F333405

General Info

Members Datasets Scaffolds Average Seq Length
221 154 193 277

Family's Representative Sequence

Representative Sequence 3300015684|Ga0183365_10001|Ga0183365_10001293
Length 301
Sequence VRHGDSDLQKVDGFMTQMSDEPFDKRTTPFKDGVTDQAHEGLIRAKTYVAGEVLSCYDASAPILSQPEHGAEQWDQLLMGERFKVIERKHDYFWGQALRDGYVGYVPVSAFKRDWYLPTHYVSTLRTYVFAGPNLKSSTLTALSHNALVSVTRYENGFAYINEMGWVFANHLSTFETFAPDFVSVAESYINAPYQWGGRESLGLDCSGLLQQALYASGYGCPRDSDMQMKLGLALNIGPDLRGLVRGDLVFWKGHVAIMTDDVNIIHANAHHMKVAIEPLADAVNRIDSCGSGMPLAFRRL

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221629 Devosia sp. Root105 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221662 Devosia sp. Root413D1 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
18 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
19 2818991435 Caulobacter henricii 536 Isolate Unclassified
20 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
21 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
22 2849560528 Caulobacter zeae 410 Isolate Unclassified
23 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
24 2851153111 Caulobacter radicis 736 Isolate Unclassified
25 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
26 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
27 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
28 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
133 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
136 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
137 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
138 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
139 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
144 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
149 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
150 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
153 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.33
Metatranscriptomes 0
Isolates 12.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.86
Nodule 0
Rhizoplane 2.71
Rhizosphere 50.68
Stem 0
Stem Tuber 0
Unclassified 16.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10079488 3300003320 Bacteria 2025
2 rootH2_10079489 3300003320 Unclassified 1568
3 rootL2_10044257 3300003322 Bacteria 1684
4 rootH1_10200593 3300003323 Bacteria 1390
5 Ga0055526_1009776 3300003771 Bacteria 4559
6 Ga0055537_1009086 3300003773 Bacteria 2226
7 Ga0055524_1001155 3300003775 Bacteria 15890
8 Ga0055524_1004011 3300003775 Bacteria 6943
9 Ga0055536_1003084 3300003781 Bacteria 9080
10 Ga0055536_1003796 3300003781 Bacteria 7964
11 Ga0055530_10001238 3300003791 Bacteria 19501
12 Ga0055530_10004402 3300003791 Bacteria 7262
13 Ga0055530_10011635 3300003791 Bacteria 3141
14 Ga0055531_10000749 3300003794 Bacteria 27331
15 Ga0055531_10003424 3300003794 Bacteria 10122
16 Ga0055531_10047176 3300003794 Bacteria 1175
17 Ga0065165_1000795 3300005262 Bacteria 42155
18 Ga0065165_1001513 3300005262 Bacteria 24537
19 Ga0065165_1028172 3300005262 Bacteria 1817
20 Ga0070671_100103643 3300005355 Bacteria 2387
21 Ga0070659_100020372 3300005366 Bacteria 5036
22 Ga0070678_100079012 3300005456 Bacteria 2487
23 Ga0070665_100038243 3300005548 Bacteria 4823
24 Ga0070665_100161949 3300005548 Bacteria 2239
25 Ga0068864_100296872 3300005618 Bacteria 1512
26 Ga0068863_100298337 3300005841 Bacteria 1563
27 Ga0075369_10051067 3300006186 Bacteria 1789
28 Ga0075370_10069650 3300006353 Bacteria 2011
29 Ga0157373_10003834 3300013100 Bacteria 11370
30 Ga0157373_10012208 3300013100 Bacteria 6316
