F333415

General Info

Members Datasets Scaffolds Average Seq Length
221 102 221 123

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10021499|Ga0207710_100214992
Length 122
Sequence MAARTSFDEVSSALKSILTPYAKDLVVDRASAMGYALSTSHLLPNGQKLFFAGVRKGKSYVSFYLMPVYMFPELLDGVSPTLSKRMQGKSCFNFKTADPAMLKELAKLTKASFARYKKEKLL

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
74 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
75 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
87 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
88 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
89 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
90 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1117262 2162886006 Bacteria 1428
2 SwRhRL3b_contig_3732042 2162886006 Bacteria 1182
3 SwRhRL2b_contig_3686162 2162886007 Bacteria 4016
4 Ga0065704_10000250 3300005289 Bacteria 52865
5 Ga0065704_10242414 3300005289 Bacteria 1011
6 Ga0065704_10495357 3300005289 Unclassified 671
7 Ga0065704_10755950 3300005289 Bacteria 540
8 Ga0065715_10301452 3300005293 Unclassified 1040
9 Ga0065707_10082246 3300005295 Bacteria 18304
10 Ga0065707_10084826 3300005295 Bacteria 6735
11 Ga0065707_10119953 3300005295 Bacteria 2146
12 Ga0065707_10367681 3300005295 Bacteria 894
13 Ga0070680_101272327 3300005336 Unclassified 636
14 Ga0070682_100254781 3300005337 Unclassified 1267
15 Ga0070689_100219702 3300005340 Bacteria 1558
16 Ga0070689_100830844 3300005340 Unclassified 814
17 Ga0070692_11107237 3300005345 Unclassified 559
18 Ga0070668_100806384 3300005347 Bacteria 834
19 Ga0070688_101293546 3300005365 Unclassified 588
20 Ga0070703_10147707 3300005406 Bacteria 880
21 Ga0070701_10606809 3300005438 Unclassified 725
22 Ga0070700_100593873 3300005441 Unclassified 866
23 Ga0070694_101637665 3300005444 Unclassified 547
24 Ga0070708_100582114 3300005445 Bacteria 1055
25 Ga0070685_10444879 3300005466 Bacteria 906
26 Ga0070706_100362452 3300005467 Bacteria 1351
27 Ga0070706_100892867 3300005467 Unclassified 821
28 Ga0070706_101964198 3300005467 Unclassified 530
29 Ga0070707_100159513 3300005468 Bacteria 2197
30 Ga0070707_100289156 3300005468 Bacteria 1593
31 Ga0070707_100352186 3300005468 Bacteria 1430
32 Ga0070698_100095794 3300005471 Bacteria 2945
33 Ga0070698_100122798 3300005471 Bacteria 2555
34 Ga0070698_100151419 3300005471 Bacteria 2267
35 Ga0070698_100192700 3300005471 Bacteria 1975
36 Ga0070698_100554638 3300005471 Bacteria 1088
37 Ga0070698_100904137 3300005471 Bacteria 828
38 Ga0070699_100005835 3300005518 Bacteria 10763
39 Ga0070699_100248873 3300005518 Bacteria 1588
40 Ga0070699_100311042 3300005518 Bacteria 1414
41 Ga0070697_100087922 3300005536 Unclassified 2566
42 Ga0070695_100019035 3300005545 Bacteria 4175
43 Ga0070695_100287360 3300005545 Bacteria 1211
44 Ga0070696_100389547 3300005546 Unclassified 1088
45 Ga0070696_100436335 3300005546 Unclassified 1031
46 Ga0070704_100097307 3300005549 Bacteria 2208
47 Ga0070704_100126857 3300005549 Bacteria 1970
48 Ga0070704_100797247 3300005549 Unclassified 844
49 Ga0070704_101503605 3300005549 Unclassified 619
50 Ga0068857_100221558 3300005577 Bacteria 1728
51 Ga0068859_100076119 3300005617 Bacteria 3397
52 Ga0068861_100273739 3300005719 Bacteria 1451
53 Ga0068870_10151826 3300005840 Bacteria 1365
54 Ga0068862_100021245 3300005844 Bacteria 5425
