F332134

General Info

Members Datasets Scaffolds Average Seq Length
220 177 440 136

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_102015705|Ga0068865_1020157051
Length 146
Sequence VRRPAGSVTAMDIKLAQCFIAVDDHDKALAFYRDVLGLEVRNDVAYEGMRWVTVGSPSQPGVEIVLEPPLADPNAPSADRDAMAAMLAKGHLRGVNFRTEDCDATFERIREGGGEVLQEPMDMPYGVRDCAFRDPAGNMLRFTQPA

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
138 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
148 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
149 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
150 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
151 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
152 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
153 2808606448 Streptomyces sp. 193411 Isolate Unclassified
154 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
155 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
156 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
157 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
158 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
159 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
160 2858882152 Micromonospora noduli MED15 Isolate Nodule
161 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
162 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
163 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
164 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
165 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
166 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
167 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
168 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
169 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
170 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
171 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
172 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
173 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
174 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
175 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
176 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
177 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.64
Metatranscriptomes 2.27
Isolates 14.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 1.82
Rhizoplane 0.91
Rhizosphere 74.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_102015705 3300006881 Bacteria 524
2 JGI25406J46586_10014504 3300003203 Bacteria 3349
3 rootH1_10030879 3300003316 Bacteria 2165
4 rootL2_10090743 3300003322 Bacteria 1136
5 Ga0006562J51391_1082898 3300003578 Bacteria 4060
6 Ga0006562J51391_1082900 3300003578 Bacteria 2310
7 Ga0068868_100341964 3300005338 Bacteria 1280
8 Ga0070692_11123283 3300005345 Bacteria 556
9 Ga0070674_100155368 3300005356 Bacteria 1731
10 Ga0070673_101050282 3300005364 Bacteria 760
11 Ga0070714_100000002 3300005435 Bacteria 386673
12 Ga0070708_100010268 3300005445 Bacteria 7581
13 Ga0070685_10256985 3300005466 Bacteria 1160
14 Ga0070685_11018934 3300005466 Bacteria 622
15 Ga0070684_100345202 3300005535 Bacteria 1369
16 Ga0070672_101479863 3300005543 Bacteria 608
17 Ga0070665_100545257 3300005548 Bacteria 1172
18 Ga0070704_101161833 3300005549 Bacteria 703
19 Ga0068864_101179444 3300005618 Bacteria 764
20 Ga0068866_10318759 3300005718 Bacteria 977
21 Ga0081538_10220833 3300005981 Bacteria 752
22 Ga0081539_10080938 3300005985 Bacteria 1707
23 Ga0075365_10088093 3300006038 Bacteria 2111
24 Ga0075364_10032706 3300006051 Bacteria 3344
25 Ga0075369_10057404 3300006186 Bacteria 1693
26 Ga0097621_100693514 3300006237 Bacteria 937
27 Ga0105240_11477514 3300009093 Bacteria 713
28 Ga0114129_10976472 3300009147 Bacteria 1068
