteria 3796
8 JGI25152J39213_1000418 3300002773 Bacteria 25621
9 JGI25150J39212_1000022 3300002774 Bacteria 131963
10 JGI25151J46595_10000023 3300003187 Bacteria 221548
11 JGI25151J46595_10010029 3300003187 Bacteria 4437
12 JGI25153J46596_10002478 3300003215 Bacteria 10596
13 Ga0055536_1003258 3300003781 Bacteria 8799
14 Ga0055531_10004240 3300003794 Bacteria 8819
15 Ga0070658_10224899 3300005327 Bacteria 1588
16 Ga0070666_10070827 3300005335 Bacteria 2373
17 Ga0070661_100179438 3300005344 Bacteria 1610
18 Ga0070674_100017666 3300005356 Bacteria 4495
19 Ga0070662_100283245 3300005457 Bacteria 1342
20 Ga0070662_100319128 3300005457 Bacteria 1266
21 Ga0068853_100131543 3300005539 Bacteria 2240
22 Ga0070665_100043355 3300005548 Bacteria 4521
23 Ga0068855_100103680 3300005563 Bacteria 3272
24 Ga0070664_100094154 3300005564 Bacteria 2597
25 Ga0068857_100079334 3300005577 Bacteria 2930
26 Ga0068854_100193872 3300005578 Bacteria 1593
27 Ga0068856_100030980 3300005614 Bacteria 5232
28 Ga0068852_100164370 3300005616 Bacteria 2075
29 Ga0075364_10068199 3300006051 Bacteria 2339
30 Ga0105251_10053268 3300009011 Bacteria 1924
31 Ga0105240_10127475 3300009093 Bacteria 3056
32 Ga0111539_10006288 3300009094 Bacteria 15332
33 Ga0105243_10029498 3300009148 Bacteria 4219
34 Ga0105241_10005020 3300009174 Bacteria 9771
35 Ga0105237_10010486 3300009545 Bacteria 9847
36 Ga0105238_10015413 3300009551 Bacteria 7733
37 Ga0105238_10096149 3300009551 Bacteria 2948
38 Ga0105249_10975809 3300009553 Bacteria 916
39 Ga0099796_10000735 3300010159 Bacteria 5835
40 Ga0157373_10024686 3300013100 Bacteria 4353
41 Ga0157370_10025617 3300013104 Bacteria 5837
42 Ga0157369_10137449 3300013105 Bacteria 2586
43 Ga0171462_1001 3300013250 Bacteria 1135406
44 Ga0157372_10411645 3300013307 Bacteria 1576
45 Ga0213872_10005255 3300021361 Bacteria 6695
46 Ga0207425_1000038 3300025245 Bacteria 221600
47 Ga0209129_1000036 3300025258 Bacteria 328331
48 Ga0209673_1006398 3300025273 Bacteria 5694
49 Ga0209130_1011989 3300025284 Bacteria 2293
50 Ga0209676_1000888 3300025292 Bacteria 38155
51 Ga0209025_1000029 3300025294 Bacteria 488571
52 Ga0209025_1000108 3300025294 Bacteria 221600
53 Ga0209758_1000104 3300025297 Bacteria 221600
54 Ga0209256_1001172 3300025299 Bacteria 29539
55 Ga0209257_1000879 3300025304 Bacteria 42464
56 Ga0207656_10103726 3300025321 Bacteria 1306
57 Ga0207680_10120517 3300025903 Bacteria 1715
58 Ga0207647_10065457 3300025904 Bacteria 2206
59 Ga0207647_10075727 3300025904 Bacteria 2025
60 Ga0207654_10071661 3300025911 Bacteria 2061
61 Ga0207671_10280553 3300025914 Bacteria 1314
62 Ga0207660_10001085 3300025917 Bacteria 18123
63 Ga0207657_10020474 3300025919 Bacteria 6250
64 Ga0207657_10047119 3300025919 Bacteria 3772
65 Ga0207652_10446979 3300025921 Bacteria 1165
66 Ga0207694_10011519 3300025924 Bacteria 6674
67 Ga0207694_10108157 3300025924 Bacteria 2209
