F332486

General Info

Members Datasets Scaffolds Average Seq Length
220 150 440 255

Family's Representative Sequence

Representative Sequence 3300038742|Ga0400486_28919|Ga0400486_28919_6873_7766
Length 297
Sequence LIKVIFQEFLRKQSAFHLENTQKSIKCTNINIDDKRNIMTIKTKKEIDLMRKAGLILWGAHQKAKELVFPGTMTKEIDSVVEEFILSKGARPLFKGVPGTVPFPASTCISINDEIVHGIPSTRKLSAGDIVSIDIGVKAGDWCADAAVTWPVGKVADEKVKLLQKTEEILRYAIRALSKKTRWSHIARKMQSKTESDNFSIIRNLVGHGIGKTLWEHPQIPNYYDRNMEDFRILKGAVLAIEPMITTGSGENKLLNDNWTIATKDGSPSAHFEHTIAITKNGPFVLTCGPSGEGWAM

Samples

Sample ID Description Type Environment
1 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
77 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
78 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
79 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
80 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 5.45
Rhizosphere 79.55
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400486_28919 3300038742 Bacteria 20374
2 Ga0070683_100158988 3300005329 Bacteria 2143
3 Ga0070690_100142657 3300005330 Bacteria 1627
4 Ga0070677_10182299 3300005333 Bacteria 1001
5 Ga0070682_100009345 3300005337 Bacteria 5549
6 Ga0068868_100061138 3300005338 Unclassified 2984
7 Ga0070669_100021210 3300005353 Bacteria 4643
8 Ga0070669_100056474 3300005353 Bacteria 2878
9 Ga0070675_100188554 3300005354 Unclassified 1786
10 Ga0070659_100000160 3300005366 Bacteria 51528
11 Ga0070709_10011212 3300005434 Bacteria 4986
12 Ga0070714_100002996 3300005435 Bacteria 12517
13 Ga0070714_100076714 3300005435 Bacteria 2902
14 Ga0070714_100102073 3300005435 Bacteria 2528
15 Ga0070714_100162039 3300005435 Bacteria 2024
16 Ga0070714_100267532 3300005435 Bacteria 1584
17 Ga0070713_100047328 3300005436 Bacteria 3534
18 Ga0070711_100015267 3300005439 Bacteria 4859
19 Ga0070705_100002004 3300005440 Bacteria 10415
20 Ga0070705_100479760 3300005440 Bacteria 939
21 Ga0070684_100208430 3300005535 Bacteria 1781
22 Ga0070697_100000309 3300005536 Bacteria 38761
23 Ga0070717_10367054 3300006028 Bacteria 1289
24 Ga0070717_10512682 3300006028 Bacteria 1084
25 Ga0070715_10073050 3300006163 Bacteria 1537
26 Ga0070716_100071426 3300006173 Bacteria 2040
27 Ga0070712_100000350 3300006175 Bacteria 26114
28 Ga0070712_100007547 3300006175 Bacteria 6799
29 Ga0075428_100024095 3300006844 Bacteria 6734
30 Ga0075430_100123414 3300006846 Bacteria 2159
31 Ga0075430_100534922 3300006846 Unclassified 967
32 Ga0075431_100367883 3300006847 Bacteria 1443
33 Ga0075433_10000042 3300006852 Bacteria 51751
34 Ga0075433_10019139 3300006852 Bacteria 5697
35 Ga0075434_100002987 3300006871 Bacteria 15051
36 Ga0075434_100782711 3300006871 Bacteria 970
37 Ga0075429_100008266 3300006880 Bacteria 9046
38 Ga0075429_100278556 3300006880 Bacteria 1464
39 Ga0075436_100086979 3300006914 Bacteria 2171
40 Ga0075435_100021095 3300007076 Bacteria 5004
41 Ga0105240_10114084 3300009093 Bacteria 3264
42 Ga0111539_10008652 3300009094 Bacteria 12920
