F332909

General Info

Members Datasets Scaffolds Average Seq Length
221 145 442 257

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10231948|rootH1_102319483
Length 280
Sequence VPGTTSVAAPVAYYVASQPEVRVTIWSLFPAAGLGACLALALVVWAISLPLRDASIVDGAWAFLIWLPAAVVAWRIAVPGPRTVLVLALSLAWALRLSGYILWRHRGQPEDRRYQAIRQRNEPHFGLKSLYLVFGLQAVLAWVVSLPLMAAVASAAAWNLVDVVGIALALAGLAFEAVADAQLAAFKARNPQGGKVMSSGLWRYSRHPNYFGECCVWWGLWLIALAAGAWWTIVSPLLMTALLLKVSGVPLLEKSIVDHRPEYRDYMSRTRAFVPGPPRG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
87 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
95 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
96 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
97 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
145 2738543013 Variovorax sp. BT01 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0.45
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 0.45
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10231948 3300003323 Bacteria 2278
2 rootH1_10047756 3300003323 Bacteria 2783
3 Ga0055536_1033490 3300003781 Bacteria 1312
4 Ga0055534_1000294 3300003784 Bacteria 33412
5 Ga0065704_10176241 3300005289 Bacteria 1262
6 Ga0070676_10038554 3300005328 Bacteria 2760
7 Ga0070690_100008959 3300005330 Bacteria 5783
8 Ga0070670_100025534 3300005331 Bacteria 5082
9 Ga0070670_100138367 3300005331 Bacteria 2105
10 Ga0070670_100348111 3300005331 Unclassified 1301
11 Ga0070677_10034514 3300005333 Bacteria 1955
12 Ga0068869_100037153 3300005334 Bacteria 3462
13 Ga0070666_10011926 3300005335 Bacteria 5468
14 Ga0068868_100005546 3300005338 Bacteria 8877
15 Ga0070689_100125687 3300005340 Bacteria 2052
16 Ga0070668_100364017 3300005347 Bacteria 1227
17 Ga0070669_100056053 3300005353 Bacteria 2889
18 Ga0070675_100000322 3300005354 Bacteria 32261
19 Ga0070671_100005747 3300005355 Bacteria 9878
20 Ga0070673_100003663 3300005364 Bacteria 9615
21 Ga0070688_100009110 3300005365 Bacteria 5414
22 Ga0070667_100004536 3300005367 Bacteria 11691
23 Ga0070662_100021231 3300005457 Bacteria 4432
24 Ga0070672_100357914 3300005543 Bacteria 1245
25 Ga0070665_100242934 3300005548 Bacteria 1801
26 Ga0070665_100259274 3300005548 Bacteria 1740
27 Ga0070664_100312545 3300005564 Bacteria 1422
28 Ga0068859_100172280 3300005617 Bacteria 2246
29 Ga0068864_100001659 3300005618 Bacteria 18328
30 Ga0068864_100002673 3300005618 Bacteria 14717
31 Ga0068864_100234572 3300005618 Bacteria 1698
32 Ga0068870_10098895 3300005840 Bacteria 1645
33 Ga0068863_100003483 3300005841 Bacteria 15528
34 Ga0068863_100003829 3300005841 Bacteria 14873
35 Ga0068858_100002097 3300005842 Bacteria 20257
36 Ga0068860_100060416 3300005843 Bacteria 3602
37 Ga0097621_100008071 3300006237 Bacteria 7562
38 Ga0075370_10005222 3300006353 Bacteria 6425
39 Ga0068871_100014300 3300006358 Bacteria 5913
40 Ga0075428_100002798 3300006844 Bacteria 18984
41 Ga0075431_100008309 3300006847 Bacteria 10383
42 Ga0075429_100003367 3300006880 Bacteria 13628
43 Ga0097620_100172277 3300006931 Bacteria 2246
44 Ga0114129_10181644 3300009147 Bacteria 2862
45 Ga0105248_10004220 3300009177 Bacteria 15895
46 Ga0157374_10113269 3300013296 Bacteria 2611
47 Ga0163162_10003654 3300013306 Bacteria 14761
48 Ga0157375_10021809 3300013308 Bacteria 5883
49 Ga0157375_10153293 3300013308 Bacteria 2441
