F333610

General Info

Members Datasets Scaffolds Average Seq Length
221 172 442 155

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0583521|Ga0436361_0583521_16597_17097
Length 166
Sequence LKNKTLKNKLRSQLEKRIMNTMDIHQILKTLPHRYPFLLVDRVLELEKGKRIRALKNVAINEPHFTGHFPHRPVMPGVLILETMAQAASILALISGDTQLDDQTICYFAGIDGARFKRPVEPGDQLVMEITLDRAKASIYKFTAKAYVGEELACEAELMCTMRRIE

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
114 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
144 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
145 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
172 2831864461 Roseateles noduli HZ7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 1.81
Rhizoplane 1.81
Rhizosphere 80.09
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0583521 3300039447 Bacteria 71514
2 rootH1_10014365 3300003323 Bacteria 11364
3 rootH1_10200848 3300003323 Bacteria 4418
4 JGI26128J50194_1000360 3300003347 Bacteria 2398
5 Ga0055526_1000724 3300003771 Bacteria 24927
6 Ga0055524_1009570 3300003775 Bacteria 3926
7 Ga0055530_10057663 3300003791 Bacteria 877
8 Ga0055540_1062255 3300003792 Bacteria 743
9 Ga0055531_10003495 3300003794 Bacteria 9993
10 Ga0055531_10012045 3300003794 Bacteria 4104
11 Ga0065714_10147748 3300005288 Bacteria 1126
12 Ga0065704_10156275 3300005289 Bacteria 1388
13 Ga0065712_10381094 3300005290 Bacteria 752
14 Ga0065715_10004063 3300005293 Bacteria 3924
15 Ga0065715_10134847 3300005293 Bacteria 1948
16 Ga0065707_10104527 3300005295 Bacteria 2680
17 Ga0070676_10141555 3300005328 Bacteria 1532
18 Ga0070670_100014093 3300005331 Bacteria 6858
19 Ga0068869_100402266 3300005334 Bacteria 1126
20 Ga0070680_100221065 3300005336 Bacteria 1599
21 Ga0068868_100834932 3300005338 Bacteria 834
22 Ga0070689_100585969 3300005340 Bacteria 964
23 Ga0070687_100275320 3300005343 Bacteria 1057
24 Ga0070668_100762455 3300005347 Bacteria 857
25 Ga0070675_100522346 3300005354 Bacteria 1071
26 Ga0070673_100641500 3300005364 Bacteria 971
27 Ga0070703_10001592 3300005406 Bacteria 6743
28 Ga0070709_10000007 3300005434 Bacteria 182605
29 Ga0070705_100182764 3300005440 Bacteria 1422
30 Ga0070694_100165947 3300005444 Bacteria 1624
31 Ga0070694_100243676 3300005444 Bacteria 1357
32 Ga0070708_100300005 3300005445 Bacteria 1513
33 Ga0070663_100148785 3300005455 Bacteria 1794
34 Ga0068867_100170768 3300005459 Bacteria 1722
35 Ga0068867_100515615 3300005459 Bacteria 1030
36 Ga0068867_100985490 3300005459 Bacteria 763
37 Ga0070706_100000037 3300005467 Bacteria 150693
38 Ga0070706_100270494 3300005467 Bacteria 1586
39 Ga0070706_101128592 3300005467 Bacteria 721
40 Ga0070707_100011248 3300005468 Bacteria 8342
41 Ga0070699_100000047 3300005518 Bacteria 122138
42 Ga0070699_100068362 3300005518 Bacteria 3085
43 Ga0070684_100109392 3300005535 Bacteria 2477
44 Ga0068853_100195799 3300005539 Bacteria 1838
45 Ga0070672_100010804 3300005543 Bacteria 6345
46 Ga0070696_100003308 3300005546 Bacteria 10763
47 Ga0070693_100003445 3300005547 Bacteria 7379
