F333515

General Info

Members Datasets Scaffolds Average Seq Length
221 102 442 495

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10033938|Ga0316579_100339382
Length 562
Sequence MGSGPGRYSGRVSATAGPPDHRPSTGVDAGTASADDDTPKEACGVFGVFAPDQPVSHLTYLGLYALQHRGQESAGMAVSDGQMVTVVKDMGLVSNAFDDRTLAALTGHLAIGHTRYSTTGSSTWRNAQPVYRDVGAHTVALAHNGNLVNTGDLADELGMLPGTITSDSDVMTELIAEELAKSPGPSDDGRALERAVLAVLPRLEGAFSVVAMDESHVIGVRDPNGFRPLCLGKLNHGWVLASESPALDVVGAHFVRELEPGEVVVIDAEGYRSIRAYEPERIDPKLCLFEFVYFARPDTRLYGQSVHQARVRMGEQLAEQAPVDADLVMGVPESGIPAAEGFARRTGIPYGQGLVKNRYIGRTFIAPNQEMRALGVRMKLNPLRDNITGRRLIVVDDSIVRGTTTRGMVSMLREAGATEVHMRISSPPYKWPCFYGMDTGLRGELLAANMGVDEIREYLNVDSLAYLTLDRLLTATGAVGAGFCDACLTGHYPVAVPVSLGKDVLELPESAPVVASGQSTFSMLLDGDAELPVELDHDHEDAEPVVVRHDGVGGLGRDHLRG

