F332878

General Info

Members Datasets Scaffolds Average Seq Length
221 156 219 241

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10010814|JGI24739J22299_100108143
Length 251
Sequence MAESSIEWTELTWNPVTGCKKISPGCKFCYAEVMTRRLKAMGQEKYKDGFKVIKTHPESLNIPFTWKRPKVVFVNSMSDLFHDEIPLDYIKAVFLVMNQTPQHIYQVLTKRSDRLLKVANQLNWTPNIWMGVSVENDKYLYRVDDLQKVPAKTRFLSIEPLLGPVADLTLEGINWVIVGGESGHGARPLKYEWIESIRVNCEGNSVPFFFKQWGKPKFNIDPNDPTIDKLHPKHAKGGCQLNGKIYRELPN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
3 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
102 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
132 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.07
Nodule 0
Rhizoplane 0
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_577364 2162886007 Bacteria 146603
2 JGI24739J22299_10010814 3300001989 Bacteria 3379
3 JGI24737J22298_10000141 3300001990 Bacteria 22274
4 JGI24735J21928_10000045 3300002067 Bacteria 54187
5 rootH1_10169912 3300003316 Bacteria 1847
6 rootH2_10012921 3300003320 Bacteria 38639
7 rootH2_10094656 3300003320 Bacteria 14010
8 rootL2_10093367 3300003322 Bacteria 4514
9 rootH1_10013549 3300003323 Bacteria 14153
10 rootH1_10022039 3300003323 Bacteria 14688
11 Ga0070670_100027952 3300005331 Bacteria 4853
12 Ga0070670_100095131 3300005331 Unclassified 2562
13 Ga0070682_100151145 3300005337 Bacteria 1593
14 Ga0070660_100008393 3300005339 Bacteria 7222
15 Ga0070660_100319768 3300005339 Bacteria 1275
16 Ga0070689_100339825 3300005340 Bacteria 1257
17 Ga0070687_100256021 3300005343 Bacteria 1090
18 Ga0070668_100175464 3300005347 Unclassified 1747
19 Ga0070671_100302318 3300005355 Unclassified 1362
20 Ga0070714_100012821 3300005435 Bacteria 6699
21 Ga0070711_100149403 3300005439 Bacteria 1760
22 Ga0070663_100089913 3300005455 Bacteria 2273
23 Ga0070662_100027143 3300005457 Bacteria 3971
24 Ga0068867_100647385 3300005459 Bacteria 927
25 Ga0070698_100693391 3300005471 Bacteria 960
26 Ga0070679_100008050 3300005530 Bacteria 9906
27 Ga0070665_100614031 3300005548 Bacteria 1100
28 Ga0068855_100096705 3300005563 Bacteria 3401
29 Ga0068855_100347707 3300005563 Bacteria 1634
30 Ga0070664_100033247 3300005564 Bacteria 4318
31 Ga0068852_100018094 3300005616 Bacteria 5544
32 Ga0068859_100000277 3300005617 Bacteria 51115
33 Ga0068859_100015656 3300005617 Bacteria 7621
34 Ga0068859_100186777 3300005617 Bacteria 2156
35 Ga0068859_100315274 3300005617 Bacteria 1658
36 Ga0068861_100031547 3300005719 Bacteria 3893
37 Ga0068870_10048966 3300005840 Bacteria 2227
38 Ga0068870_10092952 3300005840 Unclassified 1690
39 Ga0068863_100002942 3300005841 Bacteria 16829
40 Ga0068863_100097133 3300005841 Bacteria 2797
41 Ga0068858_100024441 3300005842 Bacteria 5629
42 Ga0068860_100040695 3300005843 Unclassified 4441
43 Ga0068860_100954948 3300005843 Bacteria 874
44 Ga0068862_100014768 3300005844 Bacteria 6486
45 Ga0068862_100052219 3300005844 Bacteria 3497
46 Ga0068862_100081458 3300005844 Bacteria 2808
47 Ga0068862_101045698 3300005844 Bacteria 809
48 Ga0081539_10001598 3300005985 Bacteria 37363
49 Ga0070716_100087475 3300006173 Bacteria 1877
50 Ga0075366_10014567 3300006195 Bacteria 4492
51 Ga0097621_100028493 3300006237 Bacteria 4401
52 Ga0068871_100042506 3300006358 Bacteria 3648
53 Ga0075431_100001168 3300006847 Bacteria 23668