50 Ga0163163_10002124 3300014325 Bacteria 16736
51 Ga0157380_10179999 3300014326 Bacteria 1856
52 Ga0157379_10001849 3300014968 Bacteria 17505
53 Ga0157379_10048600 3300014968 Bacteria 3787
54 Ga0157376_10001793 3300014969 Bacteria 14290
55 Ga0163161_10043875 3300017792 Bacteria 3220
56 Ga0213872_10003654 3300021361 Bacteria 8436
57 Ga0209130_1005389 3300025284 Bacteria 4454
58 Ga0209675_1002197 3300025291 Bacteria 10232
59 Ga0209676_1019681 3300025292 Bacteria 2315
60 Ga0209050_1022957 3300025298 Bacteria 2214
61 Ga0209051_1023859 3300025303 Bacteria 2532
62 Ga0207682_10020553 3300025893 Bacteria 2592
63 Ga0207680_10002935 3300025903 Bacteria 7997
64 Ga0207645_10094973 3300025907 Bacteria 1920
65 Ga0207643_10207230 3300025908 Bacteria 1196
66 Ga0207705_10205502 3300025909 Bacteria 1493
67 Ga0207650_10035217 3300025925 Bacteria 3634
68 Ga0207650_10075284 3300025925 Bacteria 2547
69 Ga0207659_10000640 3300025926 Bacteria 20764
70 Ga0207659_10049217 3300025926 Bacteria 2989
71 Ga0207644_10004942 3300025931 Bacteria 8697
72 Ga0207706_10031268 3300025933 Bacteria 4743
73 Ga0207670_10044847 3300025936 Bacteria 2928
74 Ga0207691_10152509 3300025940 Bacteria 2031
75 Ga0207691_10271082 3300025940 Bacteria 1461
76 Ga0207691_10277121 3300025940 Bacteria 1444
77 Ga0207711_10005854 3300025941 Bacteria 10381
78 Ga0207651_10000545 3300025960 Bacteria 15776
79 Ga0207651_10060785 3300025960 Bacteria 2625
80 Ga0207668_10042636 3300025972 Bacteria 3074
81 Ga0207668_10318161 3300025972 Bacteria 1290
82 Ga0207658_10004868 3300025986 Bacteria 9274
83 Ga0207677_10010110 3300026023 Bacteria 5327
84 Ga0207703_10019327 3300026035 Bacteria 5322
85 Ga0207641_10003669 3300026088 Bacteria 13524
86 Ga0207641_10010918 3300026088 Bacteria 7443
87 Ga0207648_10016566 3300026089 Bacteria 6729
88 Ga0207648_10020052 3300026089 Bacteria 6031
89 Ga0207648_10413895 3300026089 Bacteria 1223
90 Ga0207676_10001599 3300026095 Bacteria 16693
91 Ga0207676_10005847 3300026095 Bacteria 8692
92 Ga0207675_100185250 3300026118 Bacteria 1995
93 Ga0207683_10018952 3300026121 Bacteria 5872
94 Ga0207698_10224000 3300026142 Bacteria 1702
95 Ga0209970_1003976 3300027614 Bacteria 2468
96 Ga0268266_10149659 3300028379 Bacteria 2103
97 Ga0268266_10205457 3300028379 Bacteria 1804
98 Ga0268264_10032832 3300028381 Bacteria 4260
99 Ga0265330_10024808 3300031235 Bacteria 2719
100 Ga0316576_10004779 3300031727 Bacteria 8179
101 Ga0316576_10029425 3300031727 Bacteria 3883
102 Ga0316576_10104310 3300031727 Bacteria 2121
103 Ga0316576_10165378 3300031727 Bacteria 1669
104 Ga0316576_10255945 3300031727 Bacteria 1314
105 Ga0316578_10016321 3300031728 Bacteria 4015
106 Ga0316578_10031855 3300031728 Bacteria 3007
107 Ga0316578_10036189 3300031728 Bacteria 2841
108 Ga0316578_10036409 3300031728 Bacteria 2832
109 Ga0316578_10050062 3300031728 Bacteria 2443
110 Ga0316577_10006955 3300031733 Bacteria 6012
111 Ga0316577_10009360 3300031733 Bacteria 5270
112 Ga0316577_10079437 3300031733 Bacteria 1833
113 Ga0307409_100053656 3300031995 Bacteria 3099
114 Ga0307411_10017780 3300032005 Bacteria 4063
115 Ga0316583_10062485 3300032133 Bacteria 1304
116 Ga0316585_10003664 3300032137 Bacteria 4236
117 Ga0316580_10014297 3300032139 Bacteria 2423
118 Ga0316580_10051832 3300032139 Bacteria 1264
119 Ga0316580_10086575 3300032139 Unclassified 958
