F333608

General Info

Members Datasets Scaffolds Average Seq Length
221 148 442 197

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1033634|Ga0436360_1033634_60_749
Length 229
Sequence MTPSEQYGNIRAAVNPETRPLSTVFGVLVTAFARLVTGVRGQWQGCLPEDRPRIYFANHCSHGDFVLIWTVLPAALRRRTRPVAAADYWGRGRLRRAIAGGVFRAVLVDRDAATRDSDPLAAMLAALDDGASLIFFPEGTRNTTVAALLPFKSGLWRLARARPDIELVPVWIENLNRVLPKGEFVPVPLLCTVTFGAPLRLFDDEGNAPFRERSRAALLAVRPNREPAS

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
123 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
124 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
125 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
126 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
129 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
130 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
145 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
146 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
147 2909042592 Labrys sp. LIt4 Isolate Nodule
148 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 0.45
Rhizoplane 4.98
Rhizosphere 85.97
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_1033634 3300039438 Bacteria 1233
2 JGI24737J22298_10104167 3300001990 Bacteria 840
3 Ga0070658_10266173 3300005327 Bacteria 1457
4 Ga0070683_100442772 3300005329 Bacteria 1240
5 Ga0070683_101476787 3300005329 Bacteria 653
6 Ga0070680_100157147 3300005336 Bacteria 1910
7 Ga0070680_100512172 3300005336 Bacteria 1027
8 Ga0070660_100013523 3300005339 Bacteria 5856
9 Ga0070668_101071011 3300005347 Bacteria 727
10 Ga0070671_100005768 3300005355 Bacteria 9865
11 Ga0070673_100217734 3300005364 Bacteria 1651
12 Ga0070659_100008123 3300005366 Bacteria 7655
13 Ga0070711_100766431 3300005439 Unclassified 816
14 Ga0070700_100089139 3300005441 Bacteria 2009
15 Ga0070708_100171765 3300005445 Bacteria 2024
16 Ga0070662_100644904 3300005457 Bacteria 893
17 Ga0070681_10470345 3300005458 Bacteria 1170
18 Ga0068867_100360912 3300005459 Bacteria 1215
19 Ga0070697_100040261 3300005536 Bacteria 3779
20 Ga0068853_100050861 3300005539 Bacteria 3565
21 Ga0070672_100162978 3300005543 Bacteria 1851
22 Ga0070695_100462811 3300005545 Bacteria 974
23 Ga0070693_100210054 3300005547 Bacteria 1269
24 Ga0070664_100070722 3300005564 Bacteria 2989
25 Ga0070664_100133091 3300005564 Bacteria 2185
26 Ga0068854_100193529 3300005578 Bacteria 1595
27 Ga0068864_100001237 3300005618 Bacteria 21245
28 Ga0068864_100854147 3300005618 Bacteria 897
29 Ga0068861_100255291 3300005719 Bacteria 1498
30 Ga0068863_100152269 3300005841 Bacteria 2213
31 Ga0068863_100790990 3300005841 Bacteria 946
32 Ga0068860_100795543 3300005843 Unclassified 959
33 Ga0068862_100017917 3300005844 Bacteria 5898
34 Ga0075365_10029412 3300006038 Bacteria 3512
35 Ga0075368_10095345 3300006042 Bacteria 1219
36 Ga0070712_100522798 3300006175 Bacteria 997
37 Ga0075367_10050473 3300006178 Bacteria 2456
38 Ga0075369_10113265 3300006186 Bacteria 1224
39 Ga0075366_10122610 3300006195 Bacteria 1567
40 Ga0097621_100135629 3300006237 Bacteria 2099