68 Ga0207706_10115238 3300025933 Bacteria 2364
69 Ga0207667_10210011 3300025949 Bacteria 1995
70 Ga0207668_10386235 3300025972 Bacteria 1180
71 Ga0207640_10276230 3300025981 Bacteria 1317
72 Ga0207639_10001921 3300026041 Bacteria 13959
73 Ga0207639_10199826 3300026041 Bacteria 1714
74 Ga0207678_10001505 3300026067 Bacteria 21344
75 Ga0207702_10005889 3300026078 Bacteria 10661
76 Ga0207674_10039585 3300026116 Bacteria 4885
77 Ga0207698_10012643 3300026142 Bacteria 5532
78 Ga0268266_10049917 3300028379 Bacteria 3589
79 Ga0268266_10076095 3300028379 Bacteria 2917
80 Ga0307515_10003402 3300028794 Bacteria 33496
81 Ga0307515_10420134 3300028794 Bacteria 958
82 Ga0316177_1017572 3300030731 Bacteria 11894
83 Ga0316180_1046060 3300030736 Bacteria 3866
84 Ga0265339_10004135 3300031249 Bacteria 9999
85 Ga0307408_100023667 3300031548 Bacteria 4187
86 Ga0307408_100421765 3300031548 Bacteria 1151
87 Ga0307405_10127856 3300031731 Bacteria 1750
88 Ga0307410_10008771 3300031852 Bacteria 5630
89 Ga0307410_10120392 3300031852 Bacteria 1913
90 Ga0307410_10135715 3300031852 Bacteria 1813
91 Ga0307406_10056002 3300031901 Bacteria 2523
92 Ga0307406_10059798 3300031901 Bacteria 2454
93 Ga0307407_10007134 3300031903 Bacteria 5038
94 Ga0307412_10081785 3300031911 Bacteria 2234
95 Ga0307412_10096245 3300031911 Bacteria 2083
96 Ga0307412_10221652 3300031911 Bacteria 1450
97 Ga0307416_100061350 3300032002 Bacteria 3068
98 Ga0307414_10021679 3300032004 Bacteria 4039
99 Ga0307411_10001921 3300032005 Bacteria 8881
100 Ga0307411_10004633 3300032005 Bacteria 6623
101 Ga0307415_100014919 3300032126 Bacteria 4585
102 Ga0395898_0022991 3300037466 Bacteria 6304
103 Ga0395905_0036053 3300037471 Bacteria 4645
104 Ga0395901_0053518 3300038443 Bacteria 4194
105 Ga0436361_0531999 3300039447 Bacteria 5472
106 Ga0439442_042412 3300042002 Bacteria 957
107 Ga0439448_0025319 3300042005 Bacteria 1861
108 Ga0495638_0032124 3300046460 Bacteria 3368
109 Ga0495638_0061234 3300046460 Bacteria 2326
110 Ga0495651_0202360 3300046462 Bacteria 1389
111 Ga0495596_0000511 3300046500 Bacteria 24699
112 Ga0495606_0193901 3300046507 Bacteria 1162
113 Ga0495610_0001359 3300046512 Bacteria 21721
114 Ga0495610_0003239 3300046512 Bacteria 12875
115 Ga0495610_0004165 3300046512 Bacteria 10818
116 Ga0495610_0008484 3300046512 Bacteria 6647
117 Ga0495631_0000348 3300046518 Bacteria 31939
118 Ga0495632_0000753 3300046519 Bacteria 29159
119 Ga0495632_0007834 3300046519 Bacteria 6648
120 Ga0495637_0000896 3300046520 Bacteria 19239
121 Ga0495643_0000010 3300046522 Bacteria 341431
122 Ga0495643_0064134 3300046522 Bacteria 1941
123 Ga0495663_0000144 3300046525 Bacteria 29159
124 Ga0495621_0016819 3300046539 Bacteria 2354
125 Ga0495645_0463109 3300046543 Bacteria 798
126 Ga0495633_0000211 3300046558 Bacteria 73547
127 Ga0495633_0016024 3300046558 Bacteria 3876
128 Ga0495668_0011011 3300046616 Bacteria 5441
129 Ga0495611_0111070 3300046648 Bacteria 1276