54 Ga0075429_100177013 3300006880 Bacteria 1869
55 Ga0075429_100214455 3300006880 Bacteria 1686
56 Ga0075429_100400869 3300006880 Bacteria 1201
57 Ga0075429_100535393 3300006880 Bacteria 1026
58 Ga0097620_100000277 3300006931 Bacteria 51115
59 Ga0097620_100015656 3300006931 Bacteria 7621
60 Ga0097620_100186791 3300006931 Bacteria 2156
61 Ga0097620_100315277 3300006931 Bacteria 1658
62 Ga0105240_10002314 3300009093 Bacteria 30827
63 Ga0111539_10003341 3300009094 Bacteria 21191
64 Ga0111539_10009734 3300009094 Bacteria 12132
65 Ga0105245_10103377 3300009098 Bacteria 2639
66 Ga0105247_10001830 3300009101 Bacteria 14909
67 Ga0105247_10008446 3300009101 Bacteria 6275
68 Ga0114129_10007138 3300009147 Bacteria 15900
69 Ga0105241_10001565 3300009174 Bacteria 17507
70 Ga0105242_10000158 3300009176 Bacteria 50486
71 Ga0105237_10007083 3300009545 Bacteria 12330
72 Ga0105237_10194813 3300009545 Bacteria 2026
73 Ga0105238_10054400 3300009551 Bacteria 4019
74 Ga0105249_10049652 3300009553 Bacteria 3826
75 Ga0105239_10002053 3300010375 Bacteria 26110
76 Ga0105239_10878630 3300010375 Bacteria 1029
77 Ga0105246_10001343 3300011119 Bacteria 14506
78 Ga0157373_10001495 3300013100 Bacteria 17823
79 Ga0157373_10390779 3300013100 Bacteria 996
80 Ga0157373_10553458 3300013100 Bacteria 834
81 Ga0157371_10013451 3300013102 Bacteria 6214
82 Ga0157371_10197945 3300013102 Bacteria 1440
83 Ga0157371_10310802 3300013102 Bacteria 1142
84 Ga0157370_10109679 3300013104 Bacteria 2580
85 Ga0157369_10384847 3300013105 Bacteria 1456
86 Ga0157374_10000025 3300013296 Bacteria 245131
87 Ga0157378_10043576 3300013297 Bacteria 3985
88 Ga0157378_10064520 3300013297 Bacteria 3276
89 Ga0163162_10000903 3300013306 Bacteria 27662
90 Ga0163162_10176423 3300013306 Unclassified 2262
91 Ga0163162_10208280 3300013306 Bacteria 2085
92 Ga0157372_10001968 3300013307 Bacteria 22351
93 Ga0157372_10023764 3300013307 Bacteria 6649
94 Ga0157372_10219649 3300013307 Bacteria 2203
95 Ga0157372_10435898 3300013307 Bacteria 1527
96 Ga0163163_10214464 3300014325 Bacteria 1974
97 Ga0163163_10214688 3300014325 Bacteria 1973
98 Ga0163163_10284371 3300014325 Bacteria 1706
99 Ga0157380_10125129 3300014326 Unclassified 2184
100 Ga0157380_10428761 3300014326 Bacteria 1263
101 Ga0157379_10138668 3300014968 Unclassified 2192
102 Ga0157376_10025212 3300014969 Bacteria 4681
103 Ga0157376_10147892 3300014969 Bacteria 2115
104 Ga0207710_10001504 3300025900 Bacteria 11546
105 Ga0207710_10011054 3300025900 Bacteria 3802
106 Ga0207647_10378082 3300025904 Bacteria 800
107 Ga0207705_10006762 3300025909 Bacteria 8478
108 Ga0207705_10010838 3300025909 Bacteria 6619
109 Ga0207707_10127574 3300025912 Bacteria 2225
110 Ga0207695_10005344 3300025913 Bacteria 17086
111 Ga0207671_10004264 3300025914 Bacteria 13762
112 Ga0207671_10113694 3300025914 Bacteria 2062
113 Ga0207660_10042886 3300025917 Bacteria 3178
114 Ga0207660_10259064 3300025917 Bacteria 1375
115 Ga0207657_10015993 3300025919 Bacteria 7244
116 Ga0207652_10001276 3300025921 Bacteria 22439
117 Ga0207694_10363394 3300025924 Unclassified 1200
118 Ga0207650_10029387 3300025925 Bacteria 3951
119 Ga0207650_10128564 3300025925 Unclassified 1980
120 Ga0207664_10117027 3300025929 Unclassified 2224
121 Ga0207644_10361533 3300025931 Unclassified 1181