55 Ga0068862_100129853 3300005844 Bacteria 2228
56 Ga0081539_10005727 3300005985 Bacteria 12427
57 Ga0081539_10016288 3300005985 Bacteria 5324
58 Ga0075427_10000444 3300006194 Bacteria 4706
59 Ga0075428_100047727 3300006844 Bacteria 4702
60 Ga0075428_100455221 3300006844 Bacteria 1371
61 Ga0075428_100460267 3300006844 Unclassified 1362
62 Ga0075428_101463402 3300006844 Unclassified 716
63 Ga0075430_100092675 3300006846 Bacteria 2526
64 Ga0075431_100042617 3300006847 Bacteria 4682
65 Ga0075431_100128778 3300006847 Bacteria 2612
66 Ga0075431_100217201 3300006847 Bacteria 1951
67 Ga0075431_100256773 3300006847 Bacteria 1774
68 Ga0075431_100392914 3300006847 Bacteria 1389
69 Ga0075431_101117820 3300006847 Unclassified 752
70 Ga0075433_10028166 3300006852 Unclassified 4775
71 Ga0075433_10505146 3300006852 Bacteria 1064
72 Ga0075434_100795594 3300006871 Bacteria 962
73 Ga0075429_100003457 3300006880 Bacteria 13488
74 Ga0075429_100115145 3300006880 Bacteria 2350
75 Ga0075429_100171971 3300006880 Bacteria 1897
76 Ga0075429_100194583 3300006880 Bacteria 1776
77 Ga0075429_100227178 3300006880 Bacteria 1635
78 Ga0075429_100443810 3300006880 Bacteria 1137
79 Ga0075429_100791429 3300006880 Unclassified 830
80 Ga0075429_100836958 3300006880 Bacteria 805
81 Ga0075429_100899426 3300006880 Unclassified 775
82 Ga0097620_100076119 3300006931 Bacteria 3397
83 Ga0097620_100447009 3300006931 Unclassified 1389
84 Ga0097620_102857622 3300006931 Unclassified 529
85 Ga0111539_10065395 3300009094 Bacteria 4297
86 Ga0111539_10783551 3300009094 Bacteria 1110
87 Ga0105247_10042152 3300009101 Unclassified 2794
88 Ga0114129_10000238 3300009147 Bacteria 61413
89 Ga0114129_10012935 3300009147 Bacteria 11877
90 Ga0114129_10020433 3300009147 Bacteria 9417
91 Ga0114129_10044995 3300009147 Bacteria 6207
92 Ga0114129_10107423 3300009147 Bacteria 3855
93 Ga0114129_10371227 3300009147 Unclassified 1891
94 Ga0114129_10760134 3300009147 Bacteria 1240
95 Ga0114129_10954387 3300009147 Unclassified 1083
96 Ga0114129_11230299 3300009147 Bacteria 931
97 Ga0105243_10013086 3300009148 Bacteria 6271
98 Ga0105243_10135692 3300009148 Bacteria 2093
99 Ga0105241_10723124 3300009174 Bacteria 911
100 Ga0105249_10200053 3300009553 Bacteria 1955
101 Ga0105249_10260306 3300009553 Bacteria 1724
102 Ga0105249_11030399 3300009553 Bacteria 892
103 Ga0105246_10346535 3300011119 Bacteria 1216
104 Ga0105246_10412301 3300011119 Unclassified 1125
105 Ga0163163_12511327 3300014325 Bacteria 573
106 Ga0207710_10021499 3300025900 Unclassified 2765
107 Ga0207684_10411426 3300025910 Unclassified 1162
108 Ga0207684_11271239 3300025910 Unclassified 607
109 Ga0207660_10523048 3300025917 Bacteria 963
110 Ga0207646_10037262 3300025922 Bacteria 4385
111 Ga0207646_10242925 3300025922 Bacteria 1627
112 Ga0207709_10106247 3300025935 Bacteria 1867
113 Ga0207670_10168865 3300025936 Bacteria 1639
114 Ga0207670_10461236 3300025936 Bacteria 1026
115 Ga0207712_10154343 3300025961 Bacteria 1777
116 Ga0207712_11542834 3300025961 Unclassified 595
117 Ga0207708_10047057 3300026075 Bacteria 3285
118 Ga0207648_10644963 3300026089 Bacteria 978
119 Ga0207674_10139228 3300026116 Bacteria 2387
120 Ga0207675_100278580 3300026118 Bacteria 1624
121 Ga0209968_1026535 3300027526 Unclassified 958
122 Ga0268265_10272372 3300028380 Bacteria 1511
123 Ga0268265_10836715 3300028380 Unclassified 899
