F333728

General Info

Members Datasets Scaffolds Average Seq Length
221 158 212 270

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0026177|Ga0495668_0026177_1796_2686
Length 296
Sequence MSRELALAAGPAATQVLGVISRRPVLRQWTVDAFAAQPFRGNPACVVEPFDAWPDAAWMQALAAENNQAETAFLLRTADPARFGMRWFTPLLEVPLCGHATLASCHVLFAELGVTADRIVFDTQSGPLTVARVGQGYEMDFPAQPPVKTATPPGLAEALGAEPTEVWAASYLVALFDDEATVRGLRPDIPALNRISGEATGGRGNVGIAALAKAGPHDVIDRFFAPGSGIPEDPCTGSLHCILSPLYAEKLGRPVVRFHQAYPGRGGDLECEHRGDRVLLRGQAVTMMESRLRTQT

Samples

Sample ID Description Type Environment
1 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
2 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
3 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
4 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
5 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
6 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
7 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
119 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
135 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
136 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
137 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
140 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
141 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
142 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
143 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
144 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
145 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
146 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
147 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
148 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
151 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
152 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
153 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
154 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
155 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
156 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
158 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.36
Nodule 0
Rhizoplane 1.81
Rhizosphere 69.68
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10004425 3300002067 Bacteria 4725
2 Ga0055530_10004087 3300003791 Bacteria 7783
3 Ga0055531_10013308 3300003794 Bacteria 3800
4 Ga0065165_1000622 3300005262 Bacteria 51482
5 Ga0065165_1014868 3300005262 Bacteria 3000
6 Ga0070658_10412014 3300005327 Bacteria 1161
7 Ga0070680_100015001 3300005336 Bacteria 6065
8 Ga0070660_100033684 3300005339 Bacteria 3863
9 Ga0070660_100093467 3300005339 Bacteria 2375
10 Ga0070691_10007579 3300005341 Bacteria 4977
11 Ga0070668_100017682 3300005347 Bacteria 5347
12 Ga0070669_100006843 3300005353 Bacteria 8202
13 Ga0070659_100005997 3300005366 Bacteria 8761
14 Ga0070659_100057361 3300005366 Bacteria 3071
15 Ga0070713_100151106 3300005436 Bacteria 2066
16 Ga0070663_100296358 3300005455 Bacteria 1293
17 Ga0070681_10049027 3300005458 Bacteria 4218
18 Ga0070707_100530984 3300005468 Bacteria 1139
19 Ga0070679_100115427 3300005530 Bacteria 2670
20 Ga0068853_100021540 3300005539 Bacteria 5376
21 Ga0068853_100063602 3300005539 Bacteria 3196
22 Ga0070665_100000157 3300005548 Bacteria 124344
23 Ga0068855_100049493 3300005563 Bacteria 4956
24 Ga0068855_100095109 3300005563 Bacteria 3434
25 Ga0068855_100351326 3300005563 Bacteria 1624
26 Ga0068855_100417605 3300005563 Bacteria 1468