122 Ga0207690_10554723 3300025932 Bacteria 934
123 Ga0207706_10498364 3300025933 Bacteria 1051
124 Ga0207686_10000878 3300025934 Bacteria 18181
125 Ga0207670_10163678 3300025936 Bacteria 1663
126 Ga0207665_10184843 3300025939 Bacteria 1511
127 Ga0207661_10114037 3300025944 Bacteria 2291
128 Ga0207667_10553036 3300025949 Bacteria 1164
129 Ga0207712_10100831 3300025961 Bacteria 2146
130 Ga0207712_10137065 3300025961 Bacteria 1873
131 Ga0207668_10245404 3300025972 Unclassified 1451
132 Ga0207668_10631411 3300025972 Unclassified 936
133 Ga0207677_10090156 3300026023 Bacteria 2227
134 Ga0207677_10225546 3300026023 Bacteria 1506
135 Ga0207703_10020735 3300026035 Bacteria 5142
136 Ga0207678_10108923 3300026067 Bacteria 2363
137 Ga0207678_10223854 3300026067 Bacteria 1610
138 Ga0207641_10000442 3300026088 Bacteria 47467
139 Ga0207648_10521869 3300026089 Bacteria 1088
140 Ga0207675_100188599 3300026118 Unclassified 1977
141 Ga0207698_10008780 3300026142 Bacteria 6408
142 Ga0207428_10089598 3300027907 Bacteria 2390
143 Ga0268266_10493412 3300028379 Bacteria 1168
144 Ga0268265_10012033 3300028380 Bacteria 5857
145 Ga0268265_10125924 3300028380 Bacteria 2120
146 Ga0268264_10069470 3300028381 Unclassified 2979
147 Ga0265337_1000439 3300028556 Bacteria 22057
148 Ga0265326_10006426 3300028558 Bacteria 3653
149 Ga0265319_1000100 3300028563 Bacteria 66728
150 Ga0265318_10000883 3300028577 Bacteria 19608
151 Ga0265318_10003067 3300028577 Bacteria 8588
152 Ga0265322_10010115 3300028654 Bacteria 2735
153 Ga0265336_10000115 3300028666 Bacteria 59960
154 Ga0307515_10001257 3300028794 Bacteria 57814
155 Ga0265338_10003467 3300028800 Bacteria 22201
156 Ga0265324_10052629 3300029957 Bacteria 1398
157 Ga0265330_10050730 3300031235 Bacteria 1820
158 Ga0265332_10077165 3300031238 Bacteria 1415
159 Ga0265320_10006328 3300031240 Bacteria 7477
160 Ga0265325_10003164 3300031241 Bacteria 10827
161 Ga0265329_10076314 3300031242 Bacteria 1061
162 Ga0265340_10002022 3300031247 Bacteria 11606
163 Ga0265339_10006338 3300031249 Bacteria 7777
164 Ga0265331_10003825 3300031250 Bacteria 9547
165 Ga0265316_10007925 3300031344 Bacteria 9936
166 Ga0265316_10025687 3300031344 Bacteria 4912
167 Ga0265313_10000580 3300031595 Bacteria 38083
168 Ga0265314_10031551 3300031711 Bacteria 3909
169 Ga0265342_10020402 3300031712 Bacteria 4251
170 Ga0307516_10007081 3300031730 Bacteria 12965
171 Ga0307406_10001359 3300031901 Bacteria 13685
172 Ga0395899_0030463 3300037312 Bacteria 4058
173 Ga0395899_0066689 3300037312 Bacteria 2642
174 Ga0395900_0007932 3300037418 Bacteria 10928
175 Ga0395900_0014094 3300037418 Bacteria 8161
176 Ga0395900_0159757 3300037418 Bacteria 2299
177 Ga0395898_0004594 3300037466 Bacteria 15066
178 Ga0395898_0091945 3300037466 Bacteria 2918
179 Ga0395901_0143058 3300038443 Bacteria 2514
180 Ga0395901_0201010 3300038443 Bacteria 2089
181 Ga0400489_54733 3300039093 Bacteria 1266
182 Ga0439436_0068057 3300041404 Bacteria 993
183 Ga0439439_0016737 3300041406 Unclassified 1798
184 Ga0439441_011802 3300042001 Bacteria 1488
185 Ga0439457_002809 3300042014 Bacteria 4869
186 Ga0451577_0000447 3300042876 Bacteria 72385
187 Ga0451577_0012289 3300042876 Bacteria 8044
188 Ga0453683_0011307 3300044673 Bacteria 5887
189 Ga0453683_0326272 3300044673 Bacteria 984