43 Ga0111539_10083711 3300009094 Bacteria 3751
44 Ga0114129_10037889 3300009147 Bacteria 6803
45 Ga0114129_10090379 3300009147 Bacteria 4245
46 Ga0114129_10258633 3300009147 Bacteria 2335
47 Ga0105243_10056763 3300009148 Bacteria 3115
48 Ga0105239_10052946 3300010375 Bacteria 4452
49 Ga0157378_10106248 3300013297 Bacteria 2568
50 Ga0157372_10060501 3300013307 Bacteria 4238
51 Ga0157376_10018403 3300014969 Bacteria 5356
52 Ga0213876_10126823 3300021384 Bacteria 1356
53 Ga0213875_10001225 3300021388 Bacteria 17356
54 Ga0213875_10003279 3300021388 Bacteria 9270
55 Ga0213875_10020207 3300021388 Bacteria 3195
56 Ga0207695_10120044 3300025913 Bacteria 2598
57 Ga0207693_10000138 3300025915 Bacteria 66126
58 Ga0207693_10024485 3300025915 Bacteria 4789
59 Ga0207663_10024754 3300025916 Bacteria 3461
60 Ga0207652_10700652 3300025921 Bacteria 904
61 Ga0207681_10003220 3300025923 Bacteria 10235
62 Ga0207700_10034730 3300025928 Bacteria 3623
63 Ga0207664_10000020 3300025929 Bacteria 218362
64 Ga0207664_10032365 3300025929 Bacteria 4007
65 Ga0207664_10198170 3300025929 Bacteria 1732
66 Ga0207664_10431887 3300025929 Bacteria 1174
67 Ga0207690_10000165 3300025932 Bacteria 51537
68 Ga0207665_10054216 3300025939 Bacteria 2703
69 Ga0207711_10362148 3300025941 Bacteria 1344
70 Ga0207661_10173493 3300025944 Bacteria 1878
71 Ga0207712_10254053 3300025961 Bacteria 1422
72 Ga0207708_10249407 3300026075 Bacteria 1430
73 Ga0265326_10000082 3300028558 Bacteria 51208
74 Ga0265319_1000357 3300028563 Bacteria 33082
75 Ga0265334_10000050 3300028573 Bacteria 88877
76 Ga0265318_10017473 3300028577 Bacteria 2944
77 Ga0265336_10005219 3300028666 Bacteria 4819
78 Ga0265338_10035804 3300028800 Bacteria 4761
79 Ga0265324_10004534 3300029957 Bacteria 6234
80 Ga0265770_1035234 3300030878 Bacteria 856
81 Ga0265314_10178740 3300031711 Bacteria 1274
82 Ga0316578_10293845 3300031728 Bacteria 972
83 Ga0307409_100753294 3300031995 Bacteria 978
84 Ga0307409_100758457 3300031995 Unclassified 975
85 Ga0307415_100761492 3300032126 Bacteria 880
86 Ga0316593_10004759 3300032168 Bacteria 3518
87 Ga0316596_1086692 3300033541 Bacteria 843
88 Ga0373923_0033824 3300035111 Bacteria 2072
89 Ga0373956_0057970 3300035119 Bacteria 1751
90 Ga0373946_0037459 3300035171 Bacteria 1971
91 Ga0373955_0084670 3300035172 Bacteria 1798
92 Ga0373927_0003851 3300035695 Bacteria 10652
93 Ga0373947_0002143 3300035725 Bacteria 11994
94 Ga0373947_0008078 3300035725 Bacteria 6068
95 Ga0373937_0015319 3300036401 Bacteria 6780
96 Ga0373925_0002179 3300037068 Bacteria 15930
97 Ga0373925_0018654 3300037068 Bacteria 5043
98 Ga0395898_0295533 3300037466 Bacteria 1545
99 Ga0436364_0149301 3300037853 Bacteria 17361
100 Ga0436364_0221495 3300037853 Bacteria 40749
101 Ga0436364_0228196 3300037853 Bacteria 1107
102 Ga0436364_1164844 3300037853 Bacteria 6131
103 Ga0400490_16604 3300038726 Bacteria 3305
104 Ga0400490_30744 3300038726 Bacteria 133210
105 Ga0400490_58606 3300038726 Bacteria 2422