27 Ga0068854_100047781 3300005578 Bacteria 3051
28 Ga0068856_100341278 3300005614 Bacteria 1516
29 Ga0068864_100000240 3300005618 Bacteria 49024
30 Ga0068864_100042297 3300005618 Bacteria 3899
31 Ga0068863_100000091 3300005841 Bacteria 98724
32 Ga0068858_100000059 3300005842 Bacteria 117158
33 Ga0068858_100092754 3300005842 Bacteria 2811
34 Ga0081455_10008230 3300005937 Bacteria 10869
35 Ga0075368_10012454 3300006042 Bacteria 3109
36 Ga0075364_10016543 3300006051 Bacteria 4590
37 Ga0075367_10004645 3300006178 Bacteria 6730
38 Ga0075366_10043133 3300006195 Bacteria 2672
39 Ga0075370_10003795 3300006353 Bacteria 7234
40 Ga0075433_10025909 3300006852 Bacteria 4960
41 Ga0105240_10014348 3300009093 Bacteria 10820
42 Ga0105240_10024868 3300009093 Bacteria 7884
43 Ga0105240_10072859 3300009093 Bacteria 4244
44 Ga0105240_10165485 3300009093 Bacteria 2623
45 Ga0105240_10277367 3300009093 Bacteria 1927
46 Ga0105247_10287071 3300009101 Bacteria 1137
47 Ga0114129_10199287 3300009147 Bacteria 2712
48 Ga0105248_10008739 3300009177 Bacteria 11126
49 Ga0105238_10037112 3300009551 Bacteria 4955
50 Ga0105238_10265931 3300009551 Bacteria 1695
51 Ga0105239_10144564 3300010375 Bacteria 2652
52 Ga0105239_10537512 3300010375 Unclassified 1331
53 Ga0157373_10001590 3300013100 Bacteria 17352
54 Ga0157373_10001595 3300013100 Bacteria 17324
55 Ga0157369_10312071 3300013105 Bacteria 1635
56 Ga0163162_10162940 3300013306 Bacteria 2352
57 Ga0163163_10012682 3300014325 Bacteria 7687
58 Ga0157379_10010684 3300014968 Bacteria 7998
59 Ga0163161_10110671 3300017792 Bacteria 2053
60 Ga0163161_10330855 3300017792 Bacteria 1206
61 Ga0213872_10017382 3300021361 Bacteria 3325
62 Ga0213874_10044716 3300021377 Bacteria 1338
63 Ga0213876_10000313 3300021384 Bacteria 42627
64 Ga0213876_10010782 3300021384 Bacteria 4896
65 Ga0209026_1001558 3300025250 Bacteria 9925
66 Ga0209758_1002206 3300025297 Bacteria 20321
67 Ga0209050_1000073 3300025298 Bacteria 292046
68 Ga0209257_1000099 3300025304 Bacteria 255304
69 Ga0209257_1016637 3300025304 Bacteria 2960
70 Ga0207692_10204099 3300025898 Bacteria 1164
71 Ga0207680_10044872 3300025903 Bacteria 2603
72 Ga0207705_10007169 3300025909 Bacteria 8213
73 Ga0207705_10208648 3300025909 Bacteria 1481
74 Ga0207705_10305576 3300025909 Bacteria 1220
75 Ga0207707_10016990 3300025912 Bacteria 6339
76 Ga0207707_10017955 3300025912 Bacteria 6167
77 Ga0207707_10058542 3300025912 Bacteria 3353
78 Ga0207695_10000321 3300025913 Bacteria 116087
79 Ga0207695_10001284 3300025913 Bacteria 42684
80 Ga0207695_10003699 3300025913 Bacteria 21313
81 Ga0207695_10029404 3300025913 Bacteria 6073
82 Ga0207695_10055869 3300025913 Bacteria 4112
83 Ga0207660_10005833 3300025917 Bacteria 7992
84 Ga0207660_10038114 3300025917 Bacteria 3354
85 Ga0207657_10023903 3300025919 Bacteria 5675
86 Ga0207657_10027969 3300025919 Bacteria 5153
87 Ga0207657_10105468 3300025919 Bacteria 2333
88 Ga0207652_10008638 3300025921 Bacteria 8198
89 Ga0207646_10195691 3300025922 Bacteria 1826
90 Ga0207681_10026755 3300025923 Unclassified 3724
91 Ga0207694_10087930 3300025924 Bacteria 2449
92 Ga0207694_10093008 3300025924 Bacteria 2381
93 Ga0207690_10000196 3300025932 Bacteria 47111
94 Ga0207711_10145797 3300025941 Bacteria 2133
95 Ga0207711_10271971 3300025941 Bacteria 1559
96 Ga0207667_10024791 3300025949 Bacteria 6578
97 Ga0207667_10068925 3300025949 Bacteria 3682
98 Ga0207667_10203350 3300025949 Bacteria 2031