124 Ga0268265_10863815 3300028380 Bacteria 886
125 Ga0307408_100861489 3300031548 Unclassified 827
126 Ga0307405_11208906 3300031731 Unclassified 654
127 Ga0307410_10533561 3300031852 Bacteria 970
128 Ga0307407_10451306 3300031903 Unclassified 933
129 Ga0307407_10613133 3300031903 Unclassified 812
130 Ga0307412_10066161 3300031911 Bacteria 2449
131 Ga0307416_100935348 3300032002 Bacteria 968
132 Ga0307416_101726595 3300032002 Unclassified 730
133 Ga0307416_102353947 3300032002 Bacteria 633
134 Ga0307415_101176145 3300032126 Unclassified 721
135 Ga0439434_0054164 3300042435 Viruses 1247
136 Ga0451577_0190407 3300042876 Bacteria 1850
137 Ga0451577_0232910 3300042876 Bacteria 1666
138 Ga0451577_0305816 3300042876 Unclassified 1441
139 Ga0451577_0361581 3300042876 Unclassified 1316
140 Ga0453683_0000733 3300044673 Bacteria 33588
141 Ga0453683_0018858 3300044673 Bacteria 4425
142 Ga0453683_0096078 3300044673 Bacteria 1859
143 Ga0453683_0121375 3300044673 Bacteria 1645
144 Ga0453683_0591982 3300044673 Bacteria 723
145 Ga0453684_0000505 3300044712 Bacteria 152407
146 Ga0453684_0104820 3300044712 Unclassified 3451
147 Ga0453684_0117380 3300044712 Bacteria 3220
148 Ga0453684_0196619 3300044712 Bacteria 2354
149 Ga0453684_0198385 3300044712 Bacteria 2341
150 Ga0453684_0227638 3300044712 Bacteria 2155
151 Ga0453684_0283978 3300044712 Unclassified 1886
152 Ga0453684_0353288 3300044712 Bacteria 1657
153 Ga0453684_0387767 3300044712 Bacteria 1567
154 Ga0453684_0390370 3300044712 Bacteria 1561
155 Ga0453684_0527686 3300044712 Bacteria 1303
156 Ga0453684_0840520 3300044712 Unclassified 987
157 Ga0453684_1874299 3300044712 Bacteria 607
158 Ga0453684_2234317 3300044712 Bacteria 545
159 Ga0451576_0012799 3300045051 Bacteria 9413
160 Ga0451576_0287403 3300045051 Bacteria 1719
161 Ga0451576_0315600 3300045051 Bacteria 1635
162 Ga0451576_0371007 3300045051 Bacteria 1499
163 Ga0451576_0927867 3300045051 Bacteria 913
164 Ga0501291_074161 3300049514 Unclassified 665
165 Ga0501297_041376 3300049520 Bacteria 650
166 Ga0501299_220922 3300049522 Bacteria 511
167 Ga0501036_0993471 3300049572 Unclassified 687
168 Ga0501040_0166888 3300049576 Unclassified 1558
169 Ga0501041_0199319 3300049577 Unclassified 1255
170 Ga0501042_0466626 3300049578 Unclassified 916
171 Ga0501046_0161442 3300049580 Bacteria 1685
172 Ga0501069_0335197 3300049585 Unclassified 890
173 Ga0501071_0416278 3300049587 Unclassified 1027
174 Ga0501072_0280234 3300049588 Bacteria 1326
175 Ga0501075_0128534 3300049591 Bacteria 1929
176 Ga0501075_0403260 3300049591 Unclassified 1042
177 Ga0501075_0522314 3300049591 Unclassified 906
178 Ga0501075_0617687 3300049591 Bacteria 827
179 Ga0501076_0049781 3300049592 Bacteria 3314
180 Ga0501076_0144001 3300049592 Unclassified 1937
181 Ga0501209_155234 3300049656 Unclassified 690
182 Ga0501216_104068 3300049660 Bacteria 629
183 Ga0501227_217572 3300049665 Unclassified 543
184 Ga0501243_104854 3300049675 Bacteria 574
185 Ga0501219_020322 3300049703 Unclassified 572
186 Ga0501079_0010737 3300049741 Bacteria 6974
187 Ga0501079_0079046 3300049741 Bacteria 2544
188 Ga0501079_0290386 3300049741 Unclassified 1279
189 Ga0501045_0797038 3300049824 Unclassified 696
190 nmdc:mga05p37_1060461_c1 3300050507 Bacteria 854
191 nmdc:mga05p37_151362_c1 3300050507 Bacteria 2837
192 nmdc:mga05p37_1552141_c1 3300050507 Unclassified 656