31 Ga0157374_10331686 3300013296 Bacteria 1509
32 Ga0163162_10966878 3300013306 Bacteria 962
33 Ga0157372_10132936 3300013307 Bacteria 2864
34 Ga0157380_10228673 3300014326 Bacteria 1669
35 Ga0183365_10001 3300015684 Bacteria 2090444
36 Ga0213872_10002032 3300021361 Bacteria 12295
37 Ga0209565_1000179 3300025263 Bacteria 79300
38 Ga0209673_1001719 3300025273 Bacteria 18427
39 Ga0209675_1008538 3300025291 Bacteria 3749
40 Ga0209676_1000119 3300025292 Bacteria 201094
41 Ga0209676_1000282 3300025292 Bacteria 105777
42 Ga0209564_1005116 3300025295 Bacteria 7628
43 Ga0209564_1021725 3300025295 Bacteria 2296
44 Ga0209758_1000562 3300025297 Bacteria 58446
45 Ga0209758_1002432 3300025297 Bacteria 19004
46 Ga0209050_1004429 3300025298 Bacteria 9495
47 Ga0209050_1005457 3300025298 Bacteria 7975
48 Ga0209050_1019976 3300025298 Bacteria 2515
49 Ga0209256_1001534 3300025299 Bacteria 23199
50 Ga0209256_1011965 3300025299 Bacteria 3394
51 Ga0209051_1025785 3300025303 Bacteria 2384
52 Ga0209257_1000332 3300025304 Bacteria 98632
53 Ga0209257_1001017 3300025304 Bacteria 37734
54 Ga0209257_1005279 3300025304 Bacteria 9210
55 Ga0207644_10171195 3300025931 Bacteria 1695
56 Ga0207690_10030752 3300025932 Bacteria 3429
57 Ga0268266_10106036 3300028379 Bacteria 2484
58 Ga0265337_1005724 3300028556 Bacteria 4886
59 Ga0307517_10003203 3300028786 Bacteria 25702
60 Ga0307515_10038866 3300028794 Bacteria 7592
61 Ga0307515_10064493 3300028794 Bacteria 5120
62 Ga0307515_10120307 3300028794 Bacteria 2980
63 Ga0307511_10026055 3300030521 Bacteria 5371
64 Ga0265327_10001421 3300031251 Bacteria 30472
65 Ga0265327_10003025 3300031251 Bacteria 16649
66 Ga0307513_10000077 3300031456 Bacteria 134167
67 Ga0307513_10009598 3300031456 Bacteria 12224
68 Ga0307413_10042685 3300031824 Bacteria 2667
69 Ga0307409_100675521 3300031995 Bacteria 1029
70 Ga0307414_10182632 3300032004 Bacteria 1689
71 Ga0307414_10421666 3300032004 Bacteria 1164
72 Ga0307411_10269420 3300032005 Bacteria 1349
73 Ga0307510_10016479 3300033180 Bacteria 8722
74 Ga0395899_0000018 3300037312 Bacteria 423194
75 Ga0395900_0255577 3300037418 Bacteria 1752
76 Ga0395898_0170445 3300037466 Bacteria 2081
77 Ga0395898_0194305 3300037466 Bacteria 1939
78 Ga0395905_0000173 3300037471 Bacteria 105060
79 Ga0395905_0057803 3300037471 Bacteria 3628
80 Ga0395901_0171548 3300038443 Bacteria 2276
81 Ga0436361_0283710 3300039447 Bacteria 5405
82 Ga0439446_0004696 3300042156 Bacteria 3471
83 Ga0439435_0005930 3300042436 Bacteria 2718
84 Ga0466969_0000943 3300044656 Bacteria 15670
85 Ga0466966_0001737 3300044684 Bacteria 14099
86 Ga0466961_0002986 3300044693 Bacteria 10505
87 Ga0466971_0003439 3300044719 Bacteria 6771
88 Ga0466970_0013074 3300044765 Bacteria 4253
89 Ga0466959_0023194 3300045049 Bacteria 4591
90 Ga0466959_0041054 3300045049 Bacteria 3417
91 Ga0466958_0032326 3300045836 Bacteria 3112
92 Ga0495627_000511 3300046453 Bacteria 32184
93 Ga0495638_0000188 3300046460 Bacteria 94506
94 Ga0495638_0000530 3300046460 Bacteria 44348
95 Ga0495638_0003888 3300046460 Bacteria 11561
96 Ga0495638_0016627 3300046460 Bacteria 4922
97 Ga0495638_0070033 3300046460 Bacteria 2148
98 Ga0495638_0078710 3300046460 Bacteria 2005
99 Ga0495651_0249691 3300046462 Bacteria 1212
100 Ga0495650_0000024 3300046471 Bacteria 496674
101 Ga0495650_0042660 3300046471 Bacteria 1930
102 Ga0495583_0000003 3300046506 Bacteria 709273
103 Ga0495583_0172235 3300046506 Bacteria 889
104 Ga0495606_0010317 3300046507 Bacteria 7769