29 Ga0105243_10150738 3300009148 Bacteria 1994
30 Ga0105242_10292355 3300009176 Bacteria 1484
31 Ga0105248_11473784 3300009177 Bacteria 770
32 Ga0105238_12497721 3300009551 Bacteria 553
33 Ga0105249_12827698 3300009553 Bacteria 557
34 Ga0105239_10731216 3300010375 Bacteria 1132
35 Ga0105239_11388077 3300010375 Bacteria 811
36 Ga0157372_12907003 3300013307 Bacteria 548
37 Ga0163163_11332666 3300014325 Bacteria 780
38 Ga0163163_11449367 3300014325 Bacteria 748
39 Ga0157380_10225772 3300014326 Bacteria 1678
40 Ga0157377_11370271 3300014745 Bacteria 556
41 Ga0197907_11387200 3300020069 Bacteria 687
42 Ga0206352_10825636 3300020078 Bacteria 655
43 Ga0213875_10093533 3300021388 Bacteria 1402
44 Ga0224712_10012252 3300022467 Bacteria 2691
45 Ga0207425_1006843 3300025245 Bacteria 3077
46 Ga0207426_1108097 3300025302 Bacteria 706
47 Ga0207688_10267415 3300025901 Bacteria 1039
48 Ga0207705_10340480 3300025909 Bacteria 1154
49 Ga0207649_10595673 3300025920 Bacteria 850
50 Ga0207687_10732030 3300025927 Bacteria 841
51 Ga0207664_10000038 3300025929 Bacteria 166264
52 Ga0207664_10371154 3300025929 Bacteria 1269
53 Ga0207686_10315896 3300025934 Bacteria 1165
54 Ga0207669_10202934 3300025937 Bacteria 1441
55 Ga0207691_10299774 3300025940 Bacteria 1381
56 Ga0207661_10502744 3300025944 Bacteria 1108
57 Ga0207679_10238882 3300025945 Bacteria 1538
58 Ga0207668_11501710 3300025972 Bacteria 608
59 Ga0207640_10340506 3300025981 Bacteria 1201
60 Ga0207678_10443686 3300026067 Bacteria 1127
61 Ga0207708_11117050 3300026075 Bacteria 688
62 Ga0207648_10074458 3300026089 Bacteria 2959
63 Ga0207675_101118180 3300026118 Bacteria 808
64 Ga0207698_10578878 3300026142 Bacteria 1104
65 Ga0265334_10009432 3300028573 Bacteria 4127
66 Ga0307512_10100875 3300030522 Bacteria 1955
67 Ga0307509_10017440 3300031507 Bacteria 8265
68 Ga0307408_101146584 3300031548 Bacteria 723
69 Ga0307405_10416454 3300031731 Bacteria 1056
70 Ga0307413_10159652 3300031824 Bacteria 1582
71 Ga0307410_10231192 3300031852 Bacteria 1428
72 Ga0307410_10443957 3300031852 Bacteria 1057
73 Ga0326468_10081752 3300031889 Bacteria 559
74 Ga0307406_10045629 3300031901 Bacteria 2753
75 Ga0307412_10554088 3300031911 Bacteria 966
76 Ga0307409_100430437 3300031995 Bacteria 1268
77 Ga0307416_100312830 3300032002 Bacteria 1568
78 Ga0307416_100401437 3300032002 Bacteria 1408
79 Ga0307414_10235621 3300032004 Bacteria 1512
80 Ga0307415_100052005 3300032126 Bacteria 2783
81 Ga0307415_100238956 3300032126 Bacteria 1468
82 Ga0307507_10074057 3300033179 Bacteria 3056
83 Ga0373943_0278081 3300035170 Bacteria 946
84 Ga0373943_0634107 3300035170 Bacteria 631
85 Ga0373935_0480689 3300035692 Bacteria 900
86 Ga0373933_0044210 3300035724 Bacteria 2638
87 Ga0373947_0441293 3300035725 Bacteria 881
88 Ga0373947_0502728 3300035725 Bacteria 824
89 Ga0373925_0333643 3300037068 Bacteria 1229
90 Ga0436364_0928916 3300037853 Bacteria 974
91 Ga0436364_1331619 3300037853 Bacteria 6415
92 Ga0395901_0288581 3300038443 Bacteria 1703
93 Ga0451793_1280464 3300041452 Bacteria 799
94 Ga0439455_0052130 3300042012 Bacteria 1071
95 Ga0466972_0086648 3300044658 Bacteria 1488
96 Ga0466971_0047141 3300044719 Bacteria 1937
97 Ga0466959_0014020 3300045049 Bacteria 5818
98 Ga0466958_0036829 3300045836 Bacteria 2930
99 Ga0495651_0130837 3300046462 Bacteria 1832
100 Ga0495628_0008032 3300046516 Bacteria 9087
101 Ga0495652_0165180 3300046529 Bacteria 1714
102 Ga0495588_0192405 3300046674 Bacteria 1077
103 Ga0495674_0660505 3300047319 Bacteria 824
104 Ga0495677_0270629 3300047445 Bacteria 666
105 Ga0495684_0077944 3300047471 Bacteria 2515
106 Ga0496102_0839341 3300048905 Bacteria 841
107 Ga0496126_0024237 3300048929 Bacteria 5861
108 Ga0496126_0048927 3300048929 Bacteria 3861