99 Ga0207667_10303467 3300025949 Bacteria 1631
100 Ga0207667_10520638 3300025949 Bacteria 1205
101 Ga0207703_10000049 3300026035 Bacteria 149817
102 Ga0207703_10074903 3300026035 Bacteria 2804
103 Ga0207639_10037333 3300026041 Bacteria 3608
104 Ga0207639_10191697 3300026041 Bacteria 1746
105 Ga0207678_10484666 3300026067 Bacteria 1077
106 Ga0207641_10000011 3300026088 Bacteria 384362
107 Ga0207676_10000117 3300026095 Bacteria 69834
108 Ga0207676_10197932 3300026095 Bacteria 1773
109 Ga0207698_10432382 3300026142 Bacteria 1266
110 Ga0209983_1020779 3300027665 Bacteria 1370
111 Ga0209813_10006096 3300027866 Bacteria 2963
112 Ga0268266_10000003 3300028379 Bacteria 1701703
113 Ga0268266_10081030 3300028379 Bacteria 2829
114 Ga0307517_10053332 3300028786 Bacteria 4029
115 Ga0265338_10079207 3300028800 Bacteria 2766
116 Ga0265338_10199153 3300028800 Bacteria 1511
117 Ga0307412_10010129 3300031911 Bacteria 5422
118 Ga0307411_10074964 3300032005 Bacteria 2308
119 Ga0373935_0040768 3300035692 Bacteria 2915
120 Ga0395899_0000016 3300037312 Bacteria 468322
121 Ga0395899_0000052 3300037312 Bacteria 221643
122 Ga0395900_0000002 3300037418 Bacteria 671103
123 Ga0395900_0017845 3300037418 Bacteria 7243
124 Ga0395898_0115196 3300037466 Bacteria 2575
125 Ga0395898_0171426 3300037466 Bacteria 2074
126 Ga0395898_0584298 3300037466 Bacteria 1059
127 Ga0395905_0011245 3300037471 Bacteria 8653
128 Ga0395905_0017007 3300037471 Bacteria 6904
129 Ga0395905_0071383 3300037471 Bacteria 3255
130 Ga0436364_0818440 3300037853 Bacteria 9085
131 Ga0395901_0000013 3300038443 Bacteria 375733
132 Ga0395901_0110241 3300038443 Bacteria 2890
133 Ga0395901_0160838 3300038443 Bacteria 2358
134 Ga0436365_1256087 3300039437 Bacteria 5026
135 Ga0436365_1505547 3300039437 Bacteria 55840
136 Ga0436361_0257131 3300039447 Bacteria 5276
137 Ga0436361_0469396 3300039447 Bacteria 1720
138 Ga0436363_0800026 3300039450 Bacteria 1338
139 Ga0451577_0056424 3300042876 Bacteria 3503
140 Ga0466966_0033307 3300044684 Bacteria 3337
141 Ga0453684_0269339 3300044712 Bacteria 1947
142 Ga0466959_0065621 3300045049 Bacteria 2634
143 Ga0466958_0222303 3300045836 Bacteria 1205
144 Ga0495629_0007070 3300046459 Bacteria 8270
145 Ga0495638_0006356 3300046460 Bacteria 8604
146 Ga0495585_0100670 3300046492 Bacteria 1546
147 Ga0495610_0009303 3300046512 Bacteria 6226
148 Ga0495610_0116632 3300046512 Bacteria 1176
149 Ga0495643_0015235 3300046522 Bacteria 4550
150 Ga0495642_0039536 3300046528 Bacteria 1914
151 Ga0495654_0029219 3300046530 Bacteria 2812
152 Ga0495597_0001511 3300046542 Bacteria 16580
153 Ga0495622_0002106 3300046557 Bacteria 9709
154 Ga0495668_0026177 3300046616 Bacteria 3312
155 Ga0495668_0162393 3300046616 Bacteria 1224
156 Ga0495625_0130342 3300046660 Bacteria 1704
157 Ga0495649_0000631 3300046694 Bacteria 28705
158 Ga0495686_0017852 3300047472 Bacteria 4772
159 Ga0496115_0001520 3300048918 Bacteria 16684
160 Ga0496115_0001630 3300048918 Bacteria 16158
161 Ga0496115_0062724 3300048918 Bacteria 2999
162 Ga0496115_0073085 3300048918 Bacteria 2783
163 Ga0496117_0013304 3300048920 Bacteria 7188
164 Ga0496119_0006503 3300048922 Bacteria 10792
165 Ga0496121_0000035 3300048924 Bacteria 374316
166 Ga0495678_004705 3300049459 Bacteria 7798
167 Ga0495682_0139806 3300049460 Bacteria 865
168 Ga0501047_0002849 3300049581 Bacteria 16399
169 Ga0501070_0015780 3300049586 Bacteria 6352
