F331520

General Info

Members Datasets Scaffolds Average Seq Length
219 125 215 286

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0032331|Ga0501033_0032331_1457_2443
Length 328
Sequence MLLFTARALSGGRVLDNRSAASKAGNRRMPAMTRKRIALIEAGGTKLIVGIADGDRTIAARTRIPTTNPAETIGAAIDWLRAQGGDYAAVGIASFGPLDLDPASPDWGHITRTTKAGWSEAAMAAPFARALGCPVAIDTDVNGAAIAEYRWGAGQGCRSALYLTVGTGIGGGAVVGGRLIYGTSHPEMGHIAMPRHPDDRDFGGICPFHGDCLEGLASGPAIAARWRASLSDLPAEHGAHAIIAWYLARAIMSFQAILAPDRIILGGGVMETPGLLDRVRREVVTAAGDYFAGRPEEMIVAPVLGGDAGLLGALALTEVEGNLRAADG

Samples

Sample ID Description Type Environment
1 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
2 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
64 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
67 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
68 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
69 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
70 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
71 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
72 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
73 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
74 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
75 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
117 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
118 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
119 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
124 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
125 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.76
Nodule 0
Rhizoplane 1.83
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1012923 3300003762 Bacteria 1424
2 Ga0055536_1002105 3300003781 Bacteria 11326
3 Ga0055530_10000005 3300003791 Bacteria 206625
4 Ga0055531_10001265 3300003794 Bacteria 19142
5 Ga0055531_10002278 3300003794 Bacteria 12988
6 Ga0070680_100001590 3300005336 Bacteria 16586
7 Ga0070680_100063228 3300005336 Bacteria 3031
8 Ga0070668_100023534 3300005347 Bacteria 4659
9 Ga0070671_100009478 3300005355 Bacteria 7817
10 Ga0070681_10000641 3300005458 Bacteria 28787
11 Ga0070707_100516697 3300005468 Bacteria 1156
12 Ga0070679_100002952 3300005530 Bacteria 15499
13 Ga0070679_100038146 3300005530 Bacteria 4776
14 Ga0068855_100001881 3300005563 Bacteria 26066
15 Ga0068855_100008034 3300005563 Bacteria 12748
16 Ga0068855_100087816 3300005563 Bacteria 3593
17 Ga0068859_100012359 3300005617 Bacteria 8587
18 Ga0068863_100215688 3300005841 Bacteria 1848
19 Ga0068858_100001179 3300005842 Bacteria 27095
20 Ga0068862_100317608 3300005844 Bacteria 1437
21 Ga0070716_100343611 3300006173 Bacteria 1054
22 Ga0075428_100012721 3300006844 Bacteria 9360
23 Ga0075430_100048573 3300006846 Bacteria 3583
24 Ga0075431_100000347 3300006847 Bacteria 36515
25 Ga0075431_100139620 3300006847 Bacteria 2498
26 Ga0075433_10355894 3300006852 Bacteria 1293
27 Ga0075434_100057753 3300006871 Bacteria 3856
28 Ga0075429_100086425 3300006880 Bacteria 2733
29 Ga0075436_100295222 3300006914 Bacteria 1161
30 Ga0097620_100012359 3300006931 Bacteria 8587
31 Ga0105240_10000988 3300009093 Bacteria 50723
32 Ga0105240_10005726 3300009093 Bacteria 18435
33 Ga0114129_10008077 3300009147 Bacteria 14993
34 Ga0114129_10255091 3300009147 Bacteria 2353
35 Ga0105248_10012112 3300009177 Bacteria 9514
36 Ga0105238_10000440 3300009551 Bacteria 43764
37 Ga0105238_10023518 3300009551 Bacteria 6280
38 Ga0105246_10018505 3300011119 Unclassified 4442
39 Ga0157370_10001186 3300013104 Bacteria 32487
40 Ga0157370_10007395 3300013104 Bacteria 11962
41 Ga0157369_10003030 3300013105 Bacteria 20057
42 Ga0157372_10070173 3300013307 Bacteria 3942
43 Ga0209148_1000332 3300025254 Bacteria 64492