106 Ga0400485_02680 3300038735 Bacteria 9816
107 Ga0400485_18136 3300038735 Unclassified 1356
108 Ga0400485_19855 3300038735 Bacteria 23834
109 Ga0400488_59517 3300038741 Bacteria 2239
110 Ga0400488_62258 3300038741 Bacteria 7247
111 Ga0400486_00846 3300038742 Unclassified 3215
112 Ga0400486_03745 3300038742 Bacteria 15972
113 Ga0400483_006278 3300039062 Bacteria 7050
114 Ga0400483_070165 3300039062 Bacteria 2943
115 Ga0400483_117285 3300039062 Bacteria 9322
116 Ga0400483_183203 3300039062 Bacteria 1428
117 Ga0400483_207214 3300039062 Bacteria 4102
118 Ga0400483_230010 3300039062 Bacteria 5649
119 Ga0400483_265996 3300039062 Unclassified 1204
120 Ga0400487_03647 3300039110 Bacteria 36481
121 Ga0400487_26070 3300039110 Bacteria 3974
122 Ga0400487_39327 3300039110 Bacteria 1608
123 Ga0436365_0497321 3300039437 Bacteria 2166
124 Ga0436365_1369111 3300039437 Bacteria 1479
125 Ga0466966_0026754 3300044684 Bacteria 3765
126 Ga0466966_0305150 3300044684 Bacteria 957
127 Ga0466961_0044753 3300044693 Bacteria 2832
128 Ga0466961_0373443 3300044693 Bacteria 866
129 Ga0466963_0006555 3300044694 Bacteria 6894
130 Ga0466963_0038050 3300044694 Bacteria 3145
131 Ga0466963_0056053 3300044694 Bacteria 2622
132 Ga0466964_0109994 3300044706 Bacteria 1227
133 Ga0453684_0019047 3300044712 Bacteria 10481
134 Ga0466971_0013810 3300044719 Bacteria 3551
135 Ga0466970_0000027 3300044765 Bacteria 56103
136 Ga0466970_0120445 3300044765 Bacteria 1437
137 Ga0466957_0033013 3300044842 Bacteria 3103
138 Ga0466957_0084570 3300044842 Bacteria 1980
139 Ga0466960_0235640 3300044901 Bacteria 1012
140 Ga0466959_0147880 3300045049 Bacteria 1657
141 Ga0466958_0051005 3300045836 Bacteria 2504
142 Ga0466958_0073611 3300045836 Bacteria 2093
143 Ga0466958_0171541 3300045836 Bacteria 1374
144 Ga0466967_0055885 3300045976 Bacteria 3478
145 Ga0466967_0329112 3300045976 Bacteria 1475
146 Ga0495592_0037095 3300046454 Bacteria 3670
147 Ga0495592_0147800 3300046454 Bacteria 1628
148 Ga0495629_0000007 3300046459 Bacteria 358693
149 Ga0495651_0136893 3300046462 Bacteria 1780
150 Ga0495653_0085276 3300046463 Bacteria 2324
151 Ga0495582_0096862 3300046473 Bacteria 1650
152 Ga0495639_0000121 3300046475 Bacteria 39571
153 Ga0495639_0252245 3300046475 Bacteria 873
154 Ga0495664_0202161 3300046477 Bacteria 1204
155 Ga0495608_0002787 3300046511 Bacteria 12547
156 Ga0495618_0085015 3300046514 Bacteria 2022
157 Ga0495618_0349095 3300046514 Bacteria 912
158 Ga0495628_0143514 3300046516 Bacteria 1821
159 Ga0495628_0152696 3300046516 Bacteria 1758
160 Ga0495628_0239638 3300046516 Bacteria 1357
161 Ga0495666_0016379 3300046526 Bacteria 3691
162 Ga0495652_0185800 3300046529 Bacteria 1590
163 Ga0495640_0155400 3300046533 Bacteria 1468
164 Ga0495586_0000999 3300046535 Bacteria 16016
165 Ga0495587_0014000 3300046536 Bacteria 5037
166 Ga0495622_0002685 3300046557 Bacteria 8531
167 Ga0495667_0003950 3300046559 Bacteria 9947
168 Ga0495635_0022532 3300046663 Bacteria 4388