109 Ga0496126_0487419 3300048929 Bacteria 987
110 Ga0501031_0057923 3300049568 Bacteria 2525
111 Ga0501032_0001000 3300049569 Bacteria 22764
112 Ga0501032_0099397 3300049569 Bacteria 1927
113 Ga0501032_0114962 3300049569 Bacteria 1779
114 Ga0501032_0638570 3300049569 Bacteria 676
115 Ga0501033_0108252 3300049570 Bacteria 2024
116 Ga0501033_0238446 3300049570 Bacteria 1290
117 Ga0501034_0007348 3300049571 Bacteria 11731
118 Ga0501034_0100841 3300049571 Bacteria 2881
119 Ga0501036_0005470 3300049572 Bacteria 10299
120 Ga0501036_0009586 3300049572 Bacteria 7964
121 Ga0501036_0128520 3300049572 Bacteria 2139
122 Ga0501037_0001093 3300049573 Bacteria 20095
123 Ga0501037_0106351 3300049573 Bacteria 2022
124 Ga0501038_0020404 3300049574 Bacteria 5957
125 Ga0501038_0164969 3300049574 Bacteria 1797
126 Ga0501039_0063876 3300049575 Bacteria 2852
127 Ga0501039_0149497 3300049575 Bacteria 1835
128 Ga0501039_0263894 3300049575 Bacteria 1353
129 Ga0501040_0003440 3300049576 Bacteria 10222
130 Ga0501041_0014808 3300049577 Bacteria 4631
131 Ga0501042_0234638 3300049578 Bacteria 1323
132 Ga0501043_0009466 3300049579 Bacteria 7643
133 Ga0501043_0169026 3300049579 Bacteria 1706
134 Ga0501043_0341173 3300049579 Bacteria 1139
135 Ga0501047_0001262 3300049581 Bacteria 25039
136 Ga0501047_0005569 3300049581 Bacteria 11858
137 Ga0501048_0004219 3300049582 Bacteria 10953
138 Ga0501048_0560616 3300049582 Bacteria 820
139 Ga0501067_0002080 3300049583 Bacteria 11021
140 Ga0501067_0351836 3300049583 Bacteria 821
141 Ga0501068_0000777 3300049584 Bacteria 16465
142 Ga0501068_0315320 3300049584 Bacteria 1002
143 Ga0501069_0135446 3300049585 Bacteria 1411
144 Ga0501070_0007337 3300049586 Bacteria 9360
145 Ga0501070_0013360 3300049586 Bacteria 6924
146 Ga0501070_0018138 3300049586 Bacteria 5904
147 Ga0501071_0000235 3300049587 Bacteria 25360
148 Ga0501072_0003491 3300049588 Bacteria 11836
149 Ga0501073_0000046 3300049589 Bacteria 78180
150 Ga0501073_0098317 3300049589 Bacteria 2032
151 Ga0501074_0034901 3300049590 Bacteria 3645
152 Ga0501074_0174996 3300049590 Bacteria 1531
153 Ga0501076_0018023 3300049592 Bacteria 5373
154 Ga0501077_0044392 3300049593 Bacteria 2824
155 Ga0501079_0176008 3300049741 Bacteria 1668
156 Ga0501080_0058557 3300049742 Bacteria 3585
157 Ga0501080_0197518 3300049742 Bacteria 1847
158 Ga0501080_0330277 3300049742 Bacteria 1379
159 Ga0501080_1256311 3300049742 Bacteria 635
160 Ga0501083_0004720 3300049744 Bacteria 9629
161 Ga0501035_0006050 3300049822 Bacteria 11396
162 Ga0501035_0022441 3300049822 Bacteria 5796
163 Ga0501035_0438176 3300049822 Bacteria 1082
164 Ga0501044_0002251 3300049823 Bacteria 22046
165 Ga0501044_0036598 3300049823 Bacteria 5134
166 Ga0501045_0060362 3300049824 Bacteria 2779
167 Ga0501045_0148788 3300049824 Bacteria 1742
168 nmdc:mga00v17_145345_c1 3300050491 Bacteria 1522
169 nmdc:mga0yw44_37363_c1 3300050492 Bacteria 2867
170 nmdc:mga0yw44_72351_c1 3300050492 Bacteria 2143
171 nmdc:mga08y16_1156550_c1 3300050511 Bacteria 746
172 nmdc:mga08y16_988039_c1 3300050511 Bacteria 822
173 nmdc:mga0n895_1691719_c1 3300050512 Bacteria 595
174 Ga0495601_0003255 3300053077 Bacteria 9276
175 Ga0495619_0041101 3300053085 Bacteria 3024
176 Ga0500644_0018732 3300053088 Bacteria 2033
177 Ga0500651_0001489 3300053093 Bacteria 11814
178 Ga0500556_0000283 3300053104 Bacteria 39686
179 Ga0500562_002827 3300053108 Bacteria 4325
180 Ga0500593_000747 3300053117 Bacteria 12226
181 Ga0500655_033418 3300053133 Bacteria 995
182 Ga0500559_0000387 3300053136 Bacteria 32302
183 Ga0500573_0086554 3300053140 Bacteria 1775
184 Ga0500588_0178991 3300053146 Bacteria 779
185 Ga0500616_0058469 3300053153 Bacteria 2005
186 Ga0501084_0023548 3300054114 Bacteria 5136