105 Ga0495610_0000478 3300046512 Bacteria 41250
106 Ga0495610_0001067 3300046512 Bacteria 25177
107 Ga0495610_0023869 3300046512 Bacteria 3314
108 Ga0495616_0000099 3300046513 Bacteria 73607
109 Ga0495616_0071926 3300046513 Bacteria 1671
110 Ga0495620_0016275 3300046515 Bacteria 3736
111 Ga0495632_0038720 3300046519 Bacteria 2412
112 Ga0495637_0011697 3300046520 Bacteria 4211
113 Ga0495648_0000072 3300046524 Bacteria 132630
114 Ga0495648_0020650 3300046524 Bacteria 4586
115 Ga0495654_0000135 3300046530 Bacteria 77516
116 Ga0495654_0127178 3300046530 Bacteria 1147
117 Ga0495597_0042940 3300046542 Bacteria 2014
118 Ga0495633_0064591 3300046558 Bacteria 1711
119 Ga0495668_0000105 3300046616 Bacteria 133981
120 Ga0495668_0005929 3300046616 Bacteria 8121
121 Ga0495668_0011242 3300046616 Bacteria 5372
122 Ga0495668_0012608 3300046616 Bacteria 5010
123 Ga0495668_0044529 3300046616 Bacteria 2466
124 Ga0495611_0014349 3300046648 Bacteria 3384
125 Ga0495625_0000676 3300046660 Bacteria 48679
126 Ga0495625_0007966 3300046660 Bacteria 9103
127 Ga0495625_0030996 3300046660 Bacteria 3981
128 Ga0495625_0056602 3300046660 Bacteria 2790
129 Ga0495625_0084272 3300046660 Bacteria 2208
130 Ga0495625_0121542 3300046660 Bacteria 1776
131 Ga0495671_0092396 3300046692 Bacteria 1481
132 Ga0495660_0012923 3300046810 Bacteria 4840
133 Ga0495672_0001076 3300047320 Bacteria 27816
134 Ga0495673_0000340 3300047469 Bacteria 59502
135 Ga0495673_0000483 3300047469 Bacteria 42457
136 Ga0495673_0003529 3300047469 Bacteria 10294
137 Ga0495686_0003048 3300047472 Bacteria 14849
138 Ga0495686_0021271 3300047472 Bacteria 4311
139 Ga0495686_0025375 3300047472 Bacteria 3885
140 Ga0495686_0059967 3300047472 Bacteria 2366
141 Ga0496100_0343944 3300048903 Bacteria 1125
142 Ga0496106_0017547 3300048909 Bacteria 5296
143 Ga0496106_0176651 3300048909 Bacteria 1694
144 Ga0496107_0000987 3300048910 Bacteria 16906
145 Ga0496114_0295379 3300048917 Bacteria 1430
146 Ga0496115_0001412 3300048918 Bacteria 17186
147 Ga0496121_0001312 3300048924 Bacteria 42600
148 Ga0496121_0180892 3300048924 Bacteria 1522
149 Ga0496124_0317790 3300048927 Bacteria 1116
150 Ga0496125_0021157 3300048928 Bacteria 6078
151 Ga0496126_0003606 3300048929 Bacteria 19378
152 Ga0496126_0195440 3300048929 Bacteria 1711
153 Ga0495678_001353 3300049459 Bacteria 19588
154 Ga0501033_0024128 3300049570 Bacteria 4590
155 Ga0501034_0024843 3300049571 Bacteria 6096
156 Ga0501034_0221290 3300049571 Bacteria 1845
157 Ga0501034_0274674 3300049571 Bacteria 1625
158 Ga0501034_0291532 3300049571 Bacteria 1570
159 Ga0501047_0117699 3300049581 Bacteria 2539
160 Ga0501035_0007591 3300049822 Bacteria 10134
161 nmdc:mga0k408_66615_c1 3300050493 Bacteria 2098
162 nmdc:mga07m45_162653_c1 3300050496 Bacteria 1296
163 nmdc:mga07m45_205030_c1 3300050496 Bacteria 1147
164 nmdc:mga0sz30_52249_c1 3300050516 Bacteria 1420
165 Ga0500578_0000124 3300053086 Bacteria 92437
166 Ga0500644_0001127 3300053088 Bacteria 7836
167 Ga0500644_0013359 3300053088 Bacteria 2292
168 Ga0500647_0110724 3300053091 Bacteria 1305
169 Ga0500554_003241 3300053102 Bacteria 3307
170 Ga0500562_017345 3300053108 Bacteria 1856
171 Ga0500572_003417 3300053111 Bacteria 3641
172 Ga0500594_0001809 3300053118 Bacteria 4634
173 Ga0500608_000046 3300053122 Bacteria 55792
174 Ga0500608_000812 3300053122 Bacteria 11312
175 Ga0500618_011331 3300053125 Bacteria 2367
176 Ga0500658_0171759 3300053134 Bacteria 984
177 Ga0500559_0000098 3300053136 Bacteria 69305
178 Ga0500559_0000279 3300053136 Bacteria 39412