170 Ga0501080_0039176 3300049742 Bacteria 4423
171 Ga0501035_0261376 3300049822 Bacteria 1467
172 Ga0501035_0765233 3300049822 Unclassified 774
173 Ga0501045_0467642 3300049824 Bacteria 937
174 nmdc:mga00v17_1974_c1 3300050491 Bacteria 10602
175 nmdc:mga0k408_45013_c1 3300050493 Bacteria 2546
176 nmdc:mga04h51_4869_c1 3300050495 Bacteria 3378
177 nmdc:mga07m45_1245_c1 3300050496 Bacteria 11555
178 nmdc:mga07m45_8298_c1 3300050496 Bacteria 5333
179 nmdc:mga05p37_266750_c1 3300050507 Bacteria 2047
180 nmdc:mga06r32_118058_c1 3300050510 Bacteria 2615
181 nmdc:mga06r32_134802_c1 3300050510 Bacteria 2444
182 nmdc:mga06r32_924659_c1 3300050510 Bacteria 828
183 nmdc:mga08y16_84106_c1 3300050511 Bacteria 3317
184 nmdc:mga0rr50_434097_c1 3300050513 Archaea 1112
185 nmdc:mga0a205_41761_c1 3300050515 Bacteria 3491
186 nmdc:mga0a205_88900_c1 3300050515 Bacteria 2986
187 Ga0500635_0000049 3300053080 Bacteria 80019
188 Ga0500578_0000895 3300053086 Bacteria 33760
189 Ga0500646_0020403 3300053090 Bacteria 1761
190 Ga0500583_0147226 3300053092 Bacteria 1172
191 Ga0500651_0018593 3300053093 Bacteria 4304
192 Ga0500566_0049786 3300053094 Bacteria 2400
193 Ga0500641_0085157 3300053096 Bacteria 1345
194 Ga0500555_064461 3300053103 Bacteria 978
195 Ga0500556_0003800 3300053104 Bacteria 4378
196 Ga0500562_014158 3300053108 Bacteria 2042
197 Ga0500569_000436 3300053109 Bacteria 6803
198 Ga0500594_0000062 3300053118 Bacteria 33367
199 Ga0500595_003495 3300053119 Bacteria 7310
200 Ga0500614_001630 3300053123 Bacteria 5291
201 Ga0500642_0048581 3300053130 Bacteria 1864
202 Ga0500559_0013445 3300053136 Bacteria 3467
203 Ga0500590_020113 3300053148 Bacteria 3462
204 Ga0500620_022449 3300053155 Bacteria 1900
205 Ga0500624_001772 3300053157 Bacteria 3159
206 Ga0500638_021656 3300053162 Bacteria 3040
207 Ga0500636_0023285 3300053177 Bacteria 3662
208 Ga0500636_0046668 3300053177 Bacteria 2554
209 Ga0500637_0012727 3300053178 Bacteria 4393
210 Ga0500576_063939 3300053725 Bacteria 1601
211 Ga0500645_003533 3300053730 Bacteria 6313
212 Ga0500596_002041 3300053735 Bacteria 4038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0469396 Ga0436361_0469396_991_1704 219
2 3300049460 Ga0495682_0139806 Ga0495682_0139806_22_741 222
3 3300053103 Ga0500555_064461 Ga0500555_064461_18_737 222
4 3300046660 Ga0495625_0130342 Ga0495625_0130342_58_780 223
5 3300049822 Ga0501035_0765233 Ga0501035_0765233_53_754 225
6 3300050511 nmdc:mga08y16_84106_c1 nmdc:mga08y16_84106_c1_2472_3287 226
7 3300026142 Ga0207698_10432382 Ga0207698_104323821 235
8 3300005341 Ga0070691_10007579 Ga0070691_100075796 241
9 3300005530 Ga0070679_100115427 Ga0070679_1001154273 241
10 3300005578 Ga0068854_100047781 Ga0068854_1000477813 241
11 3300025912 Ga0207707_10058542 Ga0207707_100585423 241
12 3300025913 Ga0207695_10000321 Ga0207695_1000032167 241
13 3300025917 Ga0207660_10038114 Ga0207660_100381141 241
14 3300009093 Ga0105240_10072859 Ga0105240_100728593 242
15 3300005347 Ga0070668_100017682 Ga0070668_1000176826 244
16 3300050510 nmdc:mga06r32_924659_c1 nmdc:mga06r32_924659_c1_44_814 245
17 iso_pu_bacteria 2917736166 2917740983 245
18 iso_pu_bacteria 2795385470 2795781380 246
19 iso_pu_bacteria 2929177148 2929181277 246
20 iso_pu_bacteria 2945977869 2945983681 246
21 iso_pu_bacteria 2946013367 2946016909 246
22 iso_pu_bacteria 2786546940 2788433446 248
23 3300010375 Ga0105239_10537512 Ga0105239_105375121 249