130 Ga0495625_0034435 3300046660 Bacteria 3738
131 Ga0495657_0140412 3300046675 Bacteria 1506
132 Ga0495671_0000014 3300046692 Bacteria 341431
133 Ga0495681_0009087 3300047470 Bacteria 6160
134 Ga0495686_0000453 3300047472 Bacteria 61817
135 Ga0495686_0001332 3300047472 Bacteria 27671
136 Ga0495686_0002468 3300047472 Bacteria 17425
137 Ga0495686_0006719 3300047472 Bacteria 8747
138 Ga0495686_0022038 3300047472 Bacteria 4219
139 Ga0495686_0033682 3300047472 Bacteria 3305
140 Ga0495686_0059233 3300047472 Bacteria 2384
141 Ga0495626_0000737 3300048091 Bacteria 30402
142 Ga0496102_0009624 3300048905 Bacteria 8311
143 Ga0496115_0001295 3300048918 Bacteria 17869
144 Ga0496116_0015501 3300048919 Bacteria 6020
145 Ga0496117_0001139 3300048920 Bacteria 40044
146 Ga0496117_0005956 3300048920 Bacteria 12569
147 Ga0496118_0011877 3300048921 Bacteria 8438
148 Ga0496118_0034108 3300048921 Bacteria 4161
149 Ga0496118_0181560 3300048921 Bacteria 1271
150 Ga0496119_0003258 3300048922 Bacteria 16981
151 Ga0496119_0007993 3300048922 Bacteria 9403
152 Ga0496121_0074142 3300048924 Bacteria 2724
153 Ga0496122_0000036 3300048925 Bacteria 312598
154 Ga0496122_0000224 3300048925 Bacteria 126514
155 Ga0496122_0019525 3300048925 Bacteria 6185
156 Ga0496122_0114962 3300048925 Bacteria 1754
157 Ga0496123_0000011 3300048926 Bacteria 493925
158 Ga0496123_0000187 3300048926 Bacteria 125396
159 Ga0496123_0006943 3300048926 Bacteria 10813
160 Ga0496124_0000902 3300048927 Bacteria 48012
161 Ga0496124_0000930 3300048927 Bacteria 47209
162 Ga0496124_0001655 3300048927 Bacteria 31821
163 Ga0496124_0004156 3300048927 Bacteria 17086
164 Ga0496124_0005024 3300048927 Bacteria 15123
165 Ga0496124_0012751 3300048927 Bacteria 8262
166 Ga0496124_0060526 3300048927 Bacteria 3176
167 Ga0496125_0108964 3300048928 Bacteria 2012
168 Ga0496125_0161256 3300048928 Bacteria 1523
169 Ga0496126_0000967 3300048929 Bacteria 49289
170 Ga0496126_0027331 3300048929 Bacteria 5451
171 Ga0501335_000180 3300049551 Bacteria 3390
172 Ga0501034_0000347 3300049571 Bacteria 80032
173 Ga0501043_0076138 3300049579 Bacteria 2636
174 Ga0501047_0074004 3300049581 Bacteria 3279
175 Ga0501070_0040274 3300049586 Bacteria 3896
176 nmdc:mga00v17_39544_c1 3300050491 Bacteria 2825
177 nmdc:mga07m45_194636_c1 3300050496 Bacteria 1179
178 nmdc:mga08y16_85566_c1 3300050511 Bacteria 3286
179 nmdc:mga08y16_947782_c1 3300050511 Bacteria 844
180 Ga0500643_000887 3300053087 Bacteria 18945
181 Ga0500646_0000304 3300053090 Bacteria 15062
182 Ga0500641_0022182 3300053096 Bacteria 2429
183 Ga0500556_0000126 3300053104 Bacteria 65589
184 Ga0500595_015362 3300053119 Bacteria 2878
185 Ga0500559_0043436 3300053136 Bacteria 1963
186 Ga0500568_0046176 3300053139 Bacteria 1730
187 Ga0500661_005745 3300055283 Bacteria 2312
188 Ga0590071_016757 3300059421 Bacteria 1720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_947782_c1 nmdc:mga08y16_947782_c1_33_740 235