48 Ga0070665_101191030 3300005548 Bacteria 773
49 Ga0070704_100051617 3300005549 Bacteria 2897
50 Ga0070704_100244944 3300005549 Bacteria 1469
51 Ga0068854_100554449 3300005578 Bacteria 975
52 Ga0068856_100054034 3300005614 Bacteria 3961
53 Ga0068852_100927551 3300005616 Bacteria 888
54 Ga0068852_101237033 3300005616 Bacteria 768
55 Ga0068861_101124060 3300005719 Bacteria 756
56 Ga0068851_10273428 3300005834 Bacteria 964
57 Ga0068870_10130937 3300005840 Bacteria 1457
58 Ga0068863_100130636 3300005841 Bacteria 2398
59 Ga0068862_100242807 3300005844 Bacteria 1638
60 Ga0075366_10054866 3300006195 Bacteria 2367
61 Ga0075366_10208636 3300006195 Bacteria 1189
62 Ga0075370_10184369 3300006353 Bacteria 1229
63 Ga0075370_10473571 3300006353 Bacteria 755
64 Ga0075428_100000762 3300006844 Bacteria 33461
65 Ga0075430_100423469 3300006846 Bacteria 1099
66 Ga0075433_10133988 3300006852 Bacteria 2202
67 Ga0075434_101154625 3300006871 Bacteria 787
68 Ga0075436_100426848 3300006914 Bacteria 963
69 Ga0099824_1035836 3300006942 Bacteria 1482
70 Ga0099823_1000189 3300006944 Bacteria 34151
71 Ga0105244_10181104 3300009036 Bacteria 999
72 Ga0105240_10178138 3300009093 Bacteria 2511
73 Ga0105240_10415659 3300009093 Bacteria 1512
74 Ga0111539_10018817 3300009094 Bacteria 8546
75 Ga0111539_10036400 3300009094 Bacteria 5951
76 Ga0111539_10165981 3300009094 Bacteria 2581
77 Ga0105245_10044061 3300009098 Bacteria 3982
78 Ga0105245_10996656 3300009098 Bacteria 882
79 Ga0105247_10107329 3300009101 Bacteria 1793
80 Ga0114129_10027300 3300009147 Bacteria 8083
81 Ga0114129_10028458 3300009147 Bacteria 7919
82 Ga0105241_10125562 3300009174 Bacteria 2071
83 Ga0105248_10000003 3300009177 Bacteria 1019601
84 Ga0105248_11251380 3300009177 Bacteria 839
85 Ga0105239_10184563 3300010375 Bacteria 2334
86 Ga0157371_10561758 3300013102 Bacteria 846
87 Ga0157378_10323196 3300013297 Bacteria 1499
88 Ga0163162_10186772 3300013306 Bacteria 2200
89 Ga0157380_10003248 3300014326 Bacteria 11129
90 Ga0157380_11609533 3300014326 Bacteria 705
91 Ga0157376_10011880 3300014969 Bacteria 6438
92 Ga0157376_10134357 3300014969 Bacteria 2212
93 Ga0213872_10000004 3300021361 Bacteria 306230
94 Ga0213872_10072507 3300021361 Bacteria 1551
95 Ga0213876_10068868 3300021384 Bacteria 1869
96 Ga0213875_10000090 3300021388 Bacteria 105400
97 Ga0209673_1018645 3300025273 Bacteria 2516
98 Ga0209564_1000003 3300025295 Bacteria 1585848
99 Ga0209050_1004871 3300025298 Bacteria 8799
100 Ga0209256_1001948 3300025299 Bacteria 18746
101 Ga0209051_1002175 3300025303 Bacteria 14534
102 Ga0209257_1001742 3300025304 Bacteria 24158
103 Ga0207656_10181652 3300025321 Bacteria 1010
104 Ga0207653_10000006 3300025885 Bacteria 202194
105 Ga0207682_10067552 3300025893 Bacteria 1509
106 Ga0207710_10062918 3300025900 Bacteria 1687
107 Ga0207699_10000014 3300025906 Bacteria 260521
108 Ga0207645_10456821 3300025907 Bacteria 863
109 Ga0207643_10053887 3300025908 Bacteria 2285