179 Ga0500559_0007724 3300053136 Bacteria 4749
180 Ga0500559_0016039 3300053136 Bacteria 3164
181 Ga0500564_001404 3300053138 Bacteria 8315
182 Ga0500568_0046559 3300053139 Bacteria 1721
183 Ga0500577_0072943 3300053142 Bacteria 1350
184 Ga0500616_0079182 3300053153 Bacteria 1655
185 Ga0500622_0037376 3300053156 Bacteria 2536
186 Ga0500627_0124111 3300053158 Bacteria 1165
187 Ga0500639_100074 3300053163 Bacteria 1428
188 Ga0500636_0151369 3300053177 Bacteria 1274
189 Ga0500645_007171 3300053730 Bacteria 3911
190 Ga0500645_007392 3300053730 Bacteria 3829
191 Ga0500609_006228 3300053731 Bacteria 1626
192 Ga0466962_0004221 3300061719 Bacteria 6882
193 Ga0466962_0079555 3300061719 Bacteria 1567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_205030_c1 nmdc:mga07m45_205030_c1_456_1127 223
2 3300046506 Ga0495583_0172235 Ga0495583_0172235_59_733 224
3 3300049571 Ga0501034_0274674 Ga0501034_0274674_835_1569 244
4 3300005548 Ga0070665_100038243 Ga0070665_1000382432 258
5 3300028379 Ga0268266_10106036 Ga0268266_101060362 258
6 3300013306 Ga0163162_10966878 Ga0163162_109668782 259
7 3300046520 Ga0495637_0011697 Ga0495637_0011697_2704_3549 261
8 3300046462 Ga0495651_0249691 Ga0495651_0249691_123_938 265
9 3300049581 Ga0501047_0117699 Ga0501047_0117699_943_1758 265
10 3300046513 Ga0495616_0071926 Ga0495616_0071926_754_1599 266
11 3300049571 Ga0501034_0291532 Ga0501034_0291532_399_1271 266
12 3300053730 Ga0500645_007171 Ga0500645_007171_2311_3156 266
13 3300046507 Ga0495606_0010317 Ga0495606_0010317_2919_3728 269
14 3300005456 Ga0070678_100079012 Ga0070678_1000790123 271
15 3300031251 Ga0265327_10003025 Ga0265327_1000302517 271
16 3300037466 Ga0395898_0170445 Ga0395898_0170445_735_1550 271
17 3300037471 Ga0395905_0057803 Ga0395905_0057803_1937_2752 271
18 3300038443 Ga0395901_0171548 Ga0395901_0171548_1376_2191 271
19 3300042156 Ga0439446_0004696 Ga0439446_0004696_121_939 271
20 3300046558 Ga0495633_0064591 Ga0495633_0064591_667_1482 271
21 3300046616 Ga0495668_0012608 Ga0495668_0012608_1450_2265 271
22 3300053091 Ga0500647_0110724 Ga0500647_0110724_50_865 271
23 3300053136 Ga0500559_0000279 Ga0500559_0000279_1523_2338 271
24 3300053142 Ga0500577_0072943 Ga0500577_0072943_205_1023 271
25 3300053163 Ga0500639_100074 Ga0500639_100074_463_1278 271
26 3300053177 Ga0500636_0151369 Ga0500636_0151369_322_1137 271
27 iso_pu_bacteria 2643221629 2644164951 271
28 iso_pu_bacteria 2791355048 2792459176 271
29 iso_pu_bacteria 2843744320 2843744902 271
30 iso_pu_bacteria 2849560528 2849563653 271
31 iso_pu_bacteria 2849573788 2849573877 271
32 iso_pu_bacteria 2851153111 2851154707 271
33 iso_pu_bacteria 2510917020 2511122565 272
34 iso_pu_bacteria 2643221614 2644088028 273
35 iso_pu_bacteria 2643221661 2644344085 273
36 iso_pu_bacteria 2643221666 2644367385 273
37 iso_pu_bacteria 2857504554 2857507295 273
38 iso_pu_bacteria 2898329390 2898334230 273
39 3300021361 Ga0213872_10002032 Ga0213872_100020324 274
40 3300039447 Ga0436361_0283710 Ga0436361_0283710_3162_3989 274
41 iso_pu_bacteria 2582581279 2585147772 274
42 3300003323 rootH1_10200593 rootH1_102005932 275
43 3300013296 Ga0157374_10331686 Ga0157374_103316862 275
44 3300037466 Ga0395898_0194305 Ga0395898_0194305_800_1627 275
45 3300049571 Ga0501034_0221290 Ga0501034_0221290_393_1220 275
46 3300003775 Ga0055524_1001155 Ga0055524_10011552 276
47 3300005548 Ga0070665_100161949 Ga0070665_1001619492 276
48 3300013307 Ga0157372_10132936 Ga0157372_101329363 276