2 3300046543 Ga0495645_0463109 Ga0495645_0463109_17_772 251
3 3300046660 Ga0495625_0034435 Ga0495625_0034435_1673_2554 262
4 iso_pu_bacteria 2508501128 2509152771 269
5 iso_pu_bacteria 2852649853 2852653251 269
6 3300005335 Ga0070666_10070827 Ga0070666_100708272 272
7 3300005548 Ga0070665_100043355 Ga0070665_1000433553 272
8 3300025903 Ga0207680_10120517 Ga0207680_101205172 272
9 3300025919 Ga0207657_10047119 Ga0207657_100471192 272
10 3300025921 Ga0207652_10446979 Ga0207652_104469792 272
11 3300026041 Ga0207639_10199826 Ga0207639_101998262 272
12 3300028379 Ga0268266_10049917 Ga0268266_100499172 272
13 iso_pu_bacteria 2582581283 2585166536 272
14 iso_pu_bacteria 2582581306 2585267142 272
15 iso_pu_bacteria 2582581865 2585388193 272
16 iso_pu_bacteria 2738541275 2738709040 272
17 iso_pu_bacteria 2738541301 2738847465 272
18 iso_pu_bacteria 2738541304 2738863194 272
19 iso_pu_bacteria 2738543022 2739295712 272
20 iso_pu_bacteria 2738543033 2739357390 272
21 iso_pu_bacteria 2784132148 2784592600 272
22 iso_pu_bacteria 2802429296 2804845244 272
23 iso_pu_bacteria 2811994917 2812483260 272
24 iso_pu_bacteria 2848297114 2848300135 272
25 iso_pu_bacteria 2912715099 2912723698 272
26 iso_pu_bacteria 2928100450 2928102190 272
27 iso_pu_bacteria 2928959182 2928962368 272
28 iso_pu_bacteria 8023623736 8023629136 272
29 iso_pu_bacteria 8025413630 8025415461 272
30 3300048927 Ga0496124_0060526 Ga0496124_0060526_2183_3139 273
31 3300048929 Ga0496126_0000967 Ga0496126_0000967_29953_30774 273
32 3300049571 Ga0501034_0000347 Ga0501034_0000347_34909_35919 273
33 iso_pu_bacteria 2593339238 2595446064 273
34 iso_pu_bacteria 2593339239 2595452485 273
35 3300009094 Ga0111539_10006288 Ga0111539_100062885 274
36 3300009551 Ga0105238_10015413 Ga0105238_100154132 274
37 3300010159 Ga0099796_10000735 Ga0099796_100007354 274
38 3300025924 Ga0207694_10011519 Ga0207694_100115197 274
39 3300031548 Ga0307408_100023667 Ga0307408_1000236676 274
40 3300031911 Ga0307412_10221652 Ga0307412_102216523 274
41 3300032002 Ga0307416_100061350 Ga0307416_1000613505 274
42 3300042002 Ga0439442_042412 Ga0439442_042412_121_945 274
43 3300042005 Ga0439448_0025319 Ga0439448_0025319_126_950 274
44 3300046460 Ga0495638_0032124 Ga0495638_0032124_1895_2725 274
45 3300046462 Ga0495651_0202360 Ga0495651_0202360_501_1337 274
46 3300046522 Ga0495643_0064134 Ga0495643_0064134_564_1535 274
47 3300046675 Ga0495657_0140412 Ga0495657_0140412_115_951 274
48 3300047472 Ga0495686_0006719 Ga0495686_0006719_6605_7435 274
49 3300047472 Ga0495686_0022038 Ga0495686_0022038_3095_3925 274
50 3300048918 Ga0496115_0001295 Ga0496115_0001295_28_858 274
51 3300050511 nmdc:mga08y16_85566_c1 nmdc:mga08y16_85566_c1_2260_3084 274
52 3300053090 Ga0500646_0000304 Ga0500646_0000304_1863_2687 274
53 3300053096 Ga0500641_0022182 Ga0500641_0022182_15_845 274
54 iso_pu_bacteria 2511231027 2511389944 274