24 iso_pu_bacteria 2643221699 2644551245 249
25 iso_pu_bacteria 2643221574 2643883983 250
26 iso_pu_bacteria 2643221699 2644552522 250
27 3300005468 Ga0070707_100530984 Ga0070707_1005309842 251
28 3300021361 Ga0213872_10017382 Ga0213872_100173823 251
29 3300025898 Ga0207692_10204099 Ga0207692_102040992 251
30 3300025922 Ga0207646_10195691 Ga0207646_101956912 251
31 3300037312 Ga0395899_0000016 Ga0395899_0000016_272331_273143 251
32 3300039447 Ga0436361_0257131 Ga0436361_0257131_627_1439 251
33 3300044684 Ga0466966_0033307 Ga0466966_0033307_1737_2549 251
34 3300045049 Ga0466959_0065621 Ga0466959_0065621_148_960 251
35 3300045836 Ga0466958_0222303 Ga0466958_0222303_209_1021 251
36 3300048918 Ga0496115_0062724 Ga0496115_0062724_384_1196 251
37 3300005366 Ga0070659_100057361 Ga0070659_1000573612 252
38 3300026041 Ga0207639_10191697 Ga0207639_101916972 252
39 3300028800 Ga0265338_10199153 Ga0265338_101991532 252
40 3300005262 Ga0065165_1014868 Ga0065165_10148683 253
41 3300005436 Ga0070713_100151106 Ga0070713_1001511062 253
42 3300017792 Ga0163161_10330855 Ga0163161_103308552 253
43 3300028786 Ga0307517_10053332 Ga0307517_100533323 253
44 3300032005 Ga0307411_10074964 Ga0307411_100749642 253
45 3300046512 Ga0495610_0116632 Ga0495610_0116632_12_824 253
46 3300046528 Ga0495642_0039536 Ga0495642_0039536_951_1769 253
47 3300046616 Ga0495668_0162393 Ga0495668_0162393_75_890 253
48 3300046694 Ga0495649_0000631 Ga0495649_0000631_27400_28212 253
49 3300047472 Ga0495686_0017852 Ga0495686_0017852_833_1648 253
50 3300049581 Ga0501047_0002849 Ga0501047_0002849_12095_12910 253
51 3300053096 Ga0500641_0085157 Ga0500641_0085157_369_1184 253
52 3300053108 Ga0500562_014158 Ga0500562_014158_124_939 253
53 3300003791 Ga0055530_10004087 Ga0055530_100040874 254
54 3300003794 Ga0055531_10013308 Ga0055531_100133083 254
55 3300005262 Ga0065165_1000622 Ga0065165_100062217 254
56 3300005327 Ga0070658_10412014 Ga0070658_104120141 254
57 3300005339 Ga0070660_100033684 Ga0070660_1000336841 254
58 3300005339 Ga0070660_100093467 Ga0070660_1000934673 254
59 3300005353 Ga0070669_100006843 Ga0070669_1000068436 254
60 3300005366 Ga0070659_100005997 Ga0070659_1000059977 254
61 3300005455 Ga0070663_100296358 Ga0070663_1002963582 254
62 3300005458 Ga0070681_10049027 Ga0070681_100490272 254
63 3300005539 Ga0068853_100021540 Ga0068853_1000215405 254
64 3300005539 Ga0068853_100063602 Ga0068853_1000636023 254
65 3300005548 Ga0070665_100000157 Ga0070665_10000015790 254
66 3300005563 Ga0068855_100095109 Ga0068855_1000951093 254
67 3300005563 Ga0068855_100351326 Ga0068855_1003513262 254
68 3300005563 Ga0068855_100417605 Ga0068855_1004176052 254
69 3300005614 Ga0068856_100341278 Ga0068856_1003412782 254
70 3300005618 Ga0068864_100000240 Ga0068864_10000024022 254
71 3300005841 Ga0068863_100000091 Ga0068863_10000009124 254
72 3300005842 Ga0068858_100000059 Ga0068858_10000005999 254
73 3300006042 Ga0075368_10012454 Ga0075368_100124543 254
74 3300006051 Ga0075364_10016543 Ga0075364_100165435 254
75 3300006178 Ga0075367_10004645 Ga0075367_100046455 254
76 3300006195 Ga0075366_10043133 Ga0075366_100431334 254
77 3300006353 Ga0075370_10003795 Ga0075370_100037954 254
78 3300009093 Ga0105240_10014348 Ga0105240_100143487 254
79 3300009093 Ga0105240_10024868 Ga0105240_100248686 254
80 3300009093 Ga0105240_10165485 Ga0105240_101654852 254
81 3300009101 Ga0105247_10287071 Ga0105247_102870712 254
82 3300009177 Ga0105248_10008739 Ga0105248_100087396 254