190 Ga0453684_0001335 3300044712 Bacteria 72426
191 Ga0453684_0002290 3300044712 Bacteria 47049
192 Ga0453684_0005376 3300044712 Bacteria 25454
193 Ga0451576_0000252 3300045051 Bacteria 132040
194 Ga0451576_0000723 3300045051 Bacteria 66531
195 Ga0495606_0010206 3300046507 Bacteria 7829
196 Ga0495633_0000002 3300046558 Bacteria 488754
197 Ga0501043_0047203 3300049579 Bacteria 3385
198 Ga0501046_0106529 3300049580 Bacteria 2145
199 Ga0501073_0001045 3300049589 Bacteria 19958
200 Ga0501074_0230021 3300049590 Unclassified 1320
201 Ga0501249_000011 3300049679 Bacteria 168084
202 Ga0501249_011651 3300049679 Bacteria 1849
203 Ga0501080_0024372 3300049742 Bacteria 5608
204 Ga0501080_0362584 3300049742 Bacteria 1307
205 Ga0501044_0072999 3300049823 Bacteria 3488
206 nmdc:mga0k408_10086_c1 3300050493 Bacteria 5103
207 nmdc:mga09592_126951_c1 3300050508 Bacteria 1254
208 nmdc:mga09592_172039_c1 3300050508 Bacteria 1873
209 nmdc:mga09592_66221_c1 3300050508 Bacteria 3062
210 nmdc:mga06r32_325_c1 3300050510 Bacteria 39974
211 nmdc:mga08y16_12406_c1 3300050511 Bacteria 8964
212 nmdc:mga08y16_2842_c1 3300050511 Bacteria 17797
213 Ga0500578_0027423 3300053086 Bacteria 3657
214 Ga0500646_0001997 3300053090 Bacteria 5334
215 Ga0500583_0257924 3300053092 Unclassified 860
216 Ga0500557_017984 3300053105 Bacteria 1963
217 Ga0500658_0098606 3300053134 Unclassified 1273
218 Ga0500568_0016370 3300053139 Unclassified 3299
219 Ga0500622_0026729 3300053156 Bacteria 3043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039093 Ga0400489_54733 Ga0400489_54733_17_634 205
2 3300044673 Ga0453683_0326272 Ga0453683_0326272_301_918 205
3 iso_pu_bacteria 2932082852 2932088350 230
4 3300025929 Ga0207664_10117027 Ga0207664_101170273 231
5 3300001989 JGI24739J22299_10010814 JGI24739J22299_100108143 234
6 3300001990 JGI24737J22298_10000141 JGI24737J22298_1000014118 234
7 3300002067 JGI24735J21928_10000045 JGI24735J21928_1000004525 234
8 3300005459 Ga0068867_100647385 Ga0068867_1006473851 234
9 3300005840 Ga0068870_10048966 Ga0068870_100489662 234
10 3300005985 Ga0081539_10001598 Ga0081539_1000159830 234
11 3300013297 Ga0157378_10064520 Ga0157378_100645205 234
12 3300013307 Ga0157372_10001968 Ga0157372_1000196816 234
13 3300026089 Ga0207648_10521869 Ga0207648_105218691 234
14 3300053139 Ga0500568_0016370 Ga0500568_0016370_632_1336 234
15 3300005563 Ga0068855_100347707 Ga0068855_1003477072 235
16 3300005617 Ga0068859_100000277 Ga0068859_10000027743 235
17 3300005841 Ga0068863_100002942 Ga0068863_10000294223 235
18 3300005842 Ga0068858_100024441 Ga0068858_1000244412 235
19 3300005843 Ga0068860_100954948 Ga0068860_1009549482 235
20 3300006931 Ga0097620_100000277 Ga0097620_10000027743 235
21 3300009098 Ga0105245_10103377 Ga0105245_101033773 235
22 3300009101 Ga0105247_10008446 Ga0105247_100084462 235
23 3300009174 Ga0105241_10001565 Ga0105241_1000156512 235
24 3300009545 Ga0105237_10194813 Ga0105237_101948131 235
25 3300013102 Ga0157371_10310802 Ga0157371_103108022 235
26 3300013104 Ga0157370_10109679 Ga0157370_101096793 235
27 3300013306 Ga0163162_10000903 Ga0163162_1000090313 235
28 3300013307 Ga0157372_10219649 Ga0157372_102196493 235
29 3300025900 Ga0207710_10011054 Ga0207710_100110542 235
30 3300025904 Ga0207647_10378082 Ga0207647_103780821 235
31 3300025914 Ga0207671_10113694 Ga0207671_101136941 235