55 iso_pu_bacteria 2751185897 2753764064 274
56 iso_pu_bacteria 2885198086 2885201538 274
57 iso_pu_bacteria 2885211737 2885215751 274
58 iso_pu_bacteria 8057345674 8057347339 274
59 3300037466 Ga0395898_0022991 Ga0395898_0022991_3018_3932 275
60 3300037471 Ga0395905_0036053 Ga0395905_0036053_1896_2810 275
61 3300038443 Ga0395901_0053518 Ga0395901_0053518_1718_2632 275
62 3300047472 Ga0495686_0000453 Ga0495686_0000453_25726_26553 275
63 3300049581 Ga0501047_0074004 Ga0501047_0074004_143_1027 275
64 iso_pu_bacteria 2816332133 2816471244 275
65 iso_pu_bacteria 2928526807 2928529137 275
66 3300002067 JGI24735J21928_10005879 JGI24735J21928_100058792 276
67 3300003781 Ga0055536_1003258 Ga0055536_10032587 276
68 3300003794 Ga0055531_10004240 Ga0055531_100042402 276
69 3300005356 Ga0070674_100017666 Ga0070674_1000176664 276
70 3300005457 Ga0070662_100283245 Ga0070662_1002832452 276
71 3300006051 Ga0075364_10068199 Ga0075364_100681993 276
72 3300009011 Ga0105251_10053268 Ga0105251_100532682 276
73 3300009148 Ga0105243_10029498 Ga0105243_100294986 276
74 3300009553 Ga0105249_10975809 Ga0105249_109758091 276
75 3300013104 Ga0157370_10025617 Ga0157370_100256177 276
76 3300013307 Ga0157372_10411645 Ga0157372_104116452 276
77 3300021361 Ga0213872_10005255 Ga0213872_100052553 276
78 3300025284 Ga0209130_1011989 Ga0209130_10119892 276
79 3300025292 Ga0209676_1000888 Ga0209676_100088826 276
80 3300025299 Ga0209256_1001172 Ga0209256_10011725 276
81 3300025304 Ga0209257_1000879 Ga0209257_100087915 276
82 3300025904 Ga0207647_10065457 Ga0207647_100654572 276
83 3300025917 Ga0207660_10001085 Ga0207660_1000108514 276
84 3300025972 Ga0207668_10386235 Ga0207668_103862351 276
85 3300028794 Ga0307515_10003402 Ga0307515_100034022 276
86 3300028794 Ga0307515_10420134 Ga0307515_104201341 276
87 3300030731 Ga0316177_1017572 Ga0316177_10175723 276
88 3300030736 Ga0316180_1046060 Ga0316180_10460602 276
89 3300031548 Ga0307408_100421765 Ga0307408_1004217651 276
90 3300031731 Ga0307405_10127856 Ga0307405_101278562 276
91 3300031852 Ga0307410_10120392 Ga0307410_101203922 276
92 3300031852 Ga0307410_10135715 Ga0307410_101357152 276
93 3300031901 Ga0307406_10056002 Ga0307406_100560022 276
94 3300031903 Ga0307407_10007134 Ga0307407_100071342 276
95 3300032004 Ga0307414_10021679 Ga0307414_100216793 276
96 3300032005 Ga0307411_10001921 Ga0307411_100019213 276
97 3300032126 Ga0307415_100014919 Ga0307415_1000149192 276
98 3300039447 Ga0436361_0531999 Ga0436361_0531999_1900_2892 276
99 3300046512 Ga0495610_0004165 Ga0495610_0004165_6274_7104 276
100 3300046518 Ga0495631_0000348 Ga0495631_0000348_24145_24975 276
101 3300048905 Ga0496102_0009624 Ga0496102_0009624_161_1087 276
102 3300048921 Ga0496118_0181560 Ga0496118_0181560_284_1210 276
103 3300048927 Ga0496124_0000930 Ga0496124_0000930_29318_30148 276
104 3300048929 Ga0496126_0027331 Ga0496126_0027331_3020_3850 276