187 Ga0501082_0380069 3300060353 Bacteria 1232
188 Ga0466962_0127890 3300061719 Bacteria 1227
189 Ga0530510_0061517 3300061734 Bacteria 2718
190 2547410338 2547132111 Bacteria 8013147
191 2554261178 2554235005 Bacteria 6457341
192 2588108361 2585428157 Bacteria 3018951
193 2644439916 2643221678 Bacteria 9540101
194 2676481244 2675903059 Bacteria 8644972
195 2808843923 2808606359 Bacteria 9866990
196 2809235309 2808606448 Bacteria 8656184
197 2809590910 2808606522 Bacteria 9488490
198 2812478872 2811994917 Bacteria 7761064
199 2855670908 2855670206 Bacteria 7120389
200 2855681271 2855676851 Bacteria 7063653
201 2857289526 2857288857 Bacteria 7189066
202 2858851850 2858848962 Bacteria 6963058
203 2858882648 2858882152 Bacteria 7230291
204 2858894824 2858888857 Bacteria 7060307
205 2858899814 2858895516 Bacteria 7378898
206 2861527017 2861520306 Bacteria 8348283
207 2862710725 2862705112 Bacteria 6563286
208 2869054061 2869048445 Bacteria 6875584
209 2869064916 2869061728 Bacteria 7112407
210 2869074603 2869068681 Bacteria 7205615
211 2880501829 2880495981 Bacteria 7340502
212 2891401176 2891395885 Bacteria 9251614
213 2891560126 2891554331 Bacteria 8812224
214 2912721619 2912715099 Bacteria 9460473
215 2919471606 2919468124 Bacteria 9133025
216 2990045514 2990044586 Bacteria 6603797
217 8003859014 8003856774 Bacteria 7675274
218 8033686471 8033684223 Bacteria 6906479
219 8054733825 8054727385 Bacteria 7558670
220 8055415029 8055412473 Bacteria 6257500
221 Ga0068865_102015705
222 JGI25406J46586_10014504
223 rootH1_10030879
224 rootL2_10090743
225 Ga0006562J51391_1082898
226 Ga0006562J51391_1082900
227 Ga0068868_100341964
228 Ga0070692_11123283
229 Ga0070674_100155368
230 Ga0070673_101050282
231 Ga0070714_100000002
232 Ga0070708_100010268
233 Ga0070685_10256985
234 Ga0070685_11018934
235 Ga0070684_100345202
236 Ga0070672_101479863
237 Ga0070665_100545257
238 Ga0070704_101161833
239 Ga0068864_101179444
240 Ga0068866_10318759
241 Ga0081538_10220833
242 Ga0081539_10080938
243 Ga0075365_10088093
244 Ga0075364_10032706
245 Ga0075369_10057404
246 Ga0097621_100693514
247 Ga0105240_11477514
248 Ga0114129_10976472
249 Ga0105243_10150738
250 Ga0105242_10292355
251 Ga0105248_11473784
252 Ga0105238_12497721
253 Ga0105249_12827698
254 Ga0105239_10731216
255 Ga0105239_11388077
256 Ga0157372_12907003
257 Ga0163163_11332666
258 Ga0163163_11449367
259 Ga0157380_10225772
260 Ga0157377_11370271
261 Ga0197907_11387200
262 Ga0206352_10825636
263 Ga0213875_10093533
264 Ga0224712_10012252
265 Ga0207425_1006843
266 Ga0207426_1108097
267 Ga0207688_10267415
268 Ga0207705_10340480
269 Ga0207649_10595673
270 Ga0207687_10732030
271 Ga0207664_10000038
272 Ga0207664_10371154
273 Ga0207686_10315896
274 Ga0207669_10202934
275 Ga0207691_10299774
276 Ga0207661_10502744
277 Ga0207679_10238882
278 Ga0207668_11501710
279 Ga0207640_10340506
280 Ga0207678_10443686
281 Ga0207708_11117050
282 Ga0207648_10074458
283 Ga0207675_101118180
284 Ga0207698_10578878
285 Ga0265334_10009432
286 Ga0307512_10100875
287 Ga0307509_10017440
288 Ga0307408_101146584
289 Ga0307405_10416454
290 Ga0307413_10159652
291 Ga0307410_10231192
292 Ga0307410_10443957
293 Ga0326468_10081752
294 Ga0307406_10045629
295 Ga0307412_10554088
296 Ga0307409_100430437
297 Ga0307416_100312830
298 Ga0307416_100401437
299 Ga0307414_10235621
300 Ga0307415_100052005
301 Ga0307415_100238956
302 Ga0307507_10074057
303 Ga0373943_0278081
304 Ga0373943_0634107
305 Ga0373935_0480689
306 Ga0373933_0044210
307 Ga0373947_0441293
308 Ga0373947_0502728
309 Ga0373925_0333643
310 Ga0436364_0928916
311 Ga0436364_1331619
312 Ga0395901_0288581
313 Ga0451793_1280464
314 Ga0439455_0052130
315 Ga0466972_0086648
316 Ga0466971_0047141
317 Ga0466959_0014020