110 Ga0207684_10000048 3300025910 Bacteria 241098
111 Ga0207684_10844696 3300025910 Bacteria 772
112 Ga0207654_10074962 3300025911 Bacteria 2020
113 Ga0207695_10104629 3300025913 Bacteria 2819
114 Ga0207695_10312315 3300025913 Bacteria 1462
115 Ga0207662_10293010 3300025918 Bacteria 1080
116 Ga0207646_10031765 3300025922 Bacteria 4779
117 Ga0207650_10018373 3300025925 Unclassified 4906
118 Ga0207650_10564104 3300025925 Bacteria 955
119 Ga0207659_10091243 3300025926 Bacteria 2275
120 Ga0207659_11518199 3300025926 Bacteria 573
121 Ga0207670_10282131 3300025936 Bacteria 1295
122 Ga0207704_10839449 3300025938 Bacteria 769
123 Ga0207665_10370199 3300025939 Bacteria 1085
124 Ga0207691_10019928 3300025940 Bacteria 6345
125 Ga0207711_10000013 3300025941 Bacteria 514850
126 Ga0207711_10421171 3300025941 Bacteria 1242
127 Ga0207689_10161576 3300025942 Bacteria 1846
128 Ga0207651_10570632 3300025960 Bacteria 986
129 Ga0207651_10838830 3300025960 Bacteria 816
130 Ga0207668_10830749 3300025972 Bacteria 819
131 Ga0207677_10013161 3300026023 Bacteria 4783
132 Ga0207639_10264180 3300026041 Bacteria 1507
133 Ga0207678_10370744 3300026067 Bacteria 1237
134 Ga0207708_10262470 3300026075 Bacteria 1394
135 Ga0207702_10211208 3300026078 Bacteria 1804
136 Ga0207641_10102877 3300026088 Bacteria 2519
137 Ga0207648_10472900 3300026089 Bacteria 1144
138 Ga0207675_100080801 3300026118 Bacteria 3048
139 Ga0207683_10004613 3300026121 Bacteria 11873
140 Ga0207698_10400185 3300026142 Bacteria 1312
141 Ga0207698_11959394 3300026142 Bacteria 600
142 Ga0209389_1001260 3300027296 Bacteria 17587
143 Ga0209969_1020775 3300027360 Bacteria 978
144 Ga0209981_1010398 3300027378 Bacteria 1276
145 Ga0209996_1003168 3300027395 Bacteria 2058
146 Ga0209995_1005169 3300027471 Bacteria 2097
147 Ga0209968_1000191 3300027526 Bacteria 10685
148 Ga0209999_1033280 3300027543 Bacteria 959
149 Ga0210002_1006448 3300027617 Bacteria 1771
150 Ga0209966_1000004 3300027695 Bacteria 108133
151 Ga0209974_10075342 3300027876 Bacteria 1155
152 Ga0209974_10091225 3300027876 Bacteria 1057
153 Ga0207428_10339614 3300027907 Bacteria 1106
154 Ga0268265_10380669 3300028380 Bacteria 1298
155 Ga0268264_11067185 3300028381 Bacteria 815
156 Ga0265338_10259286 3300028800 Bacteria 1279
157 Ga0265330_10000527 3300031235 Bacteria 25162
158 Ga0265330_10003308 3300031235 Bacteria 8481
159 Ga0265325_10001287 3300031241 Bacteria 17810
160 Ga0265339_10001385 3300031249 Bacteria 18071
161 Ga0265316_10000151 3300031344 Bacteria 76436
162 Ga0265316_10001717 3300031344 Bacteria 23251
163 Ga0265316_10061832 3300031344 Bacteria 2907
164 Ga0307408_101068943 3300031548 Bacteria 747
165 Ga0265313_10004964 3300031595 Bacteria 9954
166 Ga0265314_10020540 3300031711 Bacteria 5098
167 Ga0265342_10000778 3300031712 Bacteria 32411
168 Ga0265342_10116805 3300031712 Bacteria 1505
169 Ga0307405_11516048 3300031731 Bacteria 589
170 Ga0307412_10192201 3300031911 Bacteria 1544
171 Ga0307416_100152809 3300032002 Bacteria 2120