41 Ga0075370_10348818 3300006353 Bacteria 884
42 Ga0075428_100554228 3300006844 Bacteria 1229
43 Ga0075428_100928770 3300006844 Bacteria 922
44 Ga0075431_100301340 3300006847 Bacteria 1619
45 Ga0075433_10068946 3300006852 Bacteria 3105
46 Ga0075434_100006085 3300006871 Bacteria 11039
47 Ga0099795_10027489 3300007788 Bacteria 1925
48 Ga0105240_10000021 3300009093 Bacteria 394304
49 Ga0111539_10113636 3300009094 Bacteria 3176
50 Ga0114129_10001996 3300009147 Bacteria 27925
51 Ga0105248_10001782 3300009177 Bacteria 23920
52 Ga0105249_10134946 3300009553 Bacteria 2360
53 Ga0099796_10098226 3300010159 Bacteria 1098
54 Ga0105239_10537955 3300010375 Bacteria 1330
55 Ga0157373_10122736 3300013100 Bacteria 1826
56 Ga0157375_10509763 3300013308 Bacteria 1367
57 Ga0163163_10561727 3300014325 Bacteria 1204
58 Ga0157380_10459142 3300014326 Bacteria 1226
59 Ga0207705_10003969 3300025909 Bacteria 11246
60 Ga0207705_10102827 3300025909 Bacteria 2104
61 Ga0207695_10000083 3300025913 Bacteria 284102
62 Ga0207693_10060243 3300025915 Bacteria 2973
63 Ga0207660_10599873 3300025917 Unclassified 897
64 Ga0207657_10080914 3300025919 Bacteria 2729
65 Ga0207649_10812577 3300025920 Bacteria 730
66 Ga0207652_10206664 3300025921 Bacteria 1767
67 Ga0207644_10031859 3300025931 Bacteria 3676
68 Ga0207706_10442731 3300025933 Bacteria 1124
69 Ga0207691_10175495 3300025940 Bacteria 1874
70 Ga0207711_10000243 3300025941 Bacteria 58447
71 Ga0207651_10379729 3300025960 Bacteria 1197
72 Ga0207668_10248761 3300025972 Bacteria 1443
73 Ga0207640_10200870 3300025981 Bacteria 1511
74 Ga0207708_10340830 3300026075 Bacteria 1227
75 Ga0207702_10713434 3300026078 Bacteria 989
76 Ga0207641_10738706 3300026088 Bacteria 971
77 Ga0207676_10002720 3300026095 Bacteria 12581
78 Ga0207674_10537484 3300026116 Bacteria 1129
79 Ga0207675_100310196 3300026118 Bacteria 1538
80 Ga0209974_10006854 3300027876 Bacteria 3952
81 Ga0209974_10075397 3300027876 Bacteria 1155
82 Ga0268265_10007236 3300028380 Bacteria 7502
83 Ga0268265_10653634 3300028380 Unclassified 1011
84 Ga0265323_10000565 3300028653 Bacteria 20524
85 Ga0265330_10124779 3300031235 Bacteria 1096
86 Ga0265325_10090117 3300031241 Bacteria 1514
87 Ga0307408_100054240 3300031548 Bacteria 2898
88 Ga0307408_100069723 3300031548 Bacteria 2593
89 Ga0307408_100074331 3300031548 Bacteria 2521
90 Ga0307408_100282076 3300031548 Bacteria 1384
91 Ga0307408_100324719 3300031548 Bacteria 1297
92 Ga0307408_100397286 3300031548 Bacteria 1183
93 Ga0307405_10016892 3300031731 Bacteria 3991
94 Ga0307405_10039539 3300031731 Bacteria 2851
95 Ga0307405_10126845 3300031731 Bacteria 1756
96 Ga0307405_10311537 3300031731 Bacteria 1198
97 Ga0307413_10004015 3300031824 Bacteria 6324
98 Ga0307413_10018687 3300031824 Bacteria 3644
99 Ga0307413_10018869 3300031824 Bacteria 3630
100 Ga0307413_10033350 3300031824 Bacteria 2930
101 Ga0307413_10215329 3300031824 Bacteria 1398
102 Ga0307413_10465314 3300031824 Bacteria 1007
103 Ga0307413_10563297 3300031824 Bacteria 926
104 Ga0307410_10013033 3300031852 Bacteria 4834