49 3300025299 Ga0209256_1011965 Ga0209256_10119652 276
50 3300028556 Ga0265337_1005724 Ga0265337_10057246 276
51 3300028794 Ga0307515_10064493 Ga0307515_100644936 276
52 3300028794 Ga0307515_10120307 Ga0307515_101203072 276
53 3300030521 Ga0307511_10026055 Ga0307511_100260552 276
54 3300037418 Ga0395900_0255577 Ga0395900_0255577_345_1175 276
55 3300046460 Ga0495638_0000188 Ga0495638_0000188_33379_34209 276
56 3300046460 Ga0495638_0000530 Ga0495638_0000530_25481_26326 276
57 3300046460 Ga0495638_0003888 Ga0495638_0003888_7117_7947 276
58 3300046460 Ga0495638_0016627 Ga0495638_0016627_3656_4486 276
59 3300046460 Ga0495638_0078710 Ga0495638_0078710_221_1051 276
60 3300046471 Ga0495650_0000024 Ga0495650_0000024_109875_110705 276
61 3300046512 Ga0495610_0001067 Ga0495610_0001067_20643_21473 276
62 3300046512 Ga0495610_0023869 Ga0495610_0023869_36_869 276
63 3300046513 Ga0495616_0000099 Ga0495616_0000099_19789_20619 276
64 3300046515 Ga0495620_0016275 Ga0495620_0016275_591_1421 276
65 3300046519 Ga0495632_0038720 Ga0495632_0038720_288_1118 276
66 3300046524 Ga0495648_0020650 Ga0495648_0020650_2237_3067 276
67 3300046530 Ga0495654_0000135 Ga0495654_0000135_41565_42395 276
68 3300046530 Ga0495654_0127178 Ga0495654_0127178_86_916 276
69 3300046616 Ga0495668_0005929 Ga0495668_0005929_3750_4580 276
70 3300046660 Ga0495625_0056602 Ga0495625_0056602_700_1530 276
71 3300046660 Ga0495625_0121542 Ga0495625_0121542_773_1603 276
72 3300047320 Ga0495672_0001076 Ga0495672_0001076_23854_24684 276
73 3300047469 Ga0495673_0000340 Ga0495673_0000340_5447_6277 276
74 3300047472 Ga0495686_0003048 Ga0495686_0003048_6119_6949 276
75 3300047472 Ga0495686_0025375 Ga0495686_0025375_1691_2521 276
76 3300047472 Ga0495686_0059967 Ga0495686_0059967_310_1143 276
77 3300048903 Ga0496100_0343944 Ga0496100_0343944_15_848 276
78 3300048909 Ga0496106_0017547 Ga0496106_0017547_3846_4679 276
79 3300048910 Ga0496107_0000987 Ga0496107_0000987_15000_15833 276
80 3300048924 Ga0496121_0001312 Ga0496121_0001312_40915_41748 276
81 3300048924 Ga0496121_0180892 Ga0496121_0180892_86_916 276
82 3300048929 Ga0496126_0195440 Ga0496126_0195440_736_1569 276
83 3300049459 Ga0495678_001353 Ga0495678_001353_4035_4865 276
84 3300053088 Ga0500644_0013359 Ga0500644_0013359_1429_2259 276
85 3300053102 Ga0500554_003241 Ga0500554_003241_770_1600 276
86 3300053118 Ga0500594_0001809 Ga0500594_0001809_416_1246 276
87 3300053125 Ga0500618_011331 Ga0500618_011331_716_1546 276
88 3300053134 Ga0500658_0171759 Ga0500658_0171759_25_855 276
89 3300053136 Ga0500559_0000098 Ga0500559_0000098_794_1624 276
90 3300053153 Ga0500616_0079182 Ga0500616_0079182_743_1573 276
91 3300053156 Ga0500622_0037376 Ga0500622_0037376_1649_2479 276
92 3300053158 Ga0500627_0124111 Ga0500627_0124111_78_908 276
93 3300053731 Ga0500609_006228 Ga0500609_006228_757_1587 276
94 iso_pu_bacteria 2643221662 2644345780 276
95 3300003781 Ga0055536_1003084 Ga0055536_10030848 277
96 3300003791 Ga0055530_10001238 Ga0055530_1000123816 277
97 3300003791 Ga0055530_10004402 Ga0055530_100044027 277
98 3300003794 Ga0055531_10047176 Ga0055531_100471761 277
99 3300005262 Ga0065165_1001513 Ga0065165_100151315 277
100 3300005262 Ga0065165_1028172 Ga0065165_10281722 277
101 3300005355 Ga0070671_100103643 Ga0070671_1001036432 277
102 3300005366 Ga0070659_100020372 Ga0070659_1000203722 277
103 3300005618 Ga0068864_100296872 Ga0068864_1002968722 277
104 3300005841 Ga0068863_100298337 Ga0068863_1002983372 277
105 3300006186 Ga0075369_10051067 Ga0075369_100510672 277