193 nmdc:mga05p37_155686_c1 3300050507 Bacteria 2793
194 nmdc:mga05p37_39914_c1 3300050507 Bacteria 5764
195 nmdc:mga05p37_469_c1 3300050507 Bacteria 43958
196 nmdc:mga05p37_814651_c1 3300050507 Unclassified 1019
197 nmdc:mga09592_10685_c1 3300050508 Bacteria 7473
198 nmdc:mga09592_150891_c1 3300050508 Bacteria 2005
199 nmdc:mga09592_307022_c1 3300050508 Bacteria 1375
200 nmdc:mga09592_335127_c1 3300050508 Unclassified 1310
201 nmdc:mga09592_697396_c1 3300050508 Unclassified 864
202 nmdc:mga09592_794691_c1 3300050508 Unclassified 801
203 nmdc:mga09592_91931_c1 3300050508 Bacteria 2594
204 nmdc:mga0qj67_1168736_c1 3300050509 Unclassified 599
205 nmdc:mga0qj67_249079_c1 3300050509 Unclassified 1441
206 nmdc:mga0qj67_434714_c1 3300050509 Bacteria 1058
207 nmdc:mga06r32_1044061_c1 3300050510 Unclassified 768
208 nmdc:mga06r32_1608764_c1 3300050510 Unclassified 588
209 nmdc:mga06r32_513790_c1 3300050510 Unclassified 1174
210 nmdc:mga06r32_93118_c1 3300050510 Bacteria 2947
211 nmdc:mga08y16_112991_c1 3300050511 Bacteria 2827
212 nmdc:mga0n895_29620_c1 3300050512 Bacteria 5224
213 nmdc:mga0n895_664200_c1 3300050512 Bacteria 1040
214 nmdc:mga0a205_19807_c1 3300050515 Bacteria 6349
215 nmdc:mga0a205_793559_c1 3300050515 Unclassified 795
216 nmdc:mga0a205_810299_c1 3300050515 Bacteria 784
217 Ga0501084_0084007 3300054114 Bacteria 2673
218 Ga0501082_0173677 3300060353 Bacteria 1874
219 Ga0501082_0333426 3300060353 Unclassified 1322
220 Ga0501082_1181823 3300060353 Unclassified 669
221 Ga0530510_0082187 3300061734 Bacteria 2346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10644963 Ga0207648_106449633 117
2 3300005985 Ga0081539_10016288 Ga0081539_100162885 120
3 3300032002 Ga0307416_101726595 Ga0307416_1017265951 120
4 3300042876 Ga0451577_0190407 Ga0451577_0190407_860_1222 120
5 3300042876 Ga0451577_0232910 Ga0451577_0232910_18_380 120
6 3300044712 Ga0453684_0000505 Ga0453684_0000505_43781_44143 120
7 3300044712 Ga0453684_0198385 Ga0453684_0198385_311_673 120
8 3300044712 Ga0453684_0387767 Ga0453684_0387767_139_501 120
9 3300045051 Ga0451576_0315600 Ga0451576_0315600_900_1268 120
10 3300049577 Ga0501041_0199319 Ga0501041_0199319_311_673 120
11 3300049580 Ga0501046_0161442 Ga0501046_0161442_178_540 120
12 3300049585 Ga0501069_0335197 Ga0501069_0335197_259_621 120
13 3300049591 Ga0501075_0128534 Ga0501075_0128534_154_516 120
14 3300049592 Ga0501076_0049781 Ga0501076_0049781_1984_2346 120
15 3300049741 Ga0501079_0010737 Ga0501079_0010737_6319_6681 120
16 3300054114 Ga0501084_0084007 Ga0501084_0084007_1843_2205 120
17 3300061734 Ga0530510_0082187 Ga0530510_0082187_239_601 120
18 3300005719 Ga0068861_100273739 Ga0068861_1002737392 121
19 3300005844 Ga0068862_100129853 Ga0068862_1001298533 121
20 3300009148 Ga0105243_10135692 Ga0105243_101356923 121
21 3300009174 Ga0105241_10723124 Ga0105241_107231242 121
22 3300025935 Ga0207709_10106247 Ga0207709_101062472 121
23 3300025936 Ga0207670_10461236 Ga0207670_104612362 121
24 3300025961 Ga0207712_10154343 Ga0207712_101543433 121
25 3300026116 Ga0207674_10139228 Ga0207674_101392283 121
26 3300026118 Ga0207675_100278580 Ga0207675_1002785803 121
27 3300031903 Ga0307407_10451306 Ga0307407_104513062 121
28 3300032002 Ga0307416_102353947 Ga0307416_1023539472 121
29 3300042435 Ga0439434_0054164 Ga0439434_0054164_438_803 121