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
10 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
20 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
21 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
22 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
23 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
24 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
25 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
28 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
29 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
30 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
33 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
34 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
35 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
36 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
37 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
38 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
39 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
40 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
41 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
44 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
45 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
46 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
47 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
48 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
49 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
50 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
53 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
56 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
57 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
58 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
71 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
72 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
77 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
78 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
88 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
89 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
96 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
97 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
98 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
99 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 0.45
Rhizosphere 78.28
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10033938 3300031691 Bacteria 2345
2 JGI25407J50210_10006043 3300003373 Bacteria 3001
3 Ga0070671_100003541 3300005355 Bacteria 12197
4 Ga0068855_100071783 3300005563 Bacteria 4025
5 Ga0081455_10002612 3300005937 Bacteria 21353
6 Ga0081538_10000033 3300005981 Bacteria 121023
7 Ga0075364_10003074 3300006051 Bacteria 9430
8 Ga0075364_10040493 3300006051 Bacteria 3022
9 Ga0075367_10063793 3300006178 Bacteria 2203
10 Ga0075428_100000001 3300006844 Bacteria 772630
11 Ga0075428_100000126 3300006844 Bacteria 66322
12 Ga0075428_100013704 3300006844 Bacteria 9027
13 Ga0075430_100027745 3300006846 Bacteria 4810
14 Ga0075430_100036580 3300006846 Bacteria 4162
15 Ga0075431_100021977 3300006847 Bacteria 6523
16 Ga0075429_100001551 3300006880 Bacteria 18864
17 Ga0111539_10002435 3300009094 Bacteria 24741
18 Ga0111539_10016245 3300009094 Bacteria 9232
19 Ga0111539_10041912 3300009094 Bacteria 5500
20 Ga0105245_10005428 3300009098 Bacteria 11194
21 Ga0114129_10003261 3300009147 Bacteria 22776
22 Ga0114129_10007311 3300009147 Bacteria 15727
23 Ga0114129_10132541 3300009147 Bacteria 3422
24 Ga0114129_10141728 3300009147 Bacteria 3294
25 Ga0182008_10003907 3300014497 Bacteria 8832
26 Ga0213876_10017203 3300021384 Bacteria 3817
27 Ga0207687_10001888 3300025927 Bacteria 14430
28 Ga0207428_10010618 3300027907 Bacteria 8216
29 Ga0207428_10079556 3300027907 Bacteria 2563
30 Ga0265338_10033490 3300028800 Bacteria 4984
31 Ga0265327_10000134 3300031251 Bacteria 163243
32 Ga0265327_10029302 3300031251 Bacteria 3133
33 Ga0316575_10010382 3300031665 Bacteria 3420
34 Ga0316579_10001383 3300031691 Bacteria 8788
35 Ga0316576_10001039 3300031727 Bacteria 14382
36 Ga0316576_10001605 3300031727 Bacteria 12343
37 Ga0316576_10002687 3300031727 Bacteria 10170
38 Ga0316576_10008279 3300031727 Bacteria 6619
39 Ga0316576_10011542 3300031727 Bacteria 5794
40 Ga0316576_10014624 3300031727 Bacteria 5245
41 Ga0316576_10020366 3300031727 Bacteria 4564
42 Ga0316576_10040217 3300031727 Bacteria 3360
43 Ga0316576_10048433 3300031727 Bacteria 3082
44 Ga0316576_10049643 3300031727 Bacteria 3048