172 Ga0316574_0621880 3300035398 Bacteria 666
173 Ga0373931_0567135 3300035691 Bacteria 739
174 Ga0436364_0309018 3300037853 Bacteria 153512
175 Ga0436364_0938705 3300037853 Bacteria 1712
176 Ga0436364_1283697 3300037853 Bacteria 602
177 Ga0436365_1028783 3300039437 Bacteria 1141
178 Ga0436365_1479718 3300039437 Bacteria 550
179 Ga0436365_1703067 3300039437 Bacteria 636
180 Ga0436360_0115384 3300039438 Bacteria 740
181 Ga0436361_0208962 3300039447 Bacteria 743
182 Ga0436361_0715677 3300039447 Bacteria 2416
183 Ga0439438_097788 3300041405 Bacteria 713
184 Ga0450914_002435 3300042118 Bacteria 1329
185 Ga0450898_063188 3300042134 Bacteria 731
186 Ga0451577_0041880 3300042876 Bacteria 4109
187 Ga0451577_0302943 3300042876 Bacteria 1448
188 Ga0466969_0098881 3300044656 Bacteria 1375
189 Ga0466965_0009487 3300044683 Bacteria 4521
190 Ga0466966_0013638 3300044684 Bacteria 5377
191 Ga0466966_0405073 3300044684 Bacteria 820
192 Ga0466964_0257472 3300044706 Bacteria 863
193 Ga0453684_0115029 3300044712 Bacteria 3260
194 Ga0453684_0195848 3300044712 Bacteria 2360
195 Ga0466968_0137228 3300044735 Bacteria 1116
196 Ga0466957_0665072 3300044842 Bacteria 733
197 Ga0466957_1154679 3300044842 Bacteria 559
198 Ga0466959_0082270 3300045049 Bacteria 2319
199 Ga0451576_0001615 3300045051 Bacteria 37836
200 Ga0496102_1370304 3300048905 Bacteria 626
201 Ga0496106_0375411 3300048909 Bacteria 1143
202 Ga0496109_0371924 3300048912 Bacteria 1350
203 Ga0496109_1218822 3300048912 Bacteria 689
204 Ga0496124_0080685 3300048927 Bacteria 2676
205 Ga0496126_0000012 3300048929 Bacteria 727789
206 Ga0496126_0044248 3300048929 Bacteria 4102
207 nmdc:mga0k408_9948_c2 3300050493 Bacteria 4425
208 nmdc:mga07m45_120315_c1 3300050496 Bacteria 1516
209 nmdc:mga05p37_18398_c1 3300050507 Bacteria 8440
210 nmdc:mga05p37_364461_c1 3300050507 Bacteria 1698
211 nmdc:mga08y16_32483_c1 3300050511 Bacteria 5485
212 nmdc:mga08y16_59720_c1 3300050511 Bacteria 3983
213 nmdc:mga0a205_1075913_c1 3300050515 Bacteria 651
214 nmdc:mga0a205_88940_c1 3300050515 Bacteria 2985
215 Ga0495619_1188568 3300053085 Bacteria 505
216 Ga0500651_0006036 3300053093 Bacteria 6956
217 Ga0500595_029580 3300053119 Bacteria 1857
218 Ga0500559_0010162 3300053136 Bacteria 4048
219 Ga0500622_0001102 3300053156 Bacteria 22470
220 2643736962 2643221543 Bacteria 6628015
221 2831866377 2831864461 Bacteria 6502356
222 Ga0436361_0583521
223 rootH1_10014365
224 rootH1_10200848
225 JGI26128J50194_1000360
226 Ga0055526_1000724
227 Ga0055524_1009570
228 Ga0055530_10057663
229 Ga0055540_1062255
230 Ga0055531_10003495
231 Ga0055531_10012045
232 Ga0065714_10147748
233 Ga0065704_10156275
234 Ga0065712_10381094
235 Ga0065715_10004063
236 Ga0065715_10134847
237 Ga0065707_10104527
238 Ga0070676_10141555
239 Ga0070670_100014093
240 Ga0068869_100402266
241 Ga0070680_100221065
242 Ga0068868_100834932
243 Ga0070689_100585969
244 Ga0070687_100275320
245 Ga0070668_100762455
246 Ga0070675_100522346