105 Ga0307410_10023038 3300031852 Bacteria 3863
106 Ga0307410_10086715 3300031852 Bacteria 2212
107 Ga0307410_10105777 3300031852 Bacteria 2026
108 Ga0307410_10303537 3300031852 Bacteria 1260
109 Ga0307410_10594427 3300031852 Bacteria 922
110 Ga0307406_10011335 3300031901 Bacteria 5057
111 Ga0307406_10019665 3300031901 Bacteria 3966
112 Ga0307406_10058201 3300031901 Bacteria 2483
113 Ga0307406_10075119 3300031901 Bacteria 2228
114 Ga0307407_10009653 3300031903 Bacteria 4506
115 Ga0307407_10015429 3300031903 Bacteria 3776
116 Ga0307407_10044118 3300031903 Bacteria 2511
117 Ga0307412_10026254 3300031911 Bacteria 3618
118 Ga0307412_10067829 3300031911 Bacteria 2423
119 Ga0307412_10107115 3300031911 Bacteria 1988
120 Ga0307412_10120748 3300031911 Bacteria 1886
121 Ga0307409_100016046 3300031995 Bacteria 4940
122 Ga0307409_100070001 3300031995 Bacteria 2783
123 Ga0307409_100130401 3300031995 Bacteria 2147
124 Ga0307409_100234600 3300031995 Bacteria 1666
125 Ga0307409_100661185 3300031995 Bacteria 1040
126 Ga0307409_100787547 3300031995 Bacteria 957
127 Ga0307416_100039932 3300032002 Bacteria 3639
128 Ga0307416_100046761 3300032002 Bacteria 3418
129 Ga0307416_100102631 3300032002 Bacteria 2494
130 Ga0307416_100771530 3300032002 Bacteria 1055
131 Ga0307416_100936728 3300032002 Bacteria 967
132 Ga0307416_101174283 3300032002 Bacteria 873
133 Ga0307414_10002311 3300032004 Bacteria 9959
134 Ga0307414_10005732 3300032004 Bacteria 6860
135 Ga0307414_10007346 3300032004 Bacteria 6192
136 Ga0307414_10156442 3300032004 Unclassified 1805
137 Ga0307414_10210063 3300032004 Bacteria 1590
138 Ga0307414_10246224 3300032004 Bacteria 1483
139 Ga0307414_10329324 3300032004 Bacteria 1303
140 Ga0307414_10354362 3300032004 Bacteria 1260
141 Ga0307414_10357081 3300032004 Bacteria 1256
142 Ga0307414_10665934 3300032004 Bacteria 939
143 Ga0307414_10706155 3300032004 Bacteria 913
144 Ga0307414_10763610 3300032004 Bacteria 879
145 Ga0307411_10015811 3300032005 Bacteria 4251
146 Ga0307411_10037223 3300032005 Bacteria 3057
147 Ga0307411_10064068 3300032005 Bacteria 2459
148 Ga0307411_10079256 3300032005 Bacteria 2254
149 Ga0307411_10090397 3300032005 Bacteria 2135
150 Ga0307415_100010451 3300032126 Bacteria 5259
151 Ga0307415_100085487 3300032126 Bacteria 2266
152 Ga0307415_100209176 3300032126 Bacteria 1555
153 Ga0373946_0199704 3300035171 Bacteria 957
154 Ga0395899_0026342 3300037312 Bacteria 4388
155 Ga0395900_0002472 3300037418 Bacteria 20338
156 Ga0395905_0001330 3300037471 Bacteria 30159
157 Ga0436364_0104476 3300037853 Bacteria 1561
158 Ga0436364_0706900 3300037853 Bacteria 2618
159 Ga0436364_1090390 3300037853 Bacteria 2752
160 Ga0395901_0000486 3300038443 Bacteria 46185
161 Ga0439464_0136368 3300042439 Unclassified 762
162 Ga0466972_0047432 3300044658 Bacteria 2077
163 Ga0466965_0109470 3300044683 Bacteria 1419
164 Ga0466963_0261475 3300044694 Bacteria 1215
165 Ga0451576_0753068 3300045051 Bacteria 1023
166 Ga0466967_0464996 3300045976 Bacteria 1238
167 Ga0466967_0576958 3300045976 Bacteria 1108