105 3300050491 nmdc:mga00v17_39544_c1 nmdc:mga00v17_39544_c1_587_1417 276
106 3300050496 nmdc:mga07m45_194636_c1 nmdc:mga07m45_194636_c1_169_1023 276
107 3300059421 Ga0590071_016757 Ga0590071_016757_617_1510 276
108 iso_pu_bacteria 2510917030 2511200298 276
109 iso_pu_bacteria 2585427594 2585842302 276
110 iso_pu_bacteria 2643221643 2644238080 276
111 iso_pu_bacteria 2738541293 2738801742 276
112 iso_pu_bacteria 8005542996 8005549562 276
113 3300046616 Ga0495668_0011011 Ga0495668_0011011_1898_2869 277
114 3300053119 Ga0500595_015362 Ga0500595_015362_1263_2105 277
115 3300003187 JGI25151J46595_10010029 JGI25151J46595_100100292 278
116 3300013250 Ga0171462_1001 Ga0171462_1001430 278
117 3300025294 Ga0209025_1000029 Ga0209025_100002960 278
118 3300028379 Ga0268266_10076095 Ga0268266_100760952 278
119 3300031249 Ga0265339_10004135 Ga0265339_100041357 278
120 3300031911 Ga0307412_10096245 Ga0307412_100962453 278
121 3300046460 Ga0495638_0061234 Ga0495638_0061234_886_1767 278
122 3300046500 Ga0495596_0000511 Ga0495596_0000511_13746_14582 278
123 3300046507 Ga0495606_0193901 Ga0495606_0193901_215_1051 278
124 3300046512 Ga0495610_0001359 Ga0495610_0001359_19817_20653 278
125 3300046512 Ga0495610_0008484 Ga0495610_0008484_918_1754 278
126 3300046519 Ga0495632_0000753 Ga0495632_0000753_13112_13948 278
127 3300046519 Ga0495632_0007834 Ga0495632_0007834_4882_5718 278
128 3300046520 Ga0495637_0000896 Ga0495637_0000896_948_1784 278
129 3300046522 Ga0495643_0000010 Ga0495643_0000010_17484_18320 278
130 3300046525 Ga0495663_0000144 Ga0495663_0000144_13112_13948 278
131 3300046539 Ga0495621_0016819 Ga0495621_0016819_650_1486 278
132 3300046558 Ga0495633_0000211 Ga0495633_0000211_28712_29548 278
133 3300046558 Ga0495633_0016024 Ga0495633_0016024_1898_2734 278
134 3300046692 Ga0495671_0000014 Ga0495671_0000014_17484_18320 278
135 3300047470 Ga0495681_0009087 Ga0495681_0009087_976_1812 278
136 3300047472 Ga0495686_0002468 Ga0495686_0002468_2372_3208 278
137 3300047472 Ga0495686_0033682 Ga0495686_0033682_2426_3262 278
138 3300047472 Ga0495686_0059233 Ga0495686_0059233_114_950 278
139 3300048091 Ga0495626_0000737 Ga0495626_0000737_28295_29131 278
140 3300048920 Ga0496117_0001139 Ga0496117_0001139_20599_21435 278
141 3300048921 Ga0496118_0011877 Ga0496118_0011877_4088_4924 278
142 3300048922 Ga0496119_0003258 Ga0496119_0003258_4380_5216 278
143 3300048922 Ga0496119_0007993 Ga0496119_0007993_49_885 278
144 3300048925 Ga0496122_0000036 Ga0496122_0000036_133770_134606 278
145 3300048925 Ga0496122_0000224 Ga0496122_0000224_73816_74652 278
146 3300048926 Ga0496123_0000011 Ga0496123_0000011_133846_134682 278
147 3300048926 Ga0496123_0000187 Ga0496123_0000187_27355_28191 278
148 3300048927 Ga0496124_0001655 Ga0496124_0001655_22076_22912 278
149 3300048927 Ga0496124_0005024 Ga0496124_0005024_5224_6060 278
150 3300048928 Ga0496125_0108964 Ga0496125_0108964_1094_1930 278