247 Ga0070673_100641500
248 Ga0070703_10001592
249 Ga0070709_10000007
250 Ga0070705_100182764
251 Ga0070694_100165947
252 Ga0070694_100243676
253 Ga0070708_100300005
254 Ga0070663_100148785
255 Ga0068867_100170768
256 Ga0068867_100515615
257 Ga0068867_100985490
258 Ga0070706_100000037
259 Ga0070706_100270494
260 Ga0070706_101128592
261 Ga0070707_100011248
262 Ga0070699_100000047
263 Ga0070699_100068362
264 Ga0070684_100109392
265 Ga0068853_100195799
266 Ga0070672_100010804
267 Ga0070696_100003308
268 Ga0070693_100003445
269 Ga0070665_101191030
270 Ga0070704_100051617
271 Ga0070704_100244944
272 Ga0068854_100554449
273 Ga0068856_100054034
274 Ga0068852_100927551
275 Ga0068852_101237033
276 Ga0068861_101124060
277 Ga0068851_10273428
278 Ga0068870_10130937
279 Ga0068863_100130636
280 Ga0068862_100242807
281 Ga0075366_10054866
282 Ga0075366_10208636
283 Ga0075370_10184369
284 Ga0075370_10473571
285 Ga0075428_100000762
286 Ga0075430_100423469
287 Ga0075433_10133988
288 Ga0075434_101154625
289 Ga0075436_100426848
290 Ga0099824_1035836
291 Ga0099823_1000189
292 Ga0105244_10181104
293 Ga0105240_10178138
294 Ga0105240_10415659
295 Ga0111539_10018817
296 Ga0111539_10036400
297 Ga0111539_10165981
298 Ga0105245_10044061
299 Ga0105245_10996656
300 Ga0105247_10107329
301 Ga0114129_10027300
302 Ga0114129_10028458
303 Ga0105241_10125562
304 Ga0105248_10000003
305 Ga0105248_11251380
306 Ga0105239_10184563
307 Ga0157371_10561758
308 Ga0157378_10323196
309 Ga0163162_10186772
310 Ga0157380_10003248
311 Ga0157380_11609533
312 Ga0157376_10011880
313 Ga0157376_10134357
314 Ga0213872_10000004
315 Ga0213872_10072507
316 Ga0213876_10068868
317 Ga0213875_10000090
318 Ga0209673_1018645
319 Ga0209564_1000003
320 Ga0209050_1004871
321 Ga0209256_1001948
322 Ga0209051_1002175
323 Ga0209257_1001742
324 Ga0207656_10181652
325 Ga0207653_10000006
326 Ga0207682_10067552
327 Ga0207710_10062918
328 Ga0207699_10000014
329 Ga0207645_10456821
330 Ga0207643_10053887
331 Ga0207684_10000048
332 Ga0207684_10844696
333 Ga0207654_10074962
334 Ga0207695_10104629
335 Ga0207695_10312315
336 Ga0207662_10293010
337 Ga0207646_10031765
338 Ga0207650_10018373
339 Ga0207650_10564104
340 Ga0207659_10091243
341 Ga0207659_11518199
342 Ga0207670_10282131
343 Ga0207704_10839449
344 Ga0207665_10370199
345 Ga0207691_10019928
346 Ga0207711_10000013
347 Ga0207711_10421171
348 Ga0207689_10161576
349 Ga0207651_10570632
350 Ga0207651_10838830
351 Ga0207668_10830749
352 Ga0207677_10013161
353 Ga0207639_10264180
354 Ga0207678_10370744
355 Ga0207708_10262470
356 Ga0207702_10211208
357 Ga0207641_10102877
358 Ga0207648_10472900
359 Ga0207675_100080801
360 Ga0207683_10004613
361 Ga0207698_10400185
362 Ga0207698_11959394
363 Ga0209389_1001260
364 Ga0209969_1020775
365 Ga0209981_1010398
366 Ga0209996_1003168
367 Ga0209995_1005169
368 Ga0209968_1000191
369 Ga0209999_1033280
370 Ga0210002_1006448
371 Ga0209966_1000004
372 Ga0209974_10075342
373 Ga0209974_10091225
374 Ga0207428_10339614