106 3300013100 Ga0157373_10003834 Ga0157373_100038342 277
107 3300013100 Ga0157373_10012208 Ga0157373_100122082 277
108 3300025292 Ga0209676_1000119 Ga0209676_10001197 277
109 3300025298 Ga0209050_1004429 Ga0209050_10044297 277
110 3300025303 Ga0209051_1025785 Ga0209051_10257852 277
111 3300025304 Ga0209257_1005279 Ga0209257_10052794 277
112 3300025931 Ga0207644_10171195 Ga0207644_101711951 277
113 3300025932 Ga0207690_10030752 Ga0207690_100307524 277
114 3300028786 Ga0307517_10003203 Ga0307517_1000320325 277
115 3300031251 Ga0265327_10001421 Ga0265327_1000142119 277
116 3300031456 Ga0307513_10000077 Ga0307513_1000007733 277
117 3300031456 Ga0307513_10009598 Ga0307513_100095987 277
118 3300031824 Ga0307413_10042685 Ga0307413_100426853 277
119 3300031995 Ga0307409_100675521 Ga0307409_1006755211 277
120 3300032004 Ga0307414_10182632 Ga0307414_101826322 277
121 3300032004 Ga0307414_10421666 Ga0307414_104216661 277
122 3300032005 Ga0307411_10269420 Ga0307411_102694201 277
123 3300033180 Ga0307510_10016479 Ga0307510_100164795 277
124 3300046616 Ga0495668_0000105 Ga0495668_0000105_108332_109165 277
125 3300046648 Ga0495611_0014349 Ga0495611_0014349_1024_1857 277
126 3300047469 Ga0495673_0003529 Ga0495673_0003529_5183_6016 277
127 3300048909 Ga0496106_0176651 Ga0496106_0176651_760_1593 277
128 3300048917 Ga0496114_0295379 Ga0496114_0295379_68_901 277
129 3300048927 Ga0496124_0317790 Ga0496124_0317790_260_1093 277
130 3300048928 Ga0496125_0021157 Ga0496125_0021157_4370_5203 277
131 3300048929 Ga0496126_0003606 Ga0496126_0003606_13998_14831 277
132 3300050493 nmdc:mga0k408_66615_c1 nmdc:mga0k408_66615_c1_777_1613 277
133 3300050516 nmdc:mga0sz30_52249_c1 nmdc:mga0sz30_52249_c1_81_914 277
134 3300053111 Ga0500572_003417 Ga0500572_003417_2620_3453 277
135 3300053122 Ga0500608_000046 Ga0500608_000046_8245_9078 277
136 3300053136 Ga0500559_0007724 Ga0500559_0007724_3074_3907 277
137 3300053136 Ga0500559_0016039 Ga0500559_0016039_1639_2472 277
138 3300053730 Ga0500645_007392 Ga0500645_007392_1080_1913 277
139 iso_pu_bacteria 2582581280 2585155175 277
140 iso_pu_bacteria 2582581293 2585194856 277
141 iso_pu_bacteria 2585428106 2587917447 277
142 iso_pu_bacteria 2643221545 2643747346 277
143 iso_pu_bacteria 2643221552 2643782452 277
144 iso_pu_bacteria 2643221583 2643922728 277
145 iso_pu_bacteria 2643221584 2643929869 277
146 iso_pu_bacteria 2643221640 2644227031 277
147 iso_pu_bacteria 2643221642 2644233501 277
148 iso_pu_bacteria 2643221691 2644507455 277
149 iso_pu_bacteria 2818991435 2819538506 277
150 iso_pu_bacteria 2818991454 2819648049 277
151 iso_pu_bacteria 2884960567 2884961976 277
152 iso_pu_bacteria 2928531327 2928533391 277
153 3300003773 Ga0055537_1009086 Ga0055537_10090862 278
154 3300003775 Ga0055524_1004011 Ga0055524_10040111 278
155 3300025263 Ga0209565_1000179 Ga0209565_100017945 278
156 3300025273 Ga0209673_1001719 Ga0209673_100171917 278
157 3300025291 Ga0209675_1008538 Ga0209675_10085382 278
158 3300025297 Ga0209758_1002432 Ga0209758_100243219 278
159 3300025299 Ga0209256_1001534 Ga0209256_10015349 278
160 3300048918 Ga0496115_0001412 Ga0496115_0001412_12638_13474 278
161 3300053139 Ga0500568_0046559 Ga0500568_0046559_579_1415 278
162 3300037312 Ga0395899_0000018 Ga0395899_0000018_226367_227209 279
163 3300045049 Ga0466959_0041054 Ga0466959_0041054_2235_3077 279
164 3300046524 Ga0495648_0000072 Ga0495648_0000072_24420_25262 280
165 3300047469 Ga0495673_0000483 Ga0495673_0000483_28707_29549 280