120 Ga0316593_10043236 3300032168 Bacteria 1505
121 Ga0316574_0000362 3300035398 Bacteria 17630
122 Ga0316574_0001139 3300035398 Bacteria 12224
123 Ga0316574_0104308 3300035398 Bacteria 1815
124 Ga0316574_0169975 3300035398 Bacteria 1403
125 Ga0316582_0005695 3300036647 Bacteria 6453
126 Ga0316582_0056181 3300036647 Bacteria 2510
127 Ga0316582_0057109 3300036647 Bacteria 2493
128 Ga0316584_0004749 3300036712 Bacteria 9009
129 Ga0316584_0008367 3300036712 Bacteria 7125
130 Ga0316584_0017120 3300036712 Bacteria 5205
131 Ga0316584_0028802 3300036712 Bacteria 4099
132 Ga0316584_0030260 3300036712 Bacteria 4000
133 Ga0316584_0218952 3300036712 Bacteria 1399
134 Ga0400483_043790 3300039062 Bacteria 4661
135 Ga0400483_176448 3300039062 Bacteria 2931
136 Ga0400483_287633 3300039062 Bacteria 1173
137 Ga0436361_0003285 3300039447 Unclassified 912
138 Ga0436361_0115897 3300039447 Bacteria 5615
139 Ga0436361_0183840 3300039447 Bacteria 2375
140 Ga0450920_001626 3300042122 Bacteria 3749
141 Ga0450894_026451 3300042131 Bacteria 797
142 Ga0450895_000185 3300042132 Bacteria 3005
143 Ga0450907_010482 3300042146 Bacteria 1538
144 Ga0439446_0121984 3300042156 Unclassified 839
145 Ga0450908_007029 3300042184 Bacteria 2130
146 Ga0451577_0199664 3300042876 Bacteria 1805
147 Ga0453684_0050351 3300044712 Bacteria 5481
148 Ga0495592_0000182 3300046454 Bacteria 55441
149 Ga0495630_0195572 3300046517 Bacteria 1543
150 Ga0495632_0038708 3300046519 Bacteria 2413
151 Ga0495666_0226551 3300046526 Bacteria 855
152 Ga0495622_0034846 3300046557 Bacteria 2348
153 Ga0495676_0024254 3300047321 Bacteria 5255
154 Ga0495686_0000872 3300047472 Bacteria 38466
155 Ga0496109_0247128 3300048912 Bacteria 1680
156 Ga0501032_0003555 3300049569 Bacteria 11888
157 Ga0501033_0134933 3300049570 Bacteria 1786
158 Ga0501036_0005438 3300049572 Bacteria 10321
159 Ga0501037_0330238 3300049573 Bacteria 1055
160 Ga0501038_0013051 3300049574 Bacteria 7578
161 Ga0501038_0130683 3300049574 Bacteria 2062
162 Ga0501038_0369085 3300049574 Bacteria 1115
163 Ga0501039_0104233 3300049575 Bacteria 2214
164 Ga0501040_0033652 3300049576 Bacteria 3473
165 Ga0501040_0155949 3300049576 Bacteria 1612
166 Ga0501041_0002113 3300049577 Bacteria 11203
167 Ga0501041_0062527 3300049577 Bacteria 2279
168 Ga0501042_0005390 3300049578 Bacteria 8232
169 Ga0501042_0037787 3300049578 Bacteria 3427
170 Ga0501043_0055263 3300049579 Bacteria 3119
171 Ga0501043_0106012 3300049579 Bacteria 2208
172 Ga0501047_0209538 3300049581 Bacteria 1808
173 Ga0501047_0370359 3300049581 Bacteria 1267
174 Ga0501048_0101901 3300049582 Bacteria 2025
175 Ga0501048_0146216 3300049582 Bacteria 1672
176 Ga0501068_0062842 3300049584 Bacteria 2258
177 Ga0501068_0115327 3300049584 Bacteria 1673
178 Ga0501069_0202873 3300049585 Bacteria 1149
179 Ga0501071_0029888 3300049587 Bacteria 3849
180 Ga0501071_0083733 3300049587 Bacteria 2337
181 Ga0501072_0091316 3300049588 Bacteria 2418
182 Ga0501072_0286599 3300049588 Bacteria 1309
183 Ga0501073_0072310 3300049589 Bacteria 2402
184 Ga0501074_0035379 3300049590 Bacteria 3619
185 Ga0501074_0137816 3300049590 Bacteria 1746
186 Ga0501075_0018889 3300049591 Bacteria 4996
187 Ga0501075_0025933 3300049591 Bacteria 4309
188 Ga0501075_0136249 3300049591 Bacteria 1870
189 Ga0501076_0004178 3300049592 Bacteria 10230