32 3300025949 Ga0207667_10553036 Ga0207667_105530362 235
33 3300025972 Ga0207668_10631411 Ga0207668_106314111 235
34 3300026023 Ga0207677_10225546 Ga0207677_102255462 235
35 3300026035 Ga0207703_10020735 Ga0207703_100207351 235
36 3300026088 Ga0207641_10000442 Ga0207641_1000044230 235
37 3300005455 Ga0070663_100089913 Ga0070663_1000899132 236
38 3300006173 Ga0070716_100087475 Ga0070716_1000874752 236
39 3300010375 Ga0105239_10878630 Ga0105239_108786302 236
40 3300013102 Ga0157371_10197945 Ga0157371_101979451 236
41 3300013105 Ga0157369_10384847 Ga0157369_103848472 236
42 3300013307 Ga0157372_10435898 Ga0157372_104358982 236
43 3300025917 Ga0207660_10259064 Ga0207660_102590642 236
44 3300025939 Ga0207665_10184843 Ga0207665_101848432 236
45 3300026067 Ga0207678_10108923 Ga0207678_101089232 236
46 3300053090 Ga0500646_0001997 Ga0500646_0001997_4200_4910 236
47 3300005331 Ga0070670_100027952 Ga0070670_1000279524 237
48 3300005331 Ga0070670_100095131 Ga0070670_1000951312 237
49 3300005339 Ga0070660_100008393 Ga0070660_1000083937 237
50 3300005347 Ga0070668_100175464 Ga0070668_1001754642 237
51 3300013297 Ga0157378_10043576 Ga0157378_100435762 237
52 3300025919 Ga0207657_10015993 Ga0207657_100159937 237
53 3300025925 Ga0207650_10029387 Ga0207650_100293873 237
54 3300025925 Ga0207650_10128564 Ga0207650_101285642 237
55 3300025972 Ga0207668_10245404 Ga0207668_102454042 237
56 3300026023 Ga0207677_10090156 Ga0207677_100901562 237
57 3300028794 Ga0307515_10001257 Ga0307515_1000125741 237
58 3300041404 Ga0439436_0068057 Ga0439436_0068057_229_942 237
59 3300041406 Ga0439439_0016737 Ga0439439_0016737_79_792 237
60 3300042876 Ga0451577_0000447 Ga0451577_0000447_22723_23436 237
61 3300044673 Ga0453683_0011307 Ga0453683_0011307_3723_4436 237
62 3300044712 Ga0453684_0001335 Ga0453684_0001335_22751_23464 237
63 3300045051 Ga0451576_0000723 Ga0451576_0000723_22725_23438 237
64 3300046507 Ga0495606_0010206 Ga0495606_0010206_1336_2097 237
65 3300049679 Ga0501249_011651 Ga0501249_011651_439_1152 237
66 3300053092 Ga0500583_0257924 Ga0500583_0257924_96_809 237
67 3300053134 Ga0500658_0098606 Ga0500658_0098606_384_1097 237
68 iso_pu_bacteria 2588253712 2588446230 237
69 3300003316 rootH1_10169912 rootH1_101699121 238
70 3300003322 rootL2_10093367 rootL2_100933675 238
71 3300003323 rootH1_10013549 rootH1_1001354913 238
72 3300005340 Ga0070689_100339825 Ga0070689_1003398252 238
73 3300005343 Ga0070687_100256021 Ga0070687_1002560212 238
74 3300006195 Ga0075366_10014567 Ga0075366_100145673 238
75 3300014325 Ga0163163_10214464 Ga0163163_102144641 238
76 3300031730 Ga0307516_10007081 Ga0307516_1000708112 238
77 3300042876 Ga0451577_0012289 Ga0451577_0012289_6056_6772 238
78 3300044712 Ga0453684_0002290 Ga0453684_0002290_40271_40987 238
79 3300045051 Ga0451576_0000252 Ga0451576_0000252_6087_6803 238
80 3300050493 nmdc:mga0k408_10086_c1 nmdc:mga0k408_10086_c1_2003_2722 238
81 3300005355 Ga0070671_100302318 Ga0070671_1003023182 239
82 3300005457 Ga0070662_100027143 Ga0070662_1000271432 239
83 3300005471 Ga0070698_100693391 Ga0070698_1006933912 239
84 3300005617 Ga0068859_100315274 Ga0068859_1003152742 239
85 3300005840 Ga0068870_10092952 Ga0068870_100929522 239
86 3300005841 Ga0068863_100097133 Ga0068863_1000971333 239