83 3300009551 Ga0105238_10037112 Ga0105238_100371124 254
84 3300009551 Ga0105238_10265931 Ga0105238_102659313 254
85 3300013100 Ga0157373_10001590 Ga0157373_100015907 254
86 3300013100 Ga0157373_10001595 Ga0157373_100015957 254
87 3300013306 Ga0163162_10162940 Ga0163162_101629403 254
88 3300014325 Ga0163163_10012682 Ga0163163_100126825 254
89 3300014968 Ga0157379_10010684 Ga0157379_100106846 254
90 3300021377 Ga0213874_10044716 Ga0213874_100447162 254
91 3300021384 Ga0213876_10000313 Ga0213876_1000031314 254
92 3300021384 Ga0213876_10010782 Ga0213876_100107824 254
93 3300025250 Ga0209026_1001558 Ga0209026_10015584 254
94 3300025297 Ga0209758_1002206 Ga0209758_100220614 254
95 3300025298 Ga0209050_1000073 Ga0209050_1000073199 254
96 3300025304 Ga0209257_1000099 Ga0209257_100009997 254
97 3300025304 Ga0209257_1016637 Ga0209257_10166373 254
98 3300025909 Ga0207705_10007169 Ga0207705_100071699 254
99 3300025909 Ga0207705_10305576 Ga0207705_103055761 254
100 3300025912 Ga0207707_10016990 Ga0207707_100169906 254
101 3300025913 Ga0207695_10001284 Ga0207695_100012846 254
102 3300025913 Ga0207695_10003699 Ga0207695_100036996 254
103 3300025913 Ga0207695_10055869 Ga0207695_100558694 254
104 3300025917 Ga0207660_10005833 Ga0207660_100058336 254
105 3300025919 Ga0207657_10023903 Ga0207657_100239036 254
106 3300025919 Ga0207657_10027969 Ga0207657_100279693 254
107 3300025919 Ga0207657_10105468 Ga0207657_101054683 254
108 3300025921 Ga0207652_10008638 Ga0207652_100086383 254
109 3300025923 Ga0207681_10026755 Ga0207681_100267551 254
110 3300025924 Ga0207694_10087930 Ga0207694_100879302 254
111 3300025924 Ga0207694_10093008 Ga0207694_100930081 254
112 3300025932 Ga0207690_10000196 Ga0207690_100001966 254
113 3300025941 Ga0207711_10145797 Ga0207711_101457972 254
114 3300025941 Ga0207711_10271971 Ga0207711_102719712 254
115 3300025949 Ga0207667_10024791 Ga0207667_100247911 254
116 3300025949 Ga0207667_10068925 Ga0207667_100689254 254
117 3300025949 Ga0207667_10303467 Ga0207667_103034672 254
118 3300025949 Ga0207667_10520638 Ga0207667_105206382 254
119 3300026035 Ga0207703_10000049 Ga0207703_10000049105 254
120 3300026041 Ga0207639_10037333 Ga0207639_100373333 254
121 3300026067 Ga0207678_10484666 Ga0207678_104846662 254
122 3300026088 Ga0207641_10000011 Ga0207641_10000011237 254
123 3300026095 Ga0207676_10000117 Ga0207676_1000011728 254
124 3300027665 Ga0209983_1020779 Ga0209983_10207792 254
125 3300027866 Ga0209813_10006096 Ga0209813_100060963 254
126 3300028379 Ga0268266_10000003 Ga0268266_100000031673 254
127 3300028800 Ga0265338_10079207 Ga0265338_100792072 254
128 3300031911 Ga0307412_10010129 Ga0307412_100101293 254
129 3300035692 Ga0373935_0040768 Ga0373935_0040768_1442_2260 254
130 3300037312 Ga0395899_0000052 Ga0395899_0000052_165675_166493 254
131 3300037418 Ga0395900_0000002 Ga0395900_0000002_535974_536792 254
132 3300037466 Ga0395898_0115196 Ga0395898_0115196_1159_1983 254
133 3300037466 Ga0395898_0171426 Ga0395898_0171426_410_1228 254
134 3300037471 Ga0395905_0017007 Ga0395905_0017007_3710_4528 254
135 3300038443 Ga0395901_0000013 Ga0395901_0000013_166993_167811 254
136 3300038443 Ga0395901_0160838 Ga0395901_0160838_481_1353 254
137 3300039437 Ga0436365_1256087 Ga0436365_1256087_3937_4755 254
138 3300046459 Ga0495629_0007070 Ga0495629_0007070_4515_5333 254
139 3300046522 Ga0495643_0015235 Ga0495643_0015235_3110_3928 254