190 Ga0501076_0041365 3300049592 Bacteria 3625
191 Ga0501076_0047296 3300049592 Bacteria 3401
192 Ga0501079_0033476 3300049741 Bacteria 3953
193 Ga0501079_0056337 3300049741 Bacteria 3033
194 Ga0501079_0057136 3300049741 Bacteria 3011
195 Ga0501081_0008828 3300049743 Bacteria 6553
196 Ga0501081_0031946 3300049743 Bacteria 3569
197 Ga0501081_0078712 3300049743 Bacteria 2305
198 Ga0501081_0113484 3300049743 Bacteria 1924
199 Ga0501083_0195458 3300049744 Bacteria 1320
200 Ga0501035_0060374 3300049822 Bacteria 3375
201 Ga0501035_0152657 3300049822 Bacteria 2003
202 Ga0501035_0183028 3300049822 Bacteria 1804
203 Ga0501035_0305707 3300049822 Bacteria 1339
204 Ga0501035_0480559 3300049822 Bacteria 1025
205 Ga0501044_0078433 3300049823 Bacteria 3347
206 Ga0501044_0126536 3300049823 Bacteria 2552
207 Ga0501045_0009888 3300049824 Bacteria 6673
208 Ga0501045_0286095 3300049824 Bacteria 1227
209 nmdc:mga05p37_131805_c1 3300050507 Bacteria 3067
210 nmdc:mga09592_2185_c1 3300050508 Bacteria 15760
211 nmdc:mga06r32_758_c1 3300050510 Bacteria 28437
212 Ga0500651_0190183 3300053093 Bacteria 1215
213 Ga0500622_0001901 3300053156 Bacteria 15758
214 Ga0500587_002256 3300053739 Bacteria 2748
215 Ga0501084_0032420 3300054114 Bacteria 4371
216 Ga0501084_0353637 3300054114 Bacteria 1241
217 Ga0501082_0063928 3300060353 Bacteria 3168
218 Ga0501082_0065422 3300060353 Bacteria 3131
219 Ga0501082_0419665 3300060353 Bacteria 1168
220 2588290029 2588253510 Bacteria 6901809
221 2739252463 2738543013 Bacteria 5618633
222 rootH1_10231948
223 rootH1_10047756
224 Ga0055536_1033490
225 Ga0055534_1000294
226 Ga0065704_10176241
227 Ga0070676_10038554
228 Ga0070690_100008959
229 Ga0070670_100025534
230 Ga0070670_100138367
231 Ga0070670_100348111
232 Ga0070677_10034514
233 Ga0068869_100037153
234 Ga0070666_10011926
235 Ga0068868_100005546
236 Ga0070689_100125687
237 Ga0070668_100364017
238 Ga0070669_100056053
239 Ga0070675_100000322
240 Ga0070671_100005747
241 Ga0070673_100003663
242 Ga0070688_100009110
243 Ga0070667_100004536
244 Ga0070662_100021231
245 Ga0070672_100357914
246 Ga0070665_100242934
247 Ga0070665_100259274
248 Ga0070664_100312545
249 Ga0068859_100172280
250 Ga0068864_100001659
251 Ga0068864_100002673
252 Ga0068864_100234572
253 Ga0068870_10098895
254 Ga0068863_100003483
255 Ga0068863_100003829
256 Ga0068858_100002097
257 Ga0068860_100060416
258 Ga0097621_100008071
259 Ga0075370_10005222
260 Ga0068871_100014300
261 Ga0075428_100002798
262 Ga0075431_100008309
263 Ga0075429_100003367
264 Ga0097620_100172277
265 Ga0114129_10181644
266 Ga0105248_10004220
267 Ga0157374_10113269
268 Ga0163162_10003654
269 Ga0157375_10021809
270 Ga0157375_10153293
271 Ga0163163_10002124
272 Ga0157380_10179999
273 Ga0157379_10001849
274 Ga0157379_10048600
275 Ga0157376_10001793
276 Ga0163161_10043875
277 Ga0213872_10003654
278 Ga0209130_1005389
279 Ga0209675_1002197
280 Ga0209676_1019681
281 Ga0209050_1022957
282 Ga0209051_1023859
283 Ga0207682_10020553
284 Ga0207680_10002935
285 Ga0207645_10094973
286 Ga0207643_10207230
287 Ga0207705_10205502
288 Ga0207650_10035217
289 Ga0207650_10075284
290 Ga0207659_10000640
291 Ga0207659_10049217
292 Ga0207644_10004942
293 Ga0207706_10031268
294 Ga0207670_10044847
295 Ga0207691_10152509
296 Ga0207691_10271082
297 Ga0207691_10277121