87 3300006237 Ga0097621_100028493 Ga0097621_1000284934 239
88 3300006358 Ga0068871_100042506 Ga0068871_1000425063 239
89 3300006847 Ga0075431_100001168 Ga0075431_1000011687 239
90 3300006880 Ga0075429_100177013 Ga0075429_1001770134 239
91 3300006880 Ga0075429_100214455 Ga0075429_1002144552 239
92 3300006880 Ga0075429_100400869 Ga0075429_1004008692 239
93 3300006880 Ga0075429_100535393 Ga0075429_1005353932 239
94 3300006931 Ga0097620_100315277 Ga0097620_1003152772 239
95 3300009094 Ga0111539_10009734 Ga0111539_100097348 239
96 3300009101 Ga0105247_10001830 Ga0105247_1000183018 239
97 3300009147 Ga0114129_10007138 Ga0114129_100071383 239
98 3300009176 Ga0105242_10000158 Ga0105242_100001584 239
99 3300009553 Ga0105249_10049652 Ga0105249_100496524 239
100 3300013296 Ga0157374_10000025 Ga0157374_100000256 239
101 3300013306 Ga0163162_10176423 Ga0163162_101764234 239
102 3300013306 Ga0163162_10208280 Ga0163162_102082801 239
103 3300014325 Ga0163163_10214688 Ga0163163_102146882 239
104 3300014325 Ga0163163_10284371 Ga0163163_102843711 239
105 3300014326 Ga0157380_10428761 Ga0157380_104287611 239
106 3300014968 Ga0157379_10138668 Ga0157379_101386682 239
107 3300014969 Ga0157376_10025212 Ga0157376_100252121 239
108 3300014969 Ga0157376_10147892 Ga0157376_101478923 239
109 3300025900 Ga0207710_10001504 Ga0207710_1000150410 239
110 3300025931 Ga0207644_10361533 Ga0207644_103615331 239
111 3300025934 Ga0207686_10000878 Ga0207686_1000087814 239
112 3300025961 Ga0207712_10137065 Ga0207712_101370652 239
113 3300027907 Ga0207428_10089598 Ga0207428_100895981 239
114 3300028577 Ga0265318_10003067 Ga0265318_100030675 239
115 3300031238 Ga0265332_10077165 Ga0265332_100771652 239
116 3300031240 Ga0265320_10006328 Ga0265320_100063287 239
117 3300031242 Ga0265329_10076314 Ga0265329_100763142 239
118 3300031249 Ga0265339_10006338 Ga0265339_100063382 239
119 3300031250 Ga0265331_10003825 Ga0265331_100038256 239
120 3300031344 Ga0265316_10007925 Ga0265316_100079256 239
121 3300031711 Ga0265314_10031551 Ga0265314_100315512 239
122 3300031712 Ga0265342_10020402 Ga0265342_100204022 239
123 3300050508 nmdc:mga09592_126951_c1 nmdc:mga09592_126951_c1_356_1075 239
124 3300050508 nmdc:mga09592_172039_c1 nmdc:mga09592_172039_c1_238_957 239
125 3300050508 nmdc:mga09592_66221_c1 nmdc:mga09592_66221_c1_1064_1783 239
126 3300050510 nmdc:mga06r32_325_c1 nmdc:mga06r32_325_c1_5012_5731 239
127 3300050511 nmdc:mga08y16_12406_c1 nmdc:mga08y16_12406_c1_1707_2426 239
128 3300003320 rootH2_10094656 rootH2_1009465610 240
129 3300005530 Ga0070679_100008050 Ga0070679_1000080502 240
130 3300009093 Ga0105240_10002314 Ga0105240_1000231423 240
131 3300010375 Ga0105239_10002053 Ga0105239_1000205316 240
132 3300013100 Ga0157373_10553458 Ga0157373_105534581 240
133 3300013307 Ga0157372_10023764 Ga0157372_100237644 240
134 3300025909 Ga0207705_10006762 Ga0207705_100067625 240
135 3300025909 Ga0207705_10010838 Ga0207705_100108384 240
136 3300025912 Ga0207707_10127574 Ga0207707_101275741 240
137 3300025913 Ga0207695_10005344 Ga0207695_1000534412 240
138 3300025917 Ga0207660_10042886 Ga0207660_100428862 240
139 3300025921 Ga0207652_10001276 Ga0207652_100012764 240
140 3300026067 Ga0207678_10223854 Ga0207678_102238542 240
141 3300037312 Ga0395899_0030463 Ga0395899_0030463_1849_2571 240