166 3300053086 Ga0500578_0000124 Ga0500578_0000124_847_1689 280
167 3300053088 Ga0500644_0001127 Ga0500644_0001127_3134_3976 280
168 3300053108 Ga0500562_017345 Ga0500562_017345_31_873 280
169 3300053138 Ga0500564_001404 Ga0500564_001404_7428_8270 280
170 3300003322 rootL2_10044257 rootL2_100442572 281
171 3300003771 Ga0055526_1009776 Ga0055526_10097765 281
172 3300003794 Ga0055531_10003424 Ga0055531_100034245 281
173 3300005262 Ga0065165_1000795 Ga0065165_100079526 281
174 3300014326 Ga0157380_10228673 Ga0157380_102286732 281
175 3300025295 Ga0209564_1005116 Ga0209564_10051166 281
176 3300025295 Ga0209564_1021725 Ga0209564_10217252 281
177 3300025297 Ga0209758_1000562 Ga0209758_100056237 281
178 3300025298 Ga0209050_1019976 Ga0209050_10199763 281
179 3300025304 Ga0209257_1001017 Ga0209257_100101738 281
180 3300042436 Ga0439435_0005930 Ga0439435_0005930_1140_1988 281
181 3300046460 Ga0495638_0070033 Ga0495638_0070033_769_1617 281
182 3300046471 Ga0495650_0042660 Ga0495650_0042660_91_936 281
183 3300046506 Ga0495583_0000003 Ga0495583_0000003_143502_144347 281
184 3300046512 Ga0495610_0000478 Ga0495610_0000478_9274_10119 281
185 3300046542 Ga0495597_0042940 Ga0495597_0042940_284_1132 281
186 3300046616 Ga0495668_0011242 Ga0495668_0011242_2427_3275 281
187 3300046616 Ga0495668_0044529 Ga0495668_0044529_804_1649 281
188 3300046660 Ga0495625_0007966 Ga0495625_0007966_5545_6390 281
189 3300046660 Ga0495625_0030996 Ga0495625_0030996_1042_1887 281
190 3300046660 Ga0495625_0084272 Ga0495625_0084272_1086_1934 281
191 3300046692 Ga0495671_0092396 Ga0495671_0092396_29_874 281
192 3300046810 Ga0495660_0012923 Ga0495660_0012923_435_1280 281
193 3300003781 Ga0055536_1003796 Ga0055536_10037963 282
194 3300003791 Ga0055530_10011635 Ga0055530_100116352 282
195 3300003794 Ga0055531_10000749 Ga0055531_1000074912 282
196 3300006353 Ga0075370_10069650 Ga0075370_100696503 282
197 3300025292 Ga0209676_1000282 Ga0209676_100028240 282
198 3300025298 Ga0209050_1005457 Ga0209050_10054573 282
199 3300025304 Ga0209257_1000332 Ga0209257_100033234 282
200 3300028794 Ga0307515_10038866 Ga0307515_100388668 282
201 3300046453 Ga0495627_000511 Ga0495627_000511_3088_3939 282
202 3300046660 Ga0495625_0000676 Ga0495625_0000676_6572_7420 282
203 3300047472 Ga0495686_0021271 Ga0495686_0021271_706_1554 282
204 3300050496 nmdc:mga07m45_162653_c1 nmdc:mga07m45_162653_c1_273_1121 282
205 3300053122 Ga0500608_000812 Ga0500608_000812_9800_10654 284
206 3300003320 rootH2_10079488 rootH2_100794882 287
207 3300003320 rootH2_10079489 rootH2_100794891 287
208 3300015684 Ga0183365_10001 Ga0183365_10001293 287
209 3300037471 Ga0395905_0000173 Ga0395905_0000173_71123_71986 287
210 3300044656 Ga0466969_0000943 Ga0466969_0000943_9757_10620 287
211 3300044684 Ga0466966_0001737 Ga0466966_0001737_9708_10571 287
212 3300044693 Ga0466961_0002986 Ga0466961_0002986_632_1495 287
213 3300044719 Ga0466971_0003439 Ga0466971_0003439_3329_4192 287
214 3300044765 Ga0466970_0013074 Ga0466970_0013074_126_989 287
215 3300045049 Ga0466959_0023194 Ga0466959_0023194_2621_3484 287
216 3300045836 Ga0466958_0032326 Ga0466958_0032326_1142_2005 287
217 3300049570 Ga0501033_0024128 Ga0501033_0024128_3646_4509 287
218 3300049571 Ga0501034_0024843 Ga0501034_0024843_2631_3494 287
219 3300049822 Ga0501035_0007591 Ga0501035_0007591_6433_7296 287
220 3300061719 Ga0466962_0004221 Ga0466962_0004221_4841_5704 287
221 3300061719 Ga0466962_0079555 Ga0466962_0079555_353_1216 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18348