45 Ga0316576_10086767 3300031727 Bacteria 2328
46 Ga0316576_10103219 3300031727 Bacteria 2133
47 Ga0316578_10000220 3300031728 Bacteria 16564
48 Ga0316578_10001269 3300031728 Bacteria 10092
49 Ga0316578_10001890 3300031728 Bacteria 8844
50 Ga0316578_10003563 3300031728 Bacteria 7153
51 Ga0316578_10041714 3300031728 Bacteria 2658
52 Ga0316578_10055560 3300031728 Bacteria 2323
53 Ga0316577_10003120 3300031733 Bacteria 8328
54 Ga0316577_10008471 3300031733 Bacteria 5515
55 Ga0316577_10016994 3300031733 Bacteria 4015
56 Ga0316577_10017268 3300031733 Bacteria 3982
57 Ga0307416_100087262 3300032002 Bacteria 2663
58 Ga0316583_10001840 3300032133 Bacteria 7224
59 Ga0316583_10002591 3300032133 Bacteria 6299
60 Ga0316583_10013982 3300032133 Bacteria 2895
61 Ga0316585_10000517 3300032137 Bacteria 9235
62 Ga0316585_10003120 3300032137 Bacteria 4524
63 Ga0316585_10004605 3300032137 Bacteria 3851
64 Ga0316585_10006099 3300032137 Bacteria 3434
65 Ga0316580_10004898 3300032139 Bacteria 3893
66 Ga0316580_10015334 3300032139 Bacteria 2344
67 Ga0316593_10005985 3300032168 Bacteria 3253
68 Ga0316596_1014321 3300033541 Bacteria 1965
69 Ga0373928_0003674 3300035084 Bacteria 2923
70 Ga0373929_0005509 3300035085 Bacteria 2279
71 Ga0373932_0000283 3300035112 Bacteria 15309
72 Ga0316574_0000381 3300035398 Bacteria 17274
73 Ga0316574_0008466 3300035398 Bacteria 5714
74 Ga0316574_0016547 3300035398 Bacteria 4300
75 Ga0316574_0017899 3300035398 Bacteria 4154
76 Ga0316574_0024379 3300035398 Bacteria 3619
77 Ga0316574_0035273 3300035398 Bacteria 3055
78 Ga0316574_0054385 3300035398 Bacteria 2500
79 Ga0373931_0000006 3300035691 Bacteria 437006
80 Ga0373931_0000064 3300035691 Bacteria 54140
81 Ga0373927_0004752 3300035695 Bacteria 9457
82 Ga0316582_0001089 3300036647 Bacteria 11446
83 Ga0316582_0001753 3300036647 Bacteria 9763
84 Ga0316582_0007678 3300036647 Bacteria 5756
85 Ga0316582_0009799 3300036647 Bacteria 5214
86 Ga0316582_0023827 3300036647 Bacteria 3652
87 Ga0316582_0023866 3300036647 Bacteria 3649
88 Ga0316582_0030187 3300036647 Unclassified 3300
89 Ga0316582_0151301 3300036647 Bacteria 1569
90 Ga0316584_0000466 3300036712 Bacteria 21133
91 Ga0316584_0003571 3300036712 Bacteria 10158
92 Ga0316584_0022107 3300036712 Bacteria 4634
93 Ga0316584_0023195 3300036712 Bacteria 4534
94 Ga0316584_0027788 3300036712 Bacteria 4165
95 Ga0316584_0039222 3300036712 Bacteria 3525
96 Ga0316584_0063978 3300036712 Bacteria 2754
97 Ga0316584_0113915 3300036712 Bacteria 2023
98 Ga0316584_0187499 3300036712 Bacteria 1530
99 Ga0373925_0007439 3300037068 Bacteria 7990
100 Ga0316581_0003827 3300037588 Bacteria 3784
101 Ga0436364_0100903 3300037853 Bacteria 1661
102 Ga0436364_1200807 3300037853 Bacteria 3528
103 Ga0400484_28552 3300038725 Bacteria 15192
104 Ga0400484_30134 3300038725 Bacteria 3038
105 Ga0400490_37674 3300038726 Bacteria 71589
106 Ga0400490_52846 3300038726 Bacteria 3957
107 Ga0400485_12678 3300038735 Bacteria 46924
108 Ga0400485_15481 3300038735 Bacteria 3570
109 Ga0400485_19730 3300038735 Bacteria 23529
110 Ga0400488_15362 3300038741 Bacteria 4383
111 Ga0400488_17301 3300038741 Bacteria 15344
112 Ga0400488_49649 3300038741 Bacteria 4315
113 Ga0400488_60631 3300038741 Bacteria 7527
114 Ga0400486_12309 3300038742 Bacteria 67151
115 Ga0400486_20940 3300038742 Bacteria 27565
116 Ga0400486_24474 3300038742 Bacteria 19222
117 Ga0400486_25611 3300038742 Bacteria 23445
118 Ga0400483_017809 3300039062 Bacteria 3832
119 Ga0400483_039483 3300039062 Bacteria 11782
120 Ga0400483_067736 3300039062 Bacteria 77755
121 Ga0400483_155983 3300039062 Bacteria 7847
122 Ga0400483_220019 3300039062 Bacteria 77762
123 Ga0400483_256937 3300039062 Bacteria 5818
124 Ga0400489_06127 3300039093 Bacteria 80653
125 Ga0400489_33336 3300039093 Bacteria 19576
126 Ga0400489_80862 3300039093 Bacteria 53053
127 Ga0400489_83948 3300039093 Bacteria 17930
128 Ga0400487_57918 3300039110 Bacteria 7335
129 Ga0400487_64330 3300039110 Bacteria 14944
130 Ga0436365_0413448 3300039437 Bacteria 3570
131 Ga0436365_1259854 3300039437 Bacteria 2220
132 Ga0436362_0819268 3300039453 Bacteria 2530
133 Ga0439434_0002007 3300042435 Bacteria 5887
134 Ga0453684_0005928 3300044712 Bacteria 23695
135 Ga0453684_0011189 3300044712 Bacteria 15105
136 Ga0453684_0193123 3300044712 Bacteria 2380
137 Ga0495613_0016941 3300046689 Bacteria 5426
138 Ga0495672_0003488 3300047320 Bacteria 13433
139 Ga0496109_0174440 3300048912 Bacteria 2018
140 Ga0501031_0008714 3300049568 Bacteria 6596