30 3300044712 Ga0453684_0840520 Ga0453684_0840520_262_627 121
31 3300049591 Ga0501075_0617687 Ga0501075_0617687_298_663 121
32 2162886006 SwRhRL3b_contig_1117262 SwRhRL3b_0019.00002580 122
33 2162886006 SwRhRL3b_contig_3732042 SwRhRL3b_0489.00001490 122
34 2162886007 SwRhRL2b_contig_3686162 SwRhRL2b_0958.00004840 122
35 3300005289 Ga0065704_10000250 Ga0065704_1000025024 122
36 3300005289 Ga0065704_10242414 Ga0065704_102424142 122
37 3300005289 Ga0065704_10495357 Ga0065704_104953571 122
38 3300005289 Ga0065704_10755950 Ga0065704_107559501 122
39 3300005293 Ga0065715_10301452 Ga0065715_103014522 122
40 3300005295 Ga0065707_10082246 Ga0065707_1008224618 122
41 3300005295 Ga0065707_10084826 Ga0065707_100848264 122
42 3300005295 Ga0065707_10119953 Ga0065707_101199535 122
43 3300005295 Ga0065707_10367681 Ga0065707_103676812 122
44 3300005336 Ga0070680_101272327 Ga0070680_1012723271 122
45 3300005337 Ga0070682_100254781 Ga0070682_1002547811 122
46 3300005340 Ga0070689_100219702 Ga0070689_1002197022 122
47 3300005340 Ga0070689_100830844 Ga0070689_1008308441 122
48 3300005345 Ga0070692_11107237 Ga0070692_111072371 122
49 3300005347 Ga0070668_100806384 Ga0070668_1008063841 122
50 3300005365 Ga0070688_101293546 Ga0070688_1012935461 122
51 3300005406 Ga0070703_10147707 Ga0070703_101477071 122
52 3300005438 Ga0070701_10606809 Ga0070701_106068092 122
53 3300005441 Ga0070700_100593873 Ga0070700_1005938732 122
54 3300005444 Ga0070694_101637665 Ga0070694_1016376652 122
55 3300005445 Ga0070708_100582114 Ga0070708_1005821141 122
56 3300005466 Ga0070685_10444879 Ga0070685_104448792 122
57 3300005467 Ga0070706_100362452 Ga0070706_1003624522 122
58 3300005467 Ga0070706_100892867 Ga0070706_1008928672 122
59 3300005467 Ga0070706_101964198 Ga0070706_1019641981 122
60 3300005468 Ga0070707_100159513 Ga0070707_1001595134 122
61 3300005468 Ga0070707_100289156 Ga0070707_1002891562 122
62 3300005468 Ga0070707_100352186 Ga0070707_1003521862 122
63 3300005471 Ga0070698_100095794 Ga0070698_1000957943 122
64 3300005471 Ga0070698_100122798 Ga0070698_1001227983 122
65 3300005471 Ga0070698_100151419 Ga0070698_1001514193 122
66 3300005471 Ga0070698_100192700 Ga0070698_1001927002 122
67 3300005471 Ga0070698_100554638 Ga0070698_1005546381 122
68 3300005471 Ga0070698_100904137 Ga0070698_1009041372 122
69 3300005518 Ga0070699_100005835 Ga0070699_1000058353 122
70 3300005518 Ga0070699_100248873 Ga0070699_1002488733 122
71 3300005518 Ga0070699_100311042 Ga0070699_1003110422 122
72 3300005536 Ga0070697_100087922 Ga0070697_1000879223 122
73 3300005545 Ga0070695_100019035 Ga0070695_1000190354 122
74 3300005545 Ga0070695_100287360 Ga0070695_1002873603 122
75 3300005546 Ga0070696_100389547 Ga0070696_1003895472 122
76 3300005546 Ga0070696_100436335 Ga0070696_1004363352 122
77 3300005549 Ga0070704_100097307 Ga0070704_1000973072 122
78 3300005549 Ga0070704_100126857 Ga0070704_1001268572 122
79 3300005549 Ga0070704_100797247 Ga0070704_1007972472 122
80 3300005549 Ga0070704_101503605 Ga0070704_1015036051 122
81 3300005577 Ga0068857_100221558 Ga0068857_1002215582 122
82 3300005617 Ga0068859_100076119 Ga0068859_1000761194 122
83 3300005840 Ga0068870_10151826 Ga0068870_101518261 122
84 3300005844 Ga0068862_100021245 Ga0068862_1000212456 122
85 3300005985 Ga0081539_10005727 Ga0081539_100057273 122
86 3300006194 Ga0075427_10000444 Ga0075427_100004441 122