298 Ga0207711_10005854
299 Ga0207651_10000545
300 Ga0207651_10060785
301 Ga0207668_10042636
302 Ga0207668_10318161
303 Ga0207658_10004868
304 Ga0207677_10010110
305 Ga0207703_10019327
306 Ga0207641_10003669
307 Ga0207641_10010918
308 Ga0207648_10016566
309 Ga0207648_10020052
310 Ga0207648_10413895
311 Ga0207676_10001599
312 Ga0207676_10005847
313 Ga0207675_100185250
314 Ga0207683_10018952
315 Ga0207698_10224000
316 Ga0209970_1003976
317 Ga0268266_10149659
318 Ga0268266_10205457
319 Ga0268264_10032832
320 Ga0265330_10024808
321 Ga0316576_10004779
322 Ga0316576_10029425
323 Ga0316576_10104310
324 Ga0316576_10165378
325 Ga0316576_10255945
326 Ga0316578_10016321
327 Ga0316578_10031855
328 Ga0316578_10036189
329 Ga0316578_10036409
330 Ga0316578_10050062
331 Ga0316577_10006955
332 Ga0316577_10009360
333 Ga0316577_10079437
334 Ga0307409_100053656
335 Ga0307411_10017780
336 Ga0316583_10062485
337 Ga0316585_10003664
338 Ga0316580_10014297
339 Ga0316580_10051832
340 Ga0316580_10086575
341 Ga0316593_10043236
342 Ga0316574_0000362
343 Ga0316574_0001139
344 Ga0316574_0104308
345 Ga0316574_0169975
346 Ga0316582_0005695
347 Ga0316582_0056181
348 Ga0316582_0057109
349 Ga0316584_0004749
350 Ga0316584_0008367
351 Ga0316584_0017120
352 Ga0316584_0028802
353 Ga0316584_0030260
354 Ga0316584_0218952
355 Ga0400483_043790
356 Ga0400483_176448
357 Ga0400483_287633
358 Ga0436361_0003285
359 Ga0436361_0115897
360 Ga0436361_0183840
361 Ga0450920_001626
362 Ga0450894_026451
363 Ga0450895_000185
364 Ga0450907_010482
365 Ga0439446_0121984
366 Ga0450908_007029
367 Ga0451577_0199664
368 Ga0453684_0050351
369 Ga0495592_0000182
370 Ga0495630_0195572
371 Ga0495632_0038708
372 Ga0495666_0226551
373 Ga0495622_0034846
374 Ga0495676_0024254
375 Ga0495686_0000872
376 Ga0496109_0247128
377 Ga0501032_0003555
378 Ga0501033_0134933
379 Ga0501036_0005438
380 Ga0501037_0330238
381 Ga0501038_0013051
382 Ga0501038_0130683
383 Ga0501038_0369085
384 Ga0501039_0104233
385 Ga0501040_0033652
386 Ga0501040_0155949
387 Ga0501041_0002113
388 Ga0501041_0062527
389 Ga0501042_0005390
390 Ga0501042_0037787
391 Ga0501043_0055263
392 Ga0501043_0106012
393 Ga0501047_0209538
394 Ga0501047_0370359
395 Ga0501048_0101901
396 Ga0501048_0146216
397 Ga0501068_0062842
398 Ga0501068_0115327
399 Ga0501069_0202873
400 Ga0501071_0029888
401 Ga0501071_0083733
402 Ga0501072_0091316
403 Ga0501072_0286599
404 Ga0501073_0072310
405 Ga0501074_0035379
406 Ga0501074_0137816
407 Ga0501075_0018889
408 Ga0501075_0025933
409 Ga0501075_0136249
410 Ga0501076_0004178
411 Ga0501076_0041365
412 Ga0501076_0047296
413 Ga0501079_0033476
414 Ga0501079_0056337
415 Ga0501079_0057136
416 Ga0501081_0008828
417 Ga0501081_0031946
418 Ga0501081_0078712
419 Ga0501081_0113484
420 Ga0501083_0195458
421 Ga0501035_0060374
422 Ga0501035_0152657
423 Ga0501035_0183028
424 Ga0501035_0305707
425 Ga0501035_0480559
426 Ga0501044_0078433
427 Ga0501044_0126536
428 Ga0501045_0009888
429 Ga0501045_0286095
430 nmdc:mga05p37_131805_c1
431 nmdc:mga09592_2185_c1
432 nmdc:mga06r32_758_c1
433 Ga0500651_0190183
434 Ga0500622_0001901
435 Ga0500587_002256
436 Ga0501084_0032420
437 Ga0501084_0353637
438 Ga0501082_0063928
439 Ga0501082_0065422
440 Ga0501082_0419665
441 2588290029
442 2739252463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