140 3300046530 Ga0495654_0029219 Ga0495654_0029219_751_1569 254
141 3300046542 Ga0495597_0001511 Ga0495597_0001511_6437_7255 254
142 3300046557 Ga0495622_0002106 Ga0495622_0002106_3690_4508 254
143 3300048918 Ga0496115_0001520 Ga0496115_0001520_6994_7812 254
144 3300048918 Ga0496115_0073085 Ga0496115_0073085_1394_2212 254
145 3300048920 Ga0496117_0013304 Ga0496117_0013304_1198_2016 254
146 3300048922 Ga0496119_0006503 Ga0496119_0006503_2745_3563 254
147 3300048924 Ga0496121_0000035 Ga0496121_0000035_216668_217486 254
148 3300050491 nmdc:mga00v17_1974_c1 nmdc:mga00v17_1974_c1_801_1619 254
149 3300050493 nmdc:mga0k408_45013_c1 nmdc:mga0k408_45013_c1_864_1682 254
150 3300050495 nmdc:mga04h51_4869_c1 nmdc:mga04h51_4869_c1_1856_2674 254
151 3300050496 nmdc:mga07m45_1245_c1 nmdc:mga07m45_1245_c1_6294_7112 254
152 3300050496 nmdc:mga07m45_8298_c1 nmdc:mga07m45_8298_c1_4000_4818 254
153 3300053080 Ga0500635_0000049 Ga0500635_0000049_35414_36232 254
154 3300053090 Ga0500646_0020403 Ga0500646_0020403_89_907 254
155 3300053092 Ga0500583_0147226 Ga0500583_0147226_57_875 254
156 3300053093 Ga0500651_0018593 Ga0500651_0018593_3203_4021 254
157 3300053094 Ga0500566_0049786 Ga0500566_0049786_970_1788 254
158 3300053104 Ga0500556_0003800 Ga0500556_0003800_314_1132 254
159 3300053109 Ga0500569_000436 Ga0500569_000436_3792_4610 254
160 3300053119 Ga0500595_003495 Ga0500595_003495_759_1577 254
161 3300053123 Ga0500614_001630 Ga0500614_001630_277_1095 254
162 3300053130 Ga0500642_0048581 Ga0500642_0048581_580_1398 254
163 3300053136 Ga0500559_0013445 Ga0500559_0013445_1291_2109 254
164 3300053148 Ga0500590_020113 Ga0500590_020113_2191_3009 254
165 3300053155 Ga0500620_022449 Ga0500620_022449_1008_1826 254
166 3300053157 Ga0500624_001772 Ga0500624_001772_1293_2111 254
167 3300053162 Ga0500638_021656 Ga0500638_021656_1579_2397 254
168 3300053177 Ga0500636_0023285 Ga0500636_0023285_1189_2007 254
169 3300053177 Ga0500636_0046668 Ga0500636_0046668_1594_2412 254
170 3300053178 Ga0500637_0012727 Ga0500637_0012727_1247_2065 254
171 3300053725 Ga0500576_063939 Ga0500576_063939_259_1077 254
172 3300053730 Ga0500645_003533 Ga0500645_003533_3753_4574 254
173 3300053735 Ga0500596_002041 Ga0500596_002041_2358_3176 254
174 3300005336 Ga0070680_100015001 Ga0070680_1000150015 255
175 3300005563 Ga0068855_100049493 Ga0068855_1000494937 255
176 3300005618 Ga0068864_100042297 Ga0068864_1000422974 255
177 3300005842 Ga0068858_100092754 Ga0068858_1000927544 255
178 3300009093 Ga0105240_10277367 Ga0105240_102773673 255
179 3300025903 Ga0207680_10044872 Ga0207680_100448721 255
180 3300025909 Ga0207705_10208648 Ga0207705_102086482 255
181 3300025912 Ga0207707_10017955 Ga0207707_100179552 255
182 3300025913 Ga0207695_10029404 Ga0207695_100294043 255
183 3300025949 Ga0207667_10203350 Ga0207667_102033503 255
184 3300026035 Ga0207703_10074903 Ga0207703_100749034 255
185 3300026095 Ga0207676_10197932 Ga0207676_101979323 255
186 3300028379 Ga0268266_10081030 Ga0268266_100810304 255
187 3300037418 Ga0395900_0017845 Ga0395900_0017845_5676_6497 255
188 3300037466 Ga0395898_0584298 Ga0395898_0584298_218_1039 255
189 3300037471 Ga0395905_0011245 Ga0395905_0011245_6576_7397 255
190 3300037471 Ga0395905_0071383 Ga0395905_0071383_664_1485 255
191 3300038443 Ga0395901_0110241 Ga0395901_0110241_1187_2008 255
192 3300046460 Ga0495638_0006356 Ga0495638_0006356_2623_3444 255
193 3300046492 Ga0495585_0100670 Ga0495585_0100670_694_1515 255