375 Ga0268265_10380669
376 Ga0268264_11067185
377 Ga0265338_10259286
378 Ga0265330_10000527
379 Ga0265330_10003308
380 Ga0265325_10001287
381 Ga0265339_10001385
382 Ga0265316_10000151
383 Ga0265316_10001717
384 Ga0265316_10061832
385 Ga0307408_101068943
386 Ga0265313_10004964
387 Ga0265314_10020540
388 Ga0265342_10000778
389 Ga0265342_10116805
390 Ga0307405_11516048
391 Ga0307412_10192201
392 Ga0307416_100152809
393 Ga0316574_0621880
394 Ga0373931_0567135
395 Ga0436364_0309018
396 Ga0436364_0938705
397 Ga0436364_1283697
398 Ga0436365_1028783
399 Ga0436365_1479718
400 Ga0436365_1703067
401 Ga0436360_0115384
402 Ga0436361_0208962
403 Ga0436361_0715677
404 Ga0439438_097788
405 Ga0450914_002435
406 Ga0450898_063188
407 Ga0451577_0041880
408 Ga0451577_0302943
409 Ga0466969_0098881
410 Ga0466965_0009487
411 Ga0466966_0013638
412 Ga0466966_0405073
413 Ga0466964_0257472
414 Ga0453684_0115029
415 Ga0453684_0195848
416 Ga0466968_0137228
417 Ga0466957_0665072
418 Ga0466957_1154679
419 Ga0466959_0082270
420 Ga0451576_0001615
421 Ga0496102_1370304
422 Ga0496106_0375411
423 Ga0496109_0371924
424 Ga0496109_1218822
425 Ga0496124_0080685
426 Ga0496126_0000012
427 Ga0496126_0044248
428 nmdc:mga0k408_9948_c2
429 nmdc:mga07m45_120315_c1
430 nmdc:mga05p37_18398_c1
431 nmdc:mga05p37_364461_c1
432 nmdc:mga08y16_32483_c1
433 nmdc:mga08y16_59720_c1
434 nmdc:mga0a205_1075913_c1
435 nmdc:mga0a205_88940_c1
436 Ga0495619_1188568
437 Ga0500651_0006036
438 Ga0500595_029580
439 Ga0500559_0010162
440 Ga0500622_0001102
441 2643736962
442 2831866377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

31

157

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n3p-assembly1.cif.gz_A crosslinked acpp=fabz complex from e. coli type ii fas 0.9858 4 148
1z6b-assembly4.cif.gz_B crystal structure of plasmodium falciparum fabz at 2.1 a 0.9843 4 144
8ayi-assembly1.cif.gz_A scalindua brodae amxfabz h48n mutant 0.9835 6 145
4h4g-assembly1.cif.gz_I crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9808 3 145
6n3p-assembly1.cif.gz_A crosslinked acpp=fabz complex from e. coli type ii fas 0.9791 4 148
ID Description Score Start End Superfamily
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9673 4 145 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9643 6 144 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9595 6 145 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9573 4 145 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9497 3 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6A5KYL5-F1-model_v4 deleted 0.9948 5 148
AF-A1K6R0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9946 6 150 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A1VN51-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9943 6 149 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A3N5N3X1-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9932 6 149 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A561JT75-F1-model_v4 deleted 0.9928 4 148

Map