142 3300037312 Ga0395899_0066689 Ga0395899_0066689_1847_2569 240
143 3300037418 Ga0395900_0007932 Ga0395900_0007932_6043_6765 240
144 3300037418 Ga0395900_0014094 Ga0395900_0014094_5593_6315 240
145 3300037418 Ga0395900_0159757 Ga0395900_0159757_1497_2219 240
146 3300037466 Ga0395898_0004594 Ga0395898_0004594_5555_6277 240
147 3300037466 Ga0395898_0091945 Ga0395898_0091945_652_1374 240
148 3300038443 Ga0395901_0143058 Ga0395901_0143058_1380_2102 240
149 3300038443 Ga0395901_0201010 Ga0395901_0201010_41_763 240
150 3300042001 Ga0439441_011802 Ga0439441_011802_416_1138 240
151 3300042014 Ga0439457_002809 Ga0439457_002809_976_1698 240
152 3300053086 Ga0500578_0027423 Ga0500578_0027423_1771_2493 240
153 2162886007 SwRhRL2b_contig_577364 SwRhRL2b_0794.00000430 241
154 3300003320 rootH2_10012921 rootH2_1001292114 241
155 3300003323 rootH1_10022039 rootH1_100220395 241
156 3300005337 Ga0070682_100151145 Ga0070682_1001511452 241
157 3300005339 Ga0070660_100319768 Ga0070660_1003197682 241
158 3300005435 Ga0070714_100012821 Ga0070714_1000128217 241
159 3300005439 Ga0070711_100149403 Ga0070711_1001494032 241
160 3300005548 Ga0070665_100614031 Ga0070665_1006140312 241
161 3300005563 Ga0068855_100096705 Ga0068855_1000967055 241
162 3300005564 Ga0070664_100033247 Ga0070664_1000332476 241
163 3300005616 Ga0068852_100018094 Ga0068852_1000180943 241
164 3300005617 Ga0068859_100015656 Ga0068859_1000156564 241
165 3300005617 Ga0068859_100186777 Ga0068859_1001867773 241
166 3300005719 Ga0068861_100031547 Ga0068861_1000315473 241
167 3300005843 Ga0068860_100040695 Ga0068860_1000406953 241
168 3300005844 Ga0068862_100014768 Ga0068862_1000147686 241
169 3300005844 Ga0068862_100052219 Ga0068862_1000522192 241
170 3300005844 Ga0068862_100081458 Ga0068862_1000814582 241
171 3300005844 Ga0068862_101045698 Ga0068862_1010456981 241
172 3300006931 Ga0097620_100015656 Ga0097620_1000156564 241
173 3300006931 Ga0097620_100186791 Ga0097620_1001867911 241
174 3300009094 Ga0111539_10003341 Ga0111539_1000334117 241
175 3300009545 Ga0105237_10007083 Ga0105237_1000708313 241
176 3300009551 Ga0105238_10054400 Ga0105238_100544004 241
177 3300011119 Ga0105246_10001343 Ga0105246_100013435 241
178 3300013100 Ga0157373_10001495 Ga0157373_1000149510 241
179 3300013100 Ga0157373_10390779 Ga0157373_103907791 241
180 3300013102 Ga0157371_10013451 Ga0157371_100134513 241
181 3300014326 Ga0157380_10125129 Ga0157380_101251293 241
182 3300025914 Ga0207671_10004264 Ga0207671_1000426414 241
183 3300025924 Ga0207694_10363394 Ga0207694_103633942 241
184 3300025932 Ga0207690_10554723 Ga0207690_105547231 241
185 3300025933 Ga0207706_10498364 Ga0207706_104983642 241
186 3300025936 Ga0207670_10163678 Ga0207670_101636782 241
187 3300025944 Ga0207661_10114037 Ga0207661_101140372 241
188 3300025961 Ga0207712_10100831 Ga0207712_101008314 241
189 3300026118 Ga0207675_100188599 Ga0207675_1001885992 241
190 3300026142 Ga0207698_10008780 Ga0207698_100087807 241
191 3300028379 Ga0268266_10493412 Ga0268266_104934122 241
192 3300028380 Ga0268265_10012033 Ga0268265_100120335 241
193 3300028380 Ga0268265_10125924 Ga0268265_101259243 241
194 3300028381 Ga0268264_10069470 Ga0268264_100694702 241
195 3300028556 Ga0265337_1000439 Ga0265337_100043921 241
196 3300028558 Ga0265326_10006426 Ga0265326_100064262 241