87 3300006844 Ga0075428_100047727 Ga0075428_1000477272 122
88 3300006844 Ga0075428_100455221 Ga0075428_1004552212 122
89 3300006844 Ga0075428_100460267 Ga0075428_1004602672 122
90 3300006844 Ga0075428_101463402 Ga0075428_1014634022 122
91 3300006846 Ga0075430_100092675 Ga0075430_1000926752 122
92 3300006847 Ga0075431_100042617 Ga0075431_1000426173 122
93 3300006847 Ga0075431_100128778 Ga0075431_1001287784 122
94 3300006847 Ga0075431_100217201 Ga0075431_1002172012 122
95 3300006847 Ga0075431_100256773 Ga0075431_1002567732 122
96 3300006847 Ga0075431_100392914 Ga0075431_1003929143 122
97 3300006847 Ga0075431_101117820 Ga0075431_1011178201 122
98 3300006852 Ga0075433_10028166 Ga0075433_100281665 122
99 3300006852 Ga0075433_10505146 Ga0075433_105051462 122
100 3300006871 Ga0075434_100795594 Ga0075434_1007955942 122
101 3300006880 Ga0075429_100003457 Ga0075429_10000345710 122
102 3300006880 Ga0075429_100115145 Ga0075429_1001151453 122
103 3300006880 Ga0075429_100171971 Ga0075429_1001719712 122
104 3300006880 Ga0075429_100194583 Ga0075429_1001945831 122
105 3300006880 Ga0075429_100227178 Ga0075429_1002271783 122
106 3300006880 Ga0075429_100443810 Ga0075429_1004438102 122
107 3300006880 Ga0075429_100791429 Ga0075429_1007914292 122
108 3300006880 Ga0075429_100836958 Ga0075429_1008369581 122
109 3300006880 Ga0075429_100899426 Ga0075429_1008994262 122
110 3300006931 Ga0097620_100076119 Ga0097620_1000761194 122
111 3300006931 Ga0097620_100447009 Ga0097620_1004470091 122
112 3300006931 Ga0097620_102857622 Ga0097620_1028576222 122
113 3300009094 Ga0111539_10065395 Ga0111539_100653955 122
114 3300009094 Ga0111539_10783551 Ga0111539_107835512 122
115 3300009101 Ga0105247_10042152 Ga0105247_100421522 122
116 3300009147 Ga0114129_10000238 Ga0114129_1000023816 122
117 3300009147 Ga0114129_10012935 Ga0114129_100129358 122
118 3300009147 Ga0114129_10020433 Ga0114129_100204334 122
119 3300009147 Ga0114129_10044995 Ga0114129_100449952 122
120 3300009147 Ga0114129_10107423 Ga0114129_101074236 122
121 3300009147 Ga0114129_10371227 Ga0114129_103712274 122
122 3300009147 Ga0114129_10760134 Ga0114129_107601341 122
123 3300009147 Ga0114129_10954387 Ga0114129_109543872 122
124 3300009147 Ga0114129_11230299 Ga0114129_112302992 122
125 3300009148 Ga0105243_10013086 Ga0105243_100130864 122
126 3300009553 Ga0105249_10200053 Ga0105249_102000533 122
127 3300009553 Ga0105249_10260306 Ga0105249_102603063 122
128 3300009553 Ga0105249_11030399 Ga0105249_110303991 122
129 3300011119 Ga0105246_10346535 Ga0105246_103465352 122
130 3300011119 Ga0105246_10412301 Ga0105246_104123012 122
131 3300014325 Ga0163163_12511327 Ga0163163_125113272 122
132 3300025900 Ga0207710_10021499 Ga0207710_100214992 122
133 3300025910 Ga0207684_10411426 Ga0207684_104114262 122
134 3300025910 Ga0207684_11271239 Ga0207684_112712392 122
135 3300025917 Ga0207660_10523048 Ga0207660_105230482 122
136 3300025922 Ga0207646_10037262 Ga0207646_100372626 122
137 3300025922 Ga0207646_10242925 Ga0207646_102429252 122
138 3300025936 Ga0207670_10168865 Ga0207670_101688653 122
139 3300025961 Ga0207712_11542834 Ga0207712_115428342 122
140 3300026075 Ga0207708_10047057 Ga0207708_100470573 122
141 3300027526 Ga0209968_1026535 Ga0209968_10265352 122
142 3300028380 Ga0268265_10272372 Ga0268265_102723722 122
143 3300028380 Ga0268265_10836715 Ga0268265_108367152 122