169 Ga0495657_0033051 3300046675 Bacteria 3605
170 Ga0495599_0025629 3300046678 Bacteria 3692
171 Ga0495623_0051676 3300046679 Bacteria 2599
172 Ga0495658_0004909 3300046683 Bacteria 6562
173 Ga0495600_0012455 3300046809 Bacteria 5319
174 Ga0495581_0005862 3300047315 Bacteria 7123
175 Ga0495604_0062214 3300047317 Bacteria 2853
176 Ga0495636_0093300 3300047318 Bacteria 1309
177 Ga0495674_0061568 3300047319 Bacteria 3270
178 Ga0495672_0013354 3300047320 Bacteria 5671
179 Ga0495676_0020676 3300047321 Bacteria 5767
180 Ga0495680_0001860 3300047322 Bacteria 22237
181 Ga0495680_0091411 3300047322 Bacteria 2281
182 Ga0495675_0028863 3300047444 Bacteria 3536
183 Ga0495684_0006640 3300047471 Bacteria 8971
184 Ga0495684_0014196 3300047471 Bacteria 6128
185 Ga0495602_0147792 3300048088 Bacteria 1851
186 Ga0495614_0139736 3300048089 Bacteria 1076
187 Ga0496104_0183238 3300048907 Bacteria 2004
188 Ga0496105_0023010 3300048908 Bacteria 5052
189 Ga0496105_0382763 3300048908 Bacteria 1119
190 Ga0496108_0054237 3300048911 Bacteria 3364
191 Ga0496108_0119433 3300048911 Bacteria 2260
192 Ga0496109_0017957 3300048912 Bacteria 6211
193 Ga0496109_0650189 3300048912 Bacteria 991
194 Ga0496112_0182162 3300048915 Bacteria 2064
195 Ga0496112_0413540 3300048915 Bacteria 1288
196 Ga0496113_0069421 3300048916 Bacteria 2676
197 Ga0496114_0156216 3300048917 Bacteria 1981
198 Ga0496115_0470299 3300048918 Bacteria 1013
199 Ga0496124_0031371 3300048927 Bacteria 4705
200 Ga0501083_0104535 3300049744 Bacteria 1866
201 nmdc:mga05p37_104638_c1 3300050507 Unclassified 3482
202 nmdc:mga05p37_306274_c2 3300050507 Bacteria 1509
203 nmdc:mga0qj67_120404_c1 3300050509 Bacteria 2123
204 nmdc:mga06r32_564084_c1 3300050510 Bacteria 1112
205 nmdc:mga08y16_8355_c1 3300050511 Bacteria 10832
206 nmdc:mga08y16_96481_c1 3300050511 Bacteria 3079
207 nmdc:mga0n895_113705_c1 3300050512 Bacteria 2725
208 nmdc:mga0n895_1194_c1 3300050512 Bacteria 19124
209 nmdc:mga0n895_6967_c1 3300050512 Bacteria 9649
210 nmdc:mga0rr50_23265_c1 3300050513 Bacteria 4269
211 nmdc:mga0rr50_628354_c1 3300050513 Bacteria 916
212 nmdc:mga0a205_15178_c1 3300050515 Bacteria 7196
213 nmdc:mga0a205_33654_c1 3300050515 Bacteria 4914
214 Ga0495601_0183650 3300053077 Bacteria 1367
215 Ga0495612_0112748 3300053078 Bacteria 1165
216 Ga0495595_0019327 3300053084 Bacteria 2955
217 Ga0495619_0015625 3300053085 Bacteria 4804
218 Ga0495619_0159958 3300053085 Bacteria 1555
219 Ga0500566_0008539 3300053094 Bacteria 6056
220 Ga0466962_0026293 3300061719 Bacteria 2794
221 Ga0400486_28919
222 Ga0070683_100158988
223 Ga0070690_100142657
224 Ga0070677_10182299
225 Ga0070682_100009345
226 Ga0068868_100061138
227 Ga0070669_100021210
228 Ga0070669_100056474
229 Ga0070675_100188554
230 Ga0070659_100000160
231 Ga0070709_10011212
232 Ga0070714_100002996
233 Ga0070714_100076714
234 Ga0070714_100102073
235 Ga0070714_100162039
236 Ga0070714_100267532
237 Ga0070713_100047328
238 Ga0070711_100015267