141 Ga0501032_0023960 3300049569 Bacteria 4216
142 Ga0501033_0000100 3300049570 Bacteria 82096
143 Ga0501034_0000297 3300049571 Bacteria 88160
144 Ga0501034_0001283 3300049571 Bacteria 33954
145 Ga0501034_0002316 3300049571 Bacteria 23265
146 Ga0501034_0002604 3300049571 Bacteria 21431
147 Ga0501034_0013214 3300049571 Bacteria 8507
148 Ga0501034_0035663 3300049571 Bacteria 5042
149 Ga0501036_0006717 3300049572 Bacteria 9350
150 Ga0501036_0052048 3300049572 Bacteria 3468
151 Ga0501036_0060935 3300049572 Bacteria 3196
152 Ga0501037_0026909 3300049573 Bacteria 4248
153 Ga0501039_0007104 3300049575 Bacteria 8531
154 Ga0501039_0108166 3300049575 Bacteria 2173
155 Ga0501040_0018808 3300049576 Bacteria 4590
156 Ga0501040_0038796 3300049576 Bacteria 3238
157 Ga0501041_0007665 3300049577 Bacteria 6340
158 Ga0501042_0025991 3300049578 Bacteria 4114
159 Ga0501043_0015567 3300049579 Bacteria 5961
160 Ga0501046_0003350 3300049580 Bacteria 14712
161 Ga0501067_0018669 3300049583 Bacteria 3839
162 Ga0501068_0002814 3300049584 Bacteria 9250
163 Ga0501068_0007991 3300049584 Bacteria 5865
164 Ga0501069_0000414 3300049585 Bacteria 19348
165 Ga0501070_0005235 3300049586 Bacteria 11058
166 Ga0501070_0006040 3300049586 Bacteria 10312
167 Ga0501070_0059364 3300049586 Bacteria 3171
168 Ga0501070_0075223 3300049586 Bacteria 2795
169 Ga0501071_0005429 3300049587 Bacteria 8190
170 Ga0501071_0010669 3300049587 Bacteria 6162
171 Ga0501072_0005998 3300049588 Bacteria 9262
172 Ga0501072_0022083 3300049588 Bacteria 4936
173 Ga0501073_0002793 3300049589 Bacteria 13071
174 Ga0501073_0057370 3300049589 Bacteria 2722
175 Ga0501073_0087452 3300049589 Bacteria 2167
176 Ga0501074_0000566 3300049590 Bacteria 22957
177 Ga0501074_0047798 3300049590 Bacteria 3092
178 Ga0501074_0095314 3300049590 Bacteria 2131
179 Ga0501075_0001643 3300049591 Bacteria 14686
180 Ga0501076_0036449 3300049592 Bacteria 3853
181 Ga0501077_0016195 3300049593 Bacteria 4695
182 Ga0501079_0002072 3300049741 Bacteria 14374
183 Ga0501079_0045236 3300049741 Bacteria 3397
184 Ga0501080_0015544 3300049742 Bacteria 7019
185 Ga0501080_0017705 3300049742 Bacteria 6592
186 Ga0501081_0004183 3300049743 Bacteria 9257
187 Ga0501083_0001535 3300049744 Bacteria 15788
188 Ga0501083_0008326 3300049744 Bacteria 7336
189 Ga0501044_0000974 3300049823 Bacteria 34383
190 Ga0501044_0002275 3300049823 Bacteria 21900
191 Ga0501045_0002398 3300049824 Bacteria 12736
192 Ga0501045_0022315 3300049824 Bacteria 4531
193 Ga0501045_0048764 3300049824 Bacteria 3087
194 nmdc:mga00v17_112074_c1 3300050491 Bacteria 1731
195 nmdc:mga00v17_32755_c2 3300050491 Bacteria 2583
196 nmdc:mga00v17_968_c1 3300050491 Bacteria 15360
197 nmdc:mga0yw44_23838_c1 3300050492 Bacteria 3453
198 nmdc:mga0yw44_457_c1 3300050492 Bacteria 14478
199 nmdc:mga0yw44_63779_c1 3300050492 Bacteria 2266
200 nmdc:mga06z11_24148_c1 3300050494 Bacteria 2864
201 nmdc:mga05p37_1866_c1 3300050507 Bacteria 24550
202 nmdc:mga05p37_47879_c1 3300050507 Bacteria 5257
203 nmdc:mga09592_103_c1 3300050508 Bacteria 51909
204 nmdc:mga0qj67_1789_c1 3300050509 Bacteria 15197
205 nmdc:mga06r32_125722_c1 3300050510 Bacteria 2533
206 nmdc:mga06r32_151094_c1 3300050510 Bacteria 2301
207 nmdc:mga06r32_9062_c1 3300050510 Bacteria 8969
208 nmdc:mga08y16_15665_c1 3300050511 Bacteria 7972
209 nmdc:mga08y16_23067_c1 3300050511 Bacteria 6571
210 nmdc:mga08y16_38413_c1 3300050511 Bacteria 5027
211 Ga0495619_0022456 3300053085 Bacteria 4039
212 Ga0495619_0047690 3300053085 Bacteria 2822
213 Ga0500566_0002187 3300053094 Bacteria 11528
214 Ga0500641_0002430 3300053096 Bacteria 6606
215 Ga0500568_0000120 3300053139 Bacteria 70393
216 Ga0500604_0004721 3300053151 Bacteria 3609
217 Ga0500616_0027280 3300053153 Bacteria 3154
218 Ga0501084_0002590 3300054114 Bacteria 14575
219 Ga0501084_0003375 3300054114 Bacteria 12937
220 Ga0501084_0152511 3300054114 Bacteria 1948
221 Ga0530510_0005101 3300061734 Bacteria 9057
222 Ga0316579_10033938
223 JGI25407J50210_10006043
224 Ga0070671_100003541
225 Ga0068855_100071783
226 Ga0081455_10002612
227 Ga0081538_10000033
228 Ga0075364_10003074
229 Ga0075364_10040493
230 Ga0075367_10063793
231 Ga0075428_100000001
232 Ga0075428_100000126
233 Ga0075428_100013704
234 Ga0075430_100027745
235 Ga0075430_100036580
236 Ga0075431_100021977
237 Ga0075429_100001551
238 Ga0111539_10002435
239 Ga0111539_10016245
240 Ga0111539_10041912
241 Ga0105245_10005428
242 Ga0114129_10003261
243 Ga0114129_10007311
244 Ga0114129_10132541
245 Ga0114129_10141728