318 Ga0466958_0036829
319 Ga0495651_0130837
320 Ga0495628_0008032
321 Ga0495652_0165180
322 Ga0495588_0192405
323 Ga0495674_0660505
324 Ga0495677_0270629
325 Ga0495684_0077944
326 Ga0496102_0839341
327 Ga0496126_0024237
328 Ga0496126_0048927
329 Ga0496126_0487419
330 Ga0501031_0057923
331 Ga0501032_0001000
332 Ga0501032_0099397
333 Ga0501032_0114962
334 Ga0501032_0638570
335 Ga0501033_0108252
336 Ga0501033_0238446
337 Ga0501034_0007348
338 Ga0501034_0100841
339 Ga0501036_0005470
340 Ga0501036_0009586
341 Ga0501036_0128520
342 Ga0501037_0001093
343 Ga0501037_0106351
344 Ga0501038_0020404
345 Ga0501038_0164969
346 Ga0501039_0063876
347 Ga0501039_0149497
348 Ga0501039_0263894
349 Ga0501040_0003440
350 Ga0501041_0014808
351 Ga0501042_0234638
352 Ga0501043_0009466
353 Ga0501043_0169026
354 Ga0501043_0341173
355 Ga0501047_0001262
356 Ga0501047_0005569
357 Ga0501048_0004219
358 Ga0501048_0560616
359 Ga0501067_0002080
360 Ga0501067_0351836
361 Ga0501068_0000777
362 Ga0501068_0315320
363 Ga0501069_0135446
364 Ga0501070_0007337
365 Ga0501070_0013360
366 Ga0501070_0018138
367 Ga0501071_0000235
368 Ga0501072_0003491
369 Ga0501073_0000046
370 Ga0501073_0098317
371 Ga0501074_0034901
372 Ga0501074_0174996
373 Ga0501076_0018023
374 Ga0501077_0044392
375 Ga0501079_0176008
376 Ga0501080_0058557
377 Ga0501080_0197518
378 Ga0501080_0330277
379 Ga0501080_1256311
380 Ga0501083_0004720
381 Ga0501035_0006050
382 Ga0501035_0022441
383 Ga0501035_0438176
384 Ga0501044_0002251
385 Ga0501044_0036598
386 Ga0501045_0060362
387 Ga0501045_0148788
388 nmdc:mga00v17_145345_c1
389 nmdc:mga0yw44_37363_c1
390 nmdc:mga0yw44_72351_c1
391 nmdc:mga08y16_1156550_c1
392 nmdc:mga08y16_988039_c1
393 nmdc:mga0n895_1691719_c1
394 Ga0495601_0003255
395 Ga0495619_0041101
396 Ga0500644_0018732
397 Ga0500651_0001489
398 Ga0500556_0000283
399 Ga0500562_002827
400 Ga0500593_000747
401 Ga0500655_033418
402 Ga0500559_0000387
403 Ga0500573_0086554
404 Ga0500588_0178991
405 Ga0500616_0058469
406 Ga0501084_0023548
407 Ga0501082_0380069
408 Ga0466962_0127890
409 Ga0530510_0061517
410 2547410338
411 2554261178
412 2588108361
413 2644439916
414 2676481244
415 2808843923
416 2809235309
417 2809590910
418 2812478872
419 2855670908
420 2855681271
421 2857289526
422 2858851850
423 2858882648
424 2858894824
425 2858899814
426 2861527017
427 2862710725
428 2869054061
429 2869064916
430 2869074603
431 2880501829
432 2891401176
433 2891560126
434 2912721619
435 2919471606
436 2990045514
437 8003859014
438 8033686471
439 8054733825
440 8055415029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

132

0.87

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

142

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

17

143

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.884 1 133
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8772 2 133
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8758 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8697 1 135
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8652 1 133
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9203 83 134 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9164 83 132 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8882 84 133 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8696 84 136 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8501 83 132 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1A3D5H7-F1-model_v4 Glyoxalase 0.9944 1 136
AF-A0A369VAR3-F1-model_v4 VOC family protein 0.9938 1 136
AF-A0A7V9NV14-F1-model_v4 VOC family protein 0.993 1 136
AF-A0A367B1M2-F1-model_v4 VOC family protein 0.9929 1 136
AF-A0A1I1X1U5-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.9927 1 136

Map