194 3300046512 Ga0495610_0009303 Ga0495610_0009303_4985_5806 255
195 3300046616 Ga0495668_0026177 Ga0495668_0026177_1796_2686 255
196 3300048918 Ga0496115_0001630 Ga0496115_0001630_6208_7041 255
197 3300049459 Ga0495678_004705 Ga0495678_004705_4474_5295 255
198 3300053086 Ga0500578_0000895 Ga0500578_0000895_2748_3569 255
199 3300053118 Ga0500594_0000062 Ga0500594_0000062_29954_30775 255
200 3300010375 Ga0105239_10144564 Ga0105239_101445643 256
201 3300013105 Ga0157369_10312071 Ga0157369_103120712 256
202 3300037853 Ga0436364_0818440 Ga0436364_0818440_5669_6502 256
203 3300039437 Ga0436365_1505547 Ga0436365_1505547_31125_31958 256
204 3300039450 Ga0436363_0800026 Ga0436363_0800026_312_1145 256
205 3300049586 Ga0501070_0015780 Ga0501070_0015780_1439_2239 256
206 3300049742 Ga0501080_0039176 Ga0501080_0039176_2484_3284 256
207 3300049822 Ga0501035_0261376 Ga0501035_0261376_207_1007 256
208 3300005937 Ga0081455_10008230 Ga0081455_100082304 258
209 3300009147 Ga0114129_10199287 Ga0114129_101992873 258
210 3300017792 Ga0163161_10110671 Ga0163161_101106712 258
211 3300049824 Ga0501045_0467642 Ga0501045_0467642_113_922 258
212 3300050507 nmdc:mga05p37_266750_c1 nmdc:mga05p37_266750_c1_854_1663 258
213 3300050510 nmdc:mga06r32_118058_c1 nmdc:mga06r32_118058_c1_981_1790 258
214 3300050510 nmdc:mga06r32_134802_c1 nmdc:mga06r32_134802_c1_591_1400 258
215 3300050513 nmdc:mga0rr50_434097_c1 nmdc:mga0rr50_434097_c1_149_958 258
216 3300050515 nmdc:mga0a205_88900_c1 nmdc:mga0a205_88900_c1_2017_2826 258
217 3300006852 Ga0075433_10025909 Ga0075433_100259094 260
218 3300042876 Ga0451577_0056424 Ga0451577_0056424_1116_1979 260
219 3300044712 Ga0453684_0269339 Ga0453684_0269339_278_1141 260
220 3300050515 nmdc:mga0a205_41761_c1 nmdc:mga0a205_41761_c1_234_1058 260
221 3300002067 JGI24735J21928_10004425 JGI24735J21928_100044256 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

31

290

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.9047 1 267
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.9015 1 267
1u1x-assembly1.cif.gz_B structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 0.8733 1 267
4dun-assembly1.cif.gz_A-2 1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630) 0.8664 3 267
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8618 1 267
ID Description Score Start End Superfamily
af_F4JHW1_176_307_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9759 136 259 3.10.310.10
af_K7LH11_163_288_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9643 149 259 3.10.310.10
af_A0A1P8ARL5_195_308_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9642 153 259 3.10.310.10
af_B6U0C2_164_278_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9615 140 248 3.10.310.10
1s7jB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9591 124 255 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7X5W2D9-F1-model_v4 deleted 0.9899 152 255
AF-A0A7X5W2D9-F1-model_v4 deleted 0.9804 152 255
AF-A0A7W3NGK3-F1-model_v4 Putative PhzF superfamily epimerase YddE/YHI9 0.9747 138 259 GO:0005737
GO:0009058
GO:0016853
AF-A0A4Z0H8Q2-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9726 4 267 GO:0005737
GO:0009058
GO:0016853
AF-A0A7V2X8L5-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9713 146 267 GO:0005737
GO:0009058
GO:0016853

Feature Viewer

pLDDT pTM Quality
93.88 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map