246 Ga0182008_10003907
247 Ga0213876_10017203
248 Ga0207687_10001888
249 Ga0207428_10010618
250 Ga0207428_10079556
251 Ga0265338_10033490
252 Ga0265327_10000134
253 Ga0265327_10029302
254 Ga0316575_10010382
255 Ga0316579_10001383
256 Ga0316576_10001039
257 Ga0316576_10001605
258 Ga0316576_10002687
259 Ga0316576_10008279
260 Ga0316576_10011542
261 Ga0316576_10014624
262 Ga0316576_10020366
263 Ga0316576_10040217
264 Ga0316576_10048433
265 Ga0316576_10049643
266 Ga0316576_10086767
267 Ga0316576_10103219
268 Ga0316578_10000220
269 Ga0316578_10001269
270 Ga0316578_10001890
271 Ga0316578_10003563
272 Ga0316578_10041714
273 Ga0316578_10055560
274 Ga0316577_10003120
275 Ga0316577_10008471
276 Ga0316577_10016994
277 Ga0316577_10017268
278 Ga0307416_100087262
279 Ga0316583_10001840
280 Ga0316583_10002591
281 Ga0316583_10013982
282 Ga0316585_10000517
283 Ga0316585_10003120
284 Ga0316585_10004605
285 Ga0316585_10006099
286 Ga0316580_10004898
287 Ga0316580_10015334
288 Ga0316593_10005985
289 Ga0316596_1014321
290 Ga0373928_0003674
291 Ga0373929_0005509
292 Ga0373932_0000283
293 Ga0316574_0000381
294 Ga0316574_0008466
295 Ga0316574_0016547
296 Ga0316574_0017899
297 Ga0316574_0024379
298 Ga0316574_0035273
299 Ga0316574_0054385
300 Ga0373931_0000006
301 Ga0373931_0000064
302 Ga0373927_0004752
303 Ga0316582_0001089
304 Ga0316582_0001753
305 Ga0316582_0007678
306 Ga0316582_0009799
307 Ga0316582_0023827
308 Ga0316582_0023866
309 Ga0316582_0030187
310 Ga0316582_0151301
311 Ga0316584_0000466
312 Ga0316584_0003571
313 Ga0316584_0022107
314 Ga0316584_0023195
315 Ga0316584_0027788
316 Ga0316584_0039222
317 Ga0316584_0063978
318 Ga0316584_0113915
319 Ga0316584_0187499
320 Ga0373925_0007439
321 Ga0316581_0003827
322 Ga0436364_0100903
323 Ga0436364_1200807
324 Ga0400484_28552
325 Ga0400484_30134
326 Ga0400490_37674
327 Ga0400490_52846
328 Ga0400485_12678
329 Ga0400485_15481
330 Ga0400485_19730
331 Ga0400488_15362
332 Ga0400488_17301
333 Ga0400488_49649
334 Ga0400488_60631
335 Ga0400486_12309
336 Ga0400486_20940
337 Ga0400486_24474
338 Ga0400486_25611
339 Ga0400483_017809
340 Ga0400483_039483
341 Ga0400483_067736
342 Ga0400483_155983
343 Ga0400483_220019
344 Ga0400483_256937
345 Ga0400489_06127
346 Ga0400489_33336
347 Ga0400489_80862
348 Ga0400489_83948
349 Ga0400487_57918
350 Ga0400487_64330
351 Ga0436365_0413448
352 Ga0436365_1259854
353 Ga0436362_0819268
354 Ga0439434_0002007
355 Ga0453684_0005928
356 Ga0453684_0011189
357 Ga0453684_0193123
358 Ga0495613_0016941
359 Ga0495672_0003488
360 Ga0496109_0174440
361 Ga0501031_0008714
362 Ga0501032_0023960
363 Ga0501033_0000100
364 Ga0501034_0000297
365 Ga0501034_0001283
366 Ga0501034_0002316
367 Ga0501034_0002604
368 Ga0501034_0013214
369 Ga0501034_0035663
370 Ga0501036_0006717
371 Ga0501036_0052048
372 Ga0501036_0060935
373 Ga0501037_0026909
374 Ga0501039_0007104
375 Ga0501039_0108166
376 Ga0501040_0018808
377 Ga0501040_0038796
378 Ga0501041_0007665
379 Ga0501042_0025991
380 Ga0501043_0015567
381 Ga0501046_0003350
382 Ga0501067_0018669
383 Ga0501068_0002814
384 Ga0501068_0007991
385 Ga0501069_0000414
386 Ga0501070_0005235
387 Ga0501070_0006040
388 Ga0501070_0059364
389 Ga0501070_0075223
390 Ga0501071_0005429
391 Ga0501071_0010669
392 Ga0501072_0005998
393 Ga0501072_0022083
394 Ga0501073_0002793
395 Ga0501073_0057370
396 Ga0501073_0087452
397 Ga0501074_0000566
398 Ga0501074_0047798
399 Ga0501074_0095314
400 Ga0501075_0001643
401 Ga0501076_0036449
402 Ga0501077_0016195
403 Ga0501079_0002072
404 Ga0501079_0045236
405 Ga0501080_0015544
406 Ga0501080_0017705
407 Ga0501081_0004183
408 Ga0501083_0001535
409 Ga0501083_0008326
410 Ga0501044_0000974
411 Ga0501044_0002275
412 Ga0501045_0002398
413 Ga0501045_0022315
414 Ga0501045_0048764
415 nmdc:mga00v17_112074_c1
416 nmdc:mga00v17_32755_c2
417 nmdc:mga00v17_968_c1
418 nmdc:mga0yw44_23838_c1
419 nmdc:mga0yw44_457_c1
420 nmdc:mga0yw44_63779_c1
421 nmdc:mga06z11_24148_c1
422 nmdc:mga05p37_1866_c1
423 nmdc:mga05p37_47879_c1
424 nmdc:mga09592_103_c1
425 nmdc:mga0qj67_1789_c1
426 nmdc:mga06r32_125722_c1
427 nmdc:mga06r32_151094_c1
428 nmdc:mga06r32_9062_c1
429 nmdc:mga08y16_15665_c1
430 nmdc:mga08y16_23067_c1
431 nmdc:mga08y16_38413_c1
432 Ga0495619_0022456
433 Ga0495619_0047690
434 Ga0500566_0002187
435 Ga0500641_0002430
436 Ga0500568_0000120
437 Ga0500604_0004721
438 Ga0500616_0027280
439 Ga0501084_0002590
440 Ga0501084_0003375
441 Ga0501084_0152511
442 Ga0530510_0005101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