151 3300049579 Ga0501043_0076138 Ga0501043_0076138_1624_2463 278
152 3300049586 Ga0501070_0040274 Ga0501070_0040274_2873_3709 278
153 3300053104 Ga0500556_0000126 Ga0500556_0000126_44840_45805 278
154 3300053136 Ga0500559_0043436 Ga0500559_0043436_514_1350 278
155 3300053139 Ga0500568_0046176 Ga0500568_0046176_23_859 278
156 3300001915 JGI24741J21665_1000164 JGI24741J21665_10001649 279
157 3300001979 JGI24740J21852_10020784 JGI24740J21852_100207842 279
158 3300001989 JGI24739J22299_10002282 JGI24739J22299_100022828 279
159 3300001990 JGI24737J22298_10001139 JGI24737J22298_100011393 279
160 3300002067 JGI24735J21928_10005577 JGI24735J21928_100055774 279
161 3300002075 JGI24738J21930_10003755 JGI24738J21930_100037552 279
162 3300002773 JGI25152J39213_1000418 JGI25152J39213_10004184 279
163 3300002774 JGI25150J39212_1000022 JGI25150J39212_100002296 279
164 3300003187 JGI25151J46595_10000023 JGI25151J46595_1000002347 279
165 3300003215 JGI25153J46596_10002478 JGI25153J46596_100024784 279
166 3300005327 Ga0070658_10224899 Ga0070658_102248991 279
167 3300005344 Ga0070661_100179438 Ga0070661_1001794382 279
168 3300005457 Ga0070662_100319128 Ga0070662_1003191281 279
169 3300005539 Ga0068853_100131543 Ga0068853_1001315432 279
170 3300005563 Ga0068855_100103680 Ga0068855_1001036802 279
171 3300005564 Ga0070664_100094154 Ga0070664_1000941543 279
172 3300005577 Ga0068857_100079334 Ga0068857_1000793343 279
173 3300005578 Ga0068854_100193872 Ga0068854_1001938723 279
174 3300005614 Ga0068856_100030980 Ga0068856_1000309804 279
175 3300005616 Ga0068852_100164370 Ga0068852_1001643702 279
176 3300009093 Ga0105240_10127475 Ga0105240_101274753 279
177 3300009174 Ga0105241_10005020 Ga0105241_100050209 279
178 3300009545 Ga0105237_10010486 Ga0105237_100104866 279
179 3300009551 Ga0105238_10096149 Ga0105238_100961493 279
180 3300013100 Ga0157373_10024686 Ga0157373_100246863 279
181 3300013105 Ga0157369_10137449 Ga0157369_101374492 279
182 3300025245 Ga0207425_1000038 Ga0207425_1000038180 279
183 3300025258 Ga0209129_1000036 Ga0209129_1000036180 279
184 3300025273 Ga0209673_1006398 Ga0209673_10063988 279
185 3300025294 Ga0209025_1000108 Ga0209025_1000108180 279
186 3300025297 Ga0209758_1000104 Ga0209758_100010447 279
187 3300025321 Ga0207656_10103726 Ga0207656_101037262 279
188 3300025904 Ga0207647_10075727 Ga0207647_100757272 279
189 3300025911 Ga0207654_10071661 Ga0207654_100716613 279
190 3300025914 Ga0207671_10280553 Ga0207671_102805531 279
191 3300025919 Ga0207657_10020474 Ga0207657_100204746 279
192 3300025924 Ga0207694_10108157 Ga0207694_101081573 279
193 3300025933 Ga0207706_10115238 Ga0207706_101152382 279
194 3300025949 Ga0207667_10210011 Ga0207667_102100112 279
195 3300025981 Ga0207640_10276230 Ga0207640_102762302 279
196 3300026041 Ga0207639_10001921 Ga0207639_100019215 279
197 3300026067 Ga0207678_10001505 Ga0207678_100015056 279