168 Ga0495592_0275304 3300046454 Bacteria 1103
169 Ga0495608_0316754 3300046511 Bacteria 964
170 Ga0495668_0091479 3300046616 Bacteria 1667
171 Ga0495611_0258817 3300046648 Bacteria 806
172 Ga0495657_0169966 3300046675 Bacteria 1343
173 Ga0495669_0032419 3300046684 Bacteria 2297
174 Ga0495670_0127400 3300046691 Bacteria 1326
175 Ga0495674_0216700 3300047319 Bacteria 1584
176 Ga0495680_0106155 3300047322 Bacteria 2087
177 Ga0495685_017268 3300047447 Bacteria 2470
178 Ga0496100_0237163 3300048903 Bacteria 1344
179 Ga0496100_0255009 3300048903 Bacteria 1299
180 Ga0496104_0095754 3300048907 Bacteria 2840
181 Ga0496106_0006411 3300048909 Bacteria 8711
182 Ga0496108_0073632 3300048911 Bacteria 2884
183 Ga0496108_0298807 3300048911 Bacteria 1402
184 Ga0496109_0002645 3300048912 Bacteria 15018
185 Ga0496109_0136212 3300048912 Bacteria 2295
186 Ga0496110_0000654 3300048913 Bacteria 23654
187 Ga0496112_0038876 3300048915 Bacteria 4648
188 Ga0496112_0491052 3300048915 Bacteria 1164
189 Ga0501071_0267367 3300049587 Bacteria 1292
190 Ga0501074_0125942 3300049590 Bacteria 1832
191 Ga0501075_0220752 3300049591 Bacteria 1446
192 Ga0501202_027082 3300049652 Bacteria 1177
193 Ga0501207_023754 3300049654 Bacteria 997
194 Ga0501209_010678 3300049656 Bacteria 1898
195 Ga0501249_001557 3300049679 Bacteria 4699
196 Ga0501234_009766 3300049707 Bacteria 1498
197 Ga0501080_0046725 3300049742 Bacteria 4030
198 Ga0501267_012852 3300049764 Bacteria 866
199 Ga0501275_000948 3300049772 Bacteria 3069
200 Ga0501283_011026 3300049779 Bacteria 1339
201 nmdc:mga03n38_180584_c1 3300050490 Bacteria 1081
202 nmdc:mga0yw44_226539_c1 3300050492 Bacteria 1240
203 nmdc:mga04h51_107543_c1 3300050495 Bacteria 1024
204 nmdc:mga04h51_175181_c1 3300050495 Bacteria 832
205 nmdc:mga07m45_114219_c1 3300050496 Bacteria 1557
206 nmdc:mga05p37_234043_c1 3300050507 Bacteria 2212
207 nmdc:mga09592_90449_c1 3300050508 Bacteria 2615
208 nmdc:mga06r32_617834_c1 3300050510 Bacteria 1054
209 nmdc:mga06r32_706117_c1 3300050510 Bacteria 974
210 nmdc:mga0n895_131399_c1 3300050512 Bacteria 2529
211 nmdc:mga08x19_25679_c1 3300050514 Bacteria 3672
212 nmdc:mga0a205_168796_c1 3300050515 Bacteria 2084
213 nmdc:mga0sz30_10820_c1 3300050516 Bacteria 3505
214 nmdc:mga0sz30_62748_c1 3300050516 Bacteria 1590
215 Ga0495601_0049473 3300053077 Bacteria 2650
216 Ga0495595_0003279 3300053084 Bacteria 6430
217 Ga0500643_007175 3300053087 Bacteria 4552
218 Ga0500555_000011 3300053103 Bacteria 259962
219 Ga0500590_023577 3300053148 Bacteria 3195
220 2909048291 2909042592 Bacteria 6499737
221 2917556053 2917554339 Bacteria 4987857
222 Ga0436360_1033634
223 JGI24737J22298_10104167
224 Ga0070658_10266173
225 Ga0070683_100442772
226 Ga0070683_101476787
227 Ga0070680_100157147
228 Ga0070680_100512172
229 Ga0070660_100013523
230 Ga0070668_101071011
231 Ga0070671_100005768
232 Ga0070673_100217734
233 Ga0070659_100008123
234 Ga0070711_100766431
235 Ga0070700_100089139
236 Ga0070708_100171765
237 Ga0070662_100644904
238 Ga0070681_10470345