239 Ga0070705_100002004
240 Ga0070705_100479760
241 Ga0070684_100208430
242 Ga0070697_100000309
243 Ga0070717_10367054
244 Ga0070717_10512682
245 Ga0070715_10073050
246 Ga0070716_100071426
247 Ga0070712_100000350
248 Ga0070712_100007547
249 Ga0075428_100024095
250 Ga0075430_100123414
251 Ga0075430_100534922
252 Ga0075431_100367883
253 Ga0075433_10000042
254 Ga0075433_10019139
255 Ga0075434_100002987
256 Ga0075434_100782711
257 Ga0075429_100008266
258 Ga0075429_100278556
259 Ga0075436_100086979
260 Ga0075435_100021095
261 Ga0105240_10114084
262 Ga0111539_10008652
263 Ga0111539_10083711
264 Ga0114129_10037889
265 Ga0114129_10090379
266 Ga0114129_10258633
267 Ga0105243_10056763
268 Ga0105239_10052946
269 Ga0157378_10106248
270 Ga0157372_10060501
271 Ga0157376_10018403
272 Ga0213876_10126823
273 Ga0213875_10001225
274 Ga0213875_10003279
275 Ga0213875_10020207
276 Ga0207695_10120044
277 Ga0207693_10000138
278 Ga0207693_10024485
279 Ga0207663_10024754
280 Ga0207652_10700652
281 Ga0207681_10003220
282 Ga0207700_10034730
283 Ga0207664_10000020
284 Ga0207664_10032365
285 Ga0207664_10198170
286 Ga0207664_10431887
287 Ga0207690_10000165
288 Ga0207665_10054216
289 Ga0207711_10362148
290 Ga0207661_10173493
291 Ga0207712_10254053
292 Ga0207708_10249407
293 Ga0265326_10000082
294 Ga0265319_1000357
295 Ga0265334_10000050
296 Ga0265318_10017473
297 Ga0265336_10005219
298 Ga0265338_10035804
299 Ga0265324_10004534
300 Ga0265770_1035234
301 Ga0265314_10178740
302 Ga0316578_10293845
303 Ga0307409_100753294
304 Ga0307409_100758457
305 Ga0307415_100761492
306 Ga0316593_10004759
307 Ga0316596_1086692
308 Ga0373923_0033824
309 Ga0373956_0057970
310 Ga0373946_0037459
311 Ga0373955_0084670
312 Ga0373927_0003851
313 Ga0373947_0002143
314 Ga0373947_0008078
315 Ga0373937_0015319
316 Ga0373925_0002179
317 Ga0373925_0018654
318 Ga0395898_0295533
319 Ga0436364_0149301
320 Ga0436364_0221495
321 Ga0436364_0228196
322 Ga0436364_1164844
323 Ga0400490_16604
324 Ga0400490_30744
325 Ga0400490_58606
326 Ga0400485_02680
327 Ga0400485_18136
328 Ga0400485_19855
329 Ga0400488_59517
330 Ga0400488_62258
331 Ga0400486_00846
332 Ga0400486_03745
333 Ga0400483_006278
334 Ga0400483_070165
335 Ga0400483_117285
336 Ga0400483_183203
337 Ga0400483_207214
338 Ga0400483_230010
339 Ga0400483_265996
340 Ga0400487_03647
341 Ga0400487_26070
342 Ga0400487_39327
343 Ga0436365_0497321
344 Ga0436365_1369111
345 Ga0466966_0026754
346 Ga0466966_0305150
347 Ga0466961_0044753
348 Ga0466961_0373443
349 Ga0466963_0006555
350 Ga0466963_0038050
351 Ga0466963_0056053
352 Ga0466964_0109994
353 Ga0453684_0019047
354 Ga0466971_0013810
355 Ga0466970_0000027
356 Ga0466970_0120445
357 Ga0466957_0033013
358 Ga0466957_0084570
359 Ga0466960_0235640
360 Ga0466959_0147880
361 Ga0466958_0051005
362 Ga0466958_0073611
363 Ga0466958_0171541
364 Ga0466967_0055885
365 Ga0466967_0329112
366 Ga0495592_0037095
367 Ga0495592_0147800
368 Ga0495629_0000007
369 Ga0495651_0136893