44

270

0.96

PF02544

Steroid_dh

3-oxo-5-alpha-steroid 4-dehydrogenase

132

248

0.84

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

164

256

0.83

PF04191

PEMT

Phospholipid methyltransferase

160

256

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4926 4 240
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.4923 27 239
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4782 4 240
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.4676 56 239
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.4351 27 239
ID Description Score Start End Superfamily
af_O53731_51_249_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7956 52 240 1.20.120.1630
af_I1MK93_104_313_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7805 54 240 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7768 54 240 1.20.120.1630
af_C6TD75_105_305_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7681 54 240 1.20.120.1630
af_Q54W87_65_266_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7602 54 240 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A5C7A5B8-F1-model_v4 DUF1295 domain-containing protein 0.9628 2 141 GO:0016020
AF-A0A0S8DRE3-F1-model_v4 Steroid 5-alpha reductase C-terminal domain-containing protein 0.958 2 141 GO:0016020
AF-A0A7X9DJ03-F1-model_v4 DUF1295 domain-containing protein 0.9132 2 141 GO:0016020
AF-A0A0S8KMY9-F1-model_v4 Steroid 5-alpha reductase 0.9095 2 125 GO:0016020
AF-A0A521KW62-F1-model_v4 DUF1295 domain-containing protein 0.8858 2 117 GO:0016020

Map