239 Ga0068867_100360912
240 Ga0070697_100040261
241 Ga0068853_100050861
242 Ga0070672_100162978
243 Ga0070695_100462811
244 Ga0070693_100210054
245 Ga0070664_100070722
246 Ga0070664_100133091
247 Ga0068854_100193529
248 Ga0068864_100001237
249 Ga0068864_100854147
250 Ga0068861_100255291
251 Ga0068863_100152269
252 Ga0068863_100790990
253 Ga0068860_100795543
254 Ga0068862_100017917
255 Ga0075365_10029412
256 Ga0075368_10095345
257 Ga0070712_100522798
258 Ga0075367_10050473
259 Ga0075369_10113265
260 Ga0075366_10122610
261 Ga0097621_100135629
262 Ga0075370_10348818
263 Ga0075428_100554228
264 Ga0075428_100928770
265 Ga0075431_100301340
266 Ga0075433_10068946
267 Ga0075434_100006085
268 Ga0099795_10027489
269 Ga0105240_10000021
270 Ga0111539_10113636
271 Ga0114129_10001996
272 Ga0105248_10001782
273 Ga0105249_10134946
274 Ga0099796_10098226
275 Ga0105239_10537955
276 Ga0157373_10122736
277 Ga0157375_10509763
278 Ga0163163_10561727
279 Ga0157380_10459142
280 Ga0207705_10003969
281 Ga0207705_10102827
282 Ga0207695_10000083
283 Ga0207693_10060243
284 Ga0207660_10599873
285 Ga0207657_10080914
286 Ga0207649_10812577
287 Ga0207652_10206664
288 Ga0207644_10031859
289 Ga0207706_10442731
290 Ga0207691_10175495
291 Ga0207711_10000243
292 Ga0207651_10379729
293 Ga0207668_10248761
294 Ga0207640_10200870
295 Ga0207708_10340830
296 Ga0207702_10713434
297 Ga0207641_10738706
298 Ga0207676_10002720
299 Ga0207674_10537484
300 Ga0207675_100310196
301 Ga0209974_10006854
302 Ga0209974_10075397
303 Ga0268265_10007236
304 Ga0268265_10653634
305 Ga0265323_10000565
306 Ga0265330_10124779
307 Ga0265325_10090117
308 Ga0307408_100054240
309 Ga0307408_100069723
310 Ga0307408_100074331
311 Ga0307408_100282076
312 Ga0307408_100324719
313 Ga0307408_100397286
314 Ga0307405_10016892
315 Ga0307405_10039539
316 Ga0307405_10126845
317 Ga0307405_10311537
318 Ga0307413_10004015
319 Ga0307413_10018687
320 Ga0307413_10018869
321 Ga0307413_10033350
322 Ga0307413_10215329
323 Ga0307413_10465314
324 Ga0307413_10563297
325 Ga0307410_10013033
326 Ga0307410_10023038
327 Ga0307410_10086715
328 Ga0307410_10105777
329 Ga0307410_10303537
330 Ga0307410_10594427
331 Ga0307406_10011335
332 Ga0307406_10019665
333 Ga0307406_10058201
334 Ga0307406_10075119
335 Ga0307407_10009653
336 Ga0307407_10015429
337 Ga0307407_10044118
338 Ga0307412_10026254
339 Ga0307412_10067829
340 Ga0307412_10107115
341 Ga0307412_10120748
342 Ga0307409_100016046
343 Ga0307409_100070001
344 Ga0307409_100130401
345 Ga0307409_100234600
346 Ga0307409_100661185
347 Ga0307409_100787547
348 Ga0307416_100039932
349 Ga0307416_100046761
350 Ga0307416_100102631
351 Ga0307416_100771530
352 Ga0307416_100936728
353 Ga0307416_101174283
354 Ga0307414_10002311
355 Ga0307414_10005732
356 Ga0307414_10007346
357 Ga0307414_10156442
358 Ga0307414_10210063
359 Ga0307414_10246224
360 Ga0307414_10329324
361 Ga0307414_10354362
362 Ga0307414_10357081
363 Ga0307414_10665934
364 Ga0307414_10706155
365 Ga0307414_10763610
366 Ga0307411_10015811
367 Ga0307411_10037223
368 Ga0307411_10064068