198 3300026078 Ga0207702_10005889 Ga0207702_1000588910 279
199 3300026116 Ga0207674_10039585 Ga0207674_100395854 279
200 3300026142 Ga0207698_10012643 Ga0207698_100126433 279
201 3300031852 Ga0307410_10008771 Ga0307410_100087716 279
202 3300031901 Ga0307406_10059798 Ga0307406_100597981 279
203 3300031911 Ga0307412_10081785 Ga0307412_100817852 279
204 3300032005 Ga0307411_10004633 Ga0307411_100046334 279
205 3300046512 Ga0495610_0003239 Ga0495610_0003239_9192_10031 279
206 3300046648 Ga0495611_0111070 Ga0495611_0111070_333_1172 279
207 3300047472 Ga0495686_0001332 Ga0495686_0001332_19792_20781 279
208 3300048919 Ga0496116_0015501 Ga0496116_0015501_5064_5969 279
209 3300048920 Ga0496117_0005956 Ga0496117_0005956_5327_6232 279
210 3300048921 Ga0496118_0034108 Ga0496118_0034108_47_952 279
211 3300048924 Ga0496121_0074142 Ga0496121_0074142_35_940 279
212 3300048925 Ga0496122_0019525 Ga0496122_0019525_79_984 279
213 3300048925 Ga0496122_0114962 Ga0496122_0114962_318_1157 279
214 3300048926 Ga0496123_0006943 Ga0496123_0006943_1644_2483 279
215 3300048927 Ga0496124_0000902 Ga0496124_0000902_62_967 279
216 3300048927 Ga0496124_0004156 Ga0496124_0004156_6938_7777 279
217 3300048927 Ga0496124_0012751 Ga0496124_0012751_455_1294 279
218 3300048928 Ga0496125_0161256 Ga0496125_0161256_197_1036 279
219 3300049551 Ga0501335_000180 Ga0501335_000180_965_1804 279
220 3300053087 Ga0500643_000887 Ga0500643_000887_690_1529 279
221 3300055283 Ga0500661_005745 Ga0500661_005745_549_1388 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

74

316

0.85

PF12146

Hydrolase_4

Serine aminopeptidase, S33

70

315

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

76

320

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a88-assembly1.cif.gz_C chloroperoxidase l 0.9793 3 279
1a88-assembly1.cif.gz_C chloroperoxidase l 0.9758 3 279
1zoi-assembly1.cif.gz_B crystal structure of a stereoselective esterase from pseudomonas putida ifo12996 0.9746 3 277
4dgq-assembly1.cif.gz_C crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia 0.974 4 279
1a8s-assembly1.cif.gz_A chloroperoxidase f/propionate complex 0.9726 3 279
ID Description Score Start End Superfamily
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9728 1 279 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9694 1 279 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9685 3 279 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9651 3 279 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9515 3 279 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A258KMV0-F1-model_v4 Alpha/beta hydrolase 0.9869 156 279 GO:0016787
AF-A0A7I6QCA6-F1-model_v4 deleted 0.9833 94 279
AF-A2WJH1-F1-model_v4 deleted 0.983 2 279
AF-A0A1A5XHV8-F1-model_v4 deleted 0.9829 3 279
AF-A8I8U0-F1-model_v4 Hydrolase 0.9828 2 279 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
93.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map