304

425

0.88

PF13537

GATase_7

Glutamine amidotransferase domain

113

249

0.84

PF13522

GATase_6

Glutamine amidotransferase domain

97

243

0.75

PF13230

GATase_4

Glutamine amidotransferases class-II

59

222

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lbp-assembly1.cif.gz_A structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana 0.8889 23 458
1ecb-assembly2.cif.gz_D escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit 0.8783 23 454
1gph-assembly1.cif.gz_1 structure of the allosteric regulatory enzyme of purine biosynthesis 0.8706 23 469
8w7d-assembly1.cif.gz_B crystal structure of ecppat-fr901483 complex 0.8695 23 455
8w7d-assembly1.cif.gz_A crystal structure of ecppat-fr901483 complex 0.8692 23 455
ID Description Score Start End Superfamily
af_P87171_221_328_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9568 349 386 3.40.50.2020
1ao0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8968 283 436 3.40.50.2020
af_Q22134_287_448_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8824 284 435 3.40.50.2020
af_Q22134_2_446_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8777 23 432 3.60.20.10
1ao0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8771 283 436 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A645HCN1-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9753 355 454 GO:0004044
AF-A0A3N5I4V5-F1-model_v4 Amidophosphoribosyltransferase 0.9711 356 461 GO:0016757
AF-A0A7C4M3W4-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9693 351 455 GO:0004044
AF-A0A0R2Q4Z9-F1-model_v4 Amidophosphoribosyltransferase 0.9623 355 466
AF-A0A3A0UTH4-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9583 345 455 GO:0004044
GO:0004422
GO:0052657

Map