369 Ga0307411_10079256
370 Ga0307411_10090397
371 Ga0307415_100010451
372 Ga0307415_100085487
373 Ga0307415_100209176
374 Ga0373946_0199704
375 Ga0395899_0026342
376 Ga0395900_0002472
377 Ga0395905_0001330
378 Ga0436364_0104476
379 Ga0436364_0706900
380 Ga0436364_1090390
381 Ga0395901_0000486
382 Ga0439464_0136368
383 Ga0466972_0047432
384 Ga0466965_0109470
385 Ga0466963_0261475
386 Ga0451576_0753068
387 Ga0466967_0464996
388 Ga0466967_0576958
389 Ga0495592_0275304
390 Ga0495608_0316754
391 Ga0495668_0091479
392 Ga0495611_0258817
393 Ga0495657_0169966
394 Ga0495669_0032419
395 Ga0495670_0127400
396 Ga0495674_0216700
397 Ga0495680_0106155
398 Ga0495685_017268
399 Ga0496100_0237163
400 Ga0496100_0255009
401 Ga0496104_0095754
402 Ga0496106_0006411
403 Ga0496108_0073632
404 Ga0496108_0298807
405 Ga0496109_0002645
406 Ga0496109_0136212
407 Ga0496110_0000654
408 Ga0496112_0038876
409 Ga0496112_0491052
410 Ga0501071_0267367
411 Ga0501074_0125942
412 Ga0501075_0220752
413 Ga0501202_027082
414 Ga0501207_023754
415 Ga0501209_010678
416 Ga0501249_001557
417 Ga0501234_009766
418 Ga0501080_0046725
419 Ga0501267_012852
420 Ga0501275_000948
421 Ga0501283_011026
422 nmdc:mga03n38_180584_c1
423 nmdc:mga0yw44_226539_c1
424 nmdc:mga04h51_107543_c1
425 nmdc:mga04h51_175181_c1
426 nmdc:mga07m45_114219_c1
427 nmdc:mga05p37_234043_c1
428 nmdc:mga09592_90449_c1
429 nmdc:mga06r32_617834_c1
430 nmdc:mga06r32_706117_c1
431 nmdc:mga0n895_131399_c1
432 nmdc:mga08x19_25679_c1
433 nmdc:mga0a205_168796_c1
434 nmdc:mga0sz30_10820_c1
435 nmdc:mga0sz30_62748_c1
436 Ga0495601_0049473
437 Ga0495595_0003279
438 Ga0500643_007175
439 Ga0500555_000011
440 Ga0500590_023577
441 2909048291
442 2917556053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

40

173

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7047 2 193
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6934 2 193
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6924 2 193
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6633 2 193
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.65 27 192
ID Description Score Start End Superfamily
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8288 28 144 3.40.50.620
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8203 26 144 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.82 24 144 3.40.50.2000
af_Q93841_73_201_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8121 26 144 3.40.50.620
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7935 24 144 3.40.50.2000
ID Description Score Start End GO Terms
AF-H6X4Z4-F1-model_v4 GDSL acyltransferase 0.9684 2 144 GO:0003841
GO:0006654
AF-A0A2R7QXE0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9584 2 151 GO:0003841
GO:0006654
AF-A0A7W6XY82-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9527 2 193 GO:0003841
GO:0006654
AF-A0A6P1J089-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9516 2 193 GO:0003841
GO:0006654
AF-A0A1F4PHJ1-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9513 2 193 GO:0003841
GO:0006654

Map