144 3300028380 Ga0268265_10863815 Ga0268265_108638151 122
145 3300031548 Ga0307408_100861489 Ga0307408_1008614892 122
146 3300031731 Ga0307405_11208906 Ga0307405_112089062 122
147 3300031852 Ga0307410_10533561 Ga0307410_105335611 122
148 3300031903 Ga0307407_10613133 Ga0307407_106131332 122
149 3300031911 Ga0307412_10066161 Ga0307412_100661612 122
150 3300032002 Ga0307416_100935348 Ga0307416_1009353482 122
151 3300032126 Ga0307415_101176145 Ga0307415_1011761452 122
152 3300042876 Ga0451577_0305816 Ga0451577_0305816_927_1295 122
153 3300042876 Ga0451577_0361581 Ga0451577_0361581_533_910 122
154 3300044673 Ga0453683_0000733 Ga0453683_0000733_488_856 122
155 3300044673 Ga0453683_0018858 Ga0453683_0018858_3015_3383 122
156 3300044673 Ga0453683_0096078 Ga0453683_0096078_1416_1793 122
157 3300044673 Ga0453683_0121375 Ga0453683_0121375_830_1198 122
158 3300044673 Ga0453683_0591982 Ga0453683_0591982_212_589 122
159 3300044712 Ga0453684_0104820 Ga0453684_0104820_2412_2780 122
160 3300044712 Ga0453684_0117380 Ga0453684_0117380_407_784 122
161 3300044712 Ga0453684_0196619 Ga0453684_0196619_78_446 122
162 3300044712 Ga0453684_0227638 Ga0453684_0227638_1246_1623 122
163 3300044712 Ga0453684_0283978 Ga0453684_0283978_567_944 122
164 3300044712 Ga0453684_0353288 Ga0453684_0353288_117_485 122
165 3300044712 Ga0453684_0390370 Ga0453684_0390370_528_896 122
166 3300044712 Ga0453684_0527686 Ga0453684_0527686_579_956 122
167 3300044712 Ga0453684_1874299 Ga0453684_1874299_88_465 122
168 3300044712 Ga0453684_2234317 Ga0453684_2234317_158_526 122
169 3300045051 Ga0451576_0012799 Ga0451576_0012799_8705_9073 122
170 3300045051 Ga0451576_0287403 Ga0451576_0287403_164_541 122
171 3300045051 Ga0451576_0371007 Ga0451576_0371007_820_1188 122
172 3300045051 Ga0451576_0927867 Ga0451576_0927867_501_869 122
173 3300049514 Ga0501291_074161 Ga0501291_074161_36_431 122
174 3300049520 Ga0501297_041376 Ga0501297_041376_158_526 122
175 3300049522 Ga0501299_220922 Ga0501299_220922_73_441 122
176 3300049572 Ga0501036_0993471 Ga0501036_0993471_231_602 122
177 3300049576 Ga0501040_0166888 Ga0501040_0166888_341_709 122
178 3300049578 Ga0501042_0466626 Ga0501042_0466626_466_837 122
179 3300049587 Ga0501071_0416278 Ga0501071_0416278_205_573 122
180 3300049588 Ga0501072_0280234 Ga0501072_0280234_172_543 122
181 3300049591 Ga0501075_0403260 Ga0501075_0403260_289_657 122
182 3300049591 Ga0501075_0522314 Ga0501075_0522314_321_689 122
183 3300049592 Ga0501076_0144001 Ga0501076_0144001_586_954 122
184 3300049656 Ga0501209_155234 Ga0501209_155234_52_420 122
185 3300049660 Ga0501216_104068 Ga0501216_104068_209_577 122
186 3300049665 Ga0501227_217572 Ga0501227_217572_13_381 122
187 3300049675 Ga0501243_104854 Ga0501243_104854_133_519 122
188 3300049703 Ga0501219_020322 Ga0501219_020322_161_529 122
189 3300049741 Ga0501079_0079046 Ga0501079_0079046_1407_1775 122
190 3300049741 Ga0501079_0290386 Ga0501079_0290386_469_837 122
191 3300049824 Ga0501045_0797038 Ga0501045_0797038_125_493 122
192 3300050507 nmdc:mga05p37_1060461_c1 nmdc:mga05p37_1060461_c1_22_393 122
193 3300050507 nmdc:mga05p37_151362_c1 nmdc:mga05p37_151362_c1_807_1175 122
194 3300050507 nmdc:mga05p37_1552141_c1 nmdc:mga05p37_1552141_c1_51_422 122
195 3300050507 nmdc:mga05p37_155686_c1 nmdc:mga05p37_155686_c1_2272_2640 122
196 3300050507 nmdc:mga05p37_39914_c1 nmdc:mga05p37_39914_c1_3940_4308 122