SH3_16

Bacterial dipeptidyl-peptidase Sh3 domain

63

111

0.95

PF00877

NLPC_P60

NlpC/P60 family

191

287

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pvq-assembly1.cif.gz_B crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution 0.8698 38 287
4r0k-assembly1.cif.gz_A crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 1.75 a resolution 0.8633 37 287
3npf-assembly1.cif.gz_B crystal structure of a putative dipeptidyl-peptidase vi (bacova_00612) from bacteroides ovatus at 1.72 a resolution 0.8493 37 287
7v6t-assembly2.cif.gz_B crystal structure of bacterial peptidase 0.8229 168 287
7v6s-assembly2.cif.gz_B crystal structure of bacterial peptidase 0.8133 168 287
ID Description Score Start End Superfamily
4m4zA01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8762 62 98 2.30.30.40
af_P71594_92_276_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.8695 168 286 3.90.1720.10
4krtA02 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.866 101 159 2.30.30.40
4r0kB02 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8597 38 98 2.30.30.40
af_P0ADT8_18_85_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8483 33 96 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A7C2KF70-F1-model_v4 SH3 domain-containing protein 0.9743 37 98
AF-A0A258D7I1-F1-model_v4 Hydrolase Nlp/P60 0.9738 9 287 GO:0008234
AF-A0A1G2W9H9-F1-model_v4 Hydrolase Nlp/P60 0.9719 9 287 GO:0008234
AF-A0A2E4QR14-F1-model_v4 NlpC/P60 domain-containing protein 0.9699 8 286 GO:0008234
AF-A0A2N5DQH5-F1-model_v4 Hydrolase Nlp/P60 0.9698 9 287 GO:0008234

Feature Viewer

pLDDT pTM Quality
93.11 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map