197 3300028563 Ga0265319_1000100 Ga0265319_100010050 241
198 3300028577 Ga0265318_10000883 Ga0265318_1000088319 241
199 3300028654 Ga0265322_10010115 Ga0265322_100101152 241
200 3300028666 Ga0265336_10000115 Ga0265336_1000011517 241
201 3300028800 Ga0265338_10003467 Ga0265338_1000346710 241
202 3300029957 Ga0265324_10052629 Ga0265324_100526292 241
203 3300031235 Ga0265330_10050730 Ga0265330_100507302 241
204 3300031241 Ga0265325_10003164 Ga0265325_100031642 241
205 3300031247 Ga0265340_10002022 Ga0265340_100020226 241
206 3300031344 Ga0265316_10025687 Ga0265316_100256876 241
207 3300031595 Ga0265313_10000580 Ga0265313_1000058019 241
208 3300031901 Ga0307406_10001359 Ga0307406_100013594 241
209 3300044712 Ga0453684_0005376 Ga0453684_0005376_1649_2374 241
210 3300046558 Ga0495633_0000002 Ga0495633_0000002_236195_236926 241
211 3300049579 Ga0501043_0047203 Ga0501043_0047203_65_796 241
212 3300049580 Ga0501046_0106529 Ga0501046_0106529_94_825 241
213 3300049589 Ga0501073_0001045 Ga0501073_0001045_10149_10880 241
214 3300049590 Ga0501074_0230021 Ga0501074_0230021_300_1031 241
215 3300049679 Ga0501249_000011 Ga0501249_000011_79850_80575 241
216 3300049742 Ga0501080_0024372 Ga0501080_0024372_435_1166 241
217 3300049742 Ga0501080_0362584 Ga0501080_0362584_299_1030 241
218 3300049823 Ga0501044_0072999 Ga0501044_0072999_2458_3189 241
219 3300050511 nmdc:mga08y16_2842_c1 nmdc:mga08y16_2842_c1_4283_5026 241
220 3300053105 Ga0500557_017984 Ga0500557_017984_1158_1883 241
221 3300053156 Ga0500622_0026729 Ga0500622_0026729_725_1450 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07505

DUF5131

Protein of unknown function (DUF5131)

3

250

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xeh-assembly1.cif.gz_A solution nmr structure of de novo designed rossmann 2x3 fold protein r2x3_168, northeast structural genomics consortium (nesg) target or386 0.8057 167 208
6kfu-assembly1.cif.gz_A a acp-amt fusion protein of hybrid polyketide/non-ribosomal peptide synthetase 0.7209 165 206
6qp2-assembly1.cif.gz_A crystal structure of the plp-bound c-s lyase from staphylococcus hominis 0.7035 166 206
2eo0-assembly2.cif.gz_A crystal structure of holliday junction resolvase st1444 0.6445 172 211
4lnj-assembly1.cif.gz_A structure of escherichia coli threonine aldolase in unliganded form 0.6354 172 206
ID Description Score Start End Superfamily
af_I6YA42_4_243_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9536 4 229 3.20.20.70
af_I6YA42_4_243_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9066 4 229 3.20.20.70
af_A0A0R0KBV4_1_334_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6882 168 206 3.40.640.10
af_A0A1D6Q0R8_688_836_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.6318 168 213 3.30.750.24
4tkdB00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.6198 172 207 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A7Y3NW63-F1-model_v4 DUF5131 family protein 0.9892 1 153
AF-A0A1W9V201-F1-model_v4 Phage Gp37/Gp68 family protein 0.9789 1 160
AF-A0A4Q4AJR3-F1-model_v4 deleted 0.9787 1 102
AF-A0A1E3X2J7-F1-model_v4 Putative phage protein 0.9771 12 153
AF-A0A356GPP7-F1-model_v4 Phage Gp37/Gp68 family protein 0.976 1 207

Feature Viewer

pLDDT pTM Quality
85.72 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map