197 3300050507 nmdc:mga05p37_469_c1 nmdc:mga05p37_469_c1_1674_2042 122
198 3300050507 nmdc:mga05p37_814651_c1 nmdc:mga05p37_814651_c1_150_518 122
199 3300050508 nmdc:mga09592_10685_c1 nmdc:mga09592_10685_c1_3358_3726 122
200 3300050508 nmdc:mga09592_150891_c1 nmdc:mga09592_150891_c1_1137_1505 122
201 3300050508 nmdc:mga09592_307022_c1 nmdc:mga09592_307022_c1_851_1219 122
202 3300050508 nmdc:mga09592_335127_c1 nmdc:mga09592_335127_c1_597_974 122
203 3300050508 nmdc:mga09592_697396_c1 nmdc:mga09592_697396_c1_380_775 122
204 3300050508 nmdc:mga09592_794691_c1 nmdc:mga09592_794691_c1_238_606 122
205 3300050508 nmdc:mga09592_91931_c1 nmdc:mga09592_91931_c1_1042_1413 122
206 3300050509 nmdc:mga0qj67_1168736_c1 nmdc:mga0qj67_1168736_c1_143_535 122
207 3300050509 nmdc:mga0qj67_249079_c1 nmdc:mga0qj67_249079_c1_758_1135 122
208 3300050509 nmdc:mga0qj67_434714_c1 nmdc:mga0qj67_434714_c1_602_979 122
209 3300050510 nmdc:mga06r32_1044061_c1 nmdc:mga06r32_1044061_c1_104_475 122
210 3300050510 nmdc:mga06r32_1608764_c1 nmdc:mga06r32_1608764_c1_59_430 122
211 3300050510 nmdc:mga06r32_513790_c1 nmdc:mga06r32_513790_c1_191_568 122
212 3300050510 nmdc:mga06r32_93118_c1 nmdc:mga06r32_93118_c1_908_1276 122
213 3300050511 nmdc:mga08y16_112991_c1 nmdc:mga08y16_112991_c1_418_786 122
214 3300050512 nmdc:mga0n895_29620_c1 nmdc:mga0n895_29620_c1_2002_2370 122
215 3300050512 nmdc:mga0n895_664200_c1 nmdc:mga0n895_664200_c1_188_556 122
216 3300050515 nmdc:mga0a205_19807_c1 nmdc:mga0a205_19807_c1_1407_1775 122
217 3300050515 nmdc:mga0a205_793559_c1 nmdc:mga0a205_793559_c1_330_698 122
218 3300050515 nmdc:mga0a205_810299_c1 nmdc:mga0a205_810299_c1_188_628 122
219 3300060353 Ga0501082_0173677 Ga0501082_0173677_1080_1448 122
220 3300060353 Ga0501082_0333426 Ga0501082_0333426_293_661 122
221 3300060353 Ga0501082_1181823 Ga0501082_1181823_194_562 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u1z-assembly2.cif.gz_A crystal structure of the drbd and crops of tcda 0.647 30 65
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5741 12 122
3nre-assembly4.cif.gz_D crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution 0.5693 25 65
1lur-assembly2.cif.gz_B crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 0.5637 24 63
2wal-assembly1.cif.gz_B-2 crystal structure of human gadd45gamma 0.5628 87 114
ID Description Score Start End Superfamily
af_K7KUA0_1_159_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.6153 9 55 3.30.930.10
af_P38025_96_184_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5864 51 98 3.30.200.20
af_Q9UUG0_1132_1263_3.30.1120.100 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.5772 25 65 3.30.1120.100
af_P76584_1_290_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.5748 25 65 2.70.98.10
af_B0UYT6_341_419_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.5702 8 112 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A838S058-F1-model_v4 Uncharacterized protein 0.998 66 119
AF-A0A640QMC4-F1-model_v4 DUF1801 domain-containing protein 0.997 49 119
AF-A0A419GTL9-F1-model_v4 DUF1801 domain-containing protein 0.9869 18 119
AF-A0A7Y4QKU2-F1-model_v4 Uncharacterized protein 0.9861 66 117
AF-A0A7C2TXT3-F1-model_v4 DUF1801 domain-containing protein 0.9837 1 119

Feature Viewer

pLDDT pTM Quality
91.64 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map