370 Ga0495653_0085276
371 Ga0495582_0096862
372 Ga0495639_0000121
373 Ga0495639_0252245
374 Ga0495664_0202161
375 Ga0495608_0002787
376 Ga0495618_0085015
377 Ga0495618_0349095
378 Ga0495628_0143514
379 Ga0495628_0152696
380 Ga0495628_0239638
381 Ga0495666_0016379
382 Ga0495652_0185800
383 Ga0495640_0155400
384 Ga0495586_0000999
385 Ga0495587_0014000
386 Ga0495622_0002685
387 Ga0495667_0003950
388 Ga0495635_0022532
389 Ga0495657_0033051
390 Ga0495599_0025629
391 Ga0495623_0051676
392 Ga0495658_0004909
393 Ga0495600_0012455
394 Ga0495581_0005862
395 Ga0495604_0062214
396 Ga0495636_0093300
397 Ga0495674_0061568
398 Ga0495672_0013354
399 Ga0495676_0020676
400 Ga0495680_0001860
401 Ga0495680_0091411
402 Ga0495675_0028863
403 Ga0495684_0006640
404 Ga0495684_0014196
405 Ga0495602_0147792
406 Ga0495614_0139736
407 Ga0496104_0183238
408 Ga0496105_0023010
409 Ga0496105_0382763
410 Ga0496108_0054237
411 Ga0496108_0119433
412 Ga0496109_0017957
413 Ga0496109_0650189
414 Ga0496112_0182162
415 Ga0496112_0413540
416 Ga0496113_0069421
417 Ga0496114_0156216
418 Ga0496115_0470299
419 Ga0496124_0031371
420 Ga0501083_0104535
421 nmdc:mga05p37_104638_c1
422 nmdc:mga05p37_306274_c2
423 nmdc:mga0qj67_120404_c1
424 nmdc:mga06r32_564084_c1
425 nmdc:mga08y16_8355_c1
426 nmdc:mga08y16_96481_c1
427 nmdc:mga0n895_113705_c1
428 nmdc:mga0n895_1194_c1
429 nmdc:mga0n895_6967_c1
430 nmdc:mga0rr50_23265_c1
431 nmdc:mga0rr50_628354_c1
432 nmdc:mga0a205_15178_c1
433 nmdc:mga0a205_33654_c1
434 Ga0495601_0183650
435 Ga0495612_0112748
436 Ga0495595_0019327
437 Ga0495619_0015625
438 Ga0495619_0159958
439 Ga0500566_0008539
440 Ga0466962_0026293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

48

280

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9917 1 246
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9886 1 246
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9862 1 248
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9848 1 246
3tav-assembly1.cif.gz_A crystal structure of a methionine aminopeptidase from mycobacterium abscessus 0.983 2 246
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9912 13 124 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9911 1 246 3.90.230.10
af_P9WK21_10_265_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9862 1 246 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9848 1 246 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9834 1 246 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7X7PQL7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9998 1 246 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.999 1 246 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C3XA93-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9985 1 196 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A536CIX4-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9978 1 246 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3D0E855-F1-model_v4 deleted 0.9973 1 246

Map