44 Ga0209675_1000357 3300025291 Bacteria 39250
45 Ga0209676_1000132 3300025292 Bacteria 185063
46 Ga0209676_1057394 3300025292 Bacteria 987
47 Ga0209025_1065932 3300025294 Bacteria 1319
48 Ga0209050_1000139 3300025298 Bacteria 173691
49 Ga0209257_1000164 3300025304 Bacteria 173339
50 Ga0207645_10097644 3300025907 Bacteria 1893
51 Ga0207707_10001261 3300025912 Bacteria 23696
52 Ga0207707_10002139 3300025912 Bacteria 17896
53 Ga0207707_10010396 3300025912 Bacteria 8076
54 Ga0207695_10015277 3300025913 Bacteria 9050
55 Ga0207695_10030894 3300025913 Bacteria 5890
56 Ga0207660_10063218 3300025917 Bacteria 2668
57 Ga0207652_10013031 3300025921 Bacteria 6730
58 Ga0207694_10014609 3300025924 Bacteria 5921
59 Ga0207694_10023654 3300025924 Unclassified 4665
60 Ga0207644_10030258 3300025931 Bacteria 3763
61 Ga0207665_10104812 3300025939 Bacteria 1980
62 Ga0207667_10019396 3300025949 Bacteria 7592
63 Ga0207667_10099189 3300025949 Bacteria 3005
64 Ga0207668_10155445 3300025972 Bacteria 1776
65 Ga0207703_10007921 3300026035 Bacteria 8401
66 Ga0207702_10142037 3300026078 Bacteria 2174
67 Ga0268265_10392213 3300028380 Bacteria 1281
68 Ga0268265_10451561 3300028380 Bacteria 1201
69 Ga0265327_10000260 3300031251 Bacteria 104663
70 Ga0307406_10061857 3300031901 Bacteria 2420
71 Ga0307412_10009713 3300031911 Bacteria 5526
72 Ga0307414_10161528 3300032004 Bacteria 1780
73 Ga0439460_0037879 3300042461 Bacteria 1404
74 Ga0451577_0097980 3300042876 Bacteria 2619
75 Ga0453684_0086172 3300044712 Bacteria 3899
76 Ga0451576_0000073 3300045051 Bacteria 253094
77 Ga0451576_0097882 3300045051 Bacteria 3051
78 Ga0451576_0286075 3300045051 Bacteria 1723
79 Ga0495630_0172715 3300046517 Bacteria 1647
80 Ga0495621_0002108 3300046539 Bacteria 5269
81 Ga0495668_0000024 3300046616 Bacteria 359469
82 Ga0496110_0133500 3300048913 Bacteria 2242
83 Ga0496111_0408396 3300048914 Bacteria 1003
84 Ga0496113_0082219 3300048916 Bacteria 2470
85 Ga0496114_0030569 3300048917 Bacteria 4432
86 Ga0496117_0037927 3300048920 Bacteria 3582
87 Ga0496118_0176254 3300048921 Bacteria 1298
88 Ga0496119_0064756 3300048922 Bacteria 2169
89 Ga0496120_0001498 3300048923 Bacteria 27651
90 Ga0496121_0000947 3300048924 Bacteria 52572
91 Ga0496122_0000071 3300048925 Bacteria 222537
92 Ga0496123_0000006 3300048926 Bacteria 647258
93 Ga0496124_0194267 3300048927 Unclassified 1550
94 Ga0496125_0109830 3300048928 Bacteria 2001
95 Ga0496125_0123483 3300048928 Bacteria 1840
96 Ga0496126_0158213 3300048929 Bacteria 1937
97 Ga0501031_0184008 3300049568 Bacteria 1364
98 Ga0501031_0283614 3300049568 Bacteria 1074
99 Ga0501033_0032331 3300049570 Bacteria 3929
100 Ga0501034_0032848 3300049571 Bacteria 5269
101 Ga0501036_0003037 3300049572 Bacteria 13367
102 Ga0501036_0052787 3300049572 Bacteria 3443
103 Ga0501036_0079793 3300049572 Unclassified 2767
104 Ga0501036_0087240 3300049572 Bacteria 2637
105 Ga0501037_0074723 3300049573 Bacteria 2462
106 Ga0501038_0025718 3300049574 Bacteria 5244
107 Ga0501038_0051832 3300049574 Bacteria 3539
108 Ga0501038_0254093 3300049574 Bacteria 1391
109 Ga0501039_0005431 3300049575 Bacteria 9637
110 Ga0501039_0016076 3300049575 Bacteria 5731
111 Ga0501039_0088184 3300049575 Unclassified 2417
112 Ga0501039_0122021 3300049575 Bacteria 2043
113 Ga0501039_0178747 3300049575 Unclassified 1669
114 Ga0501039_0469378 3300049575 Bacteria 988
115 Ga0501040_0005764 3300049576 Bacteria 8016
116 Ga0501040_0037318 3300049576 Bacteria 3301
117 Ga0501040_0096028 3300049576 Bacteria 2063
118 Ga0501041_0007965 3300049577 Bacteria 6232
119 Ga0501041_0010137 3300049577 Bacteria 5552
120 Ga0501041_0042514 3300049577 Bacteria 2762
121 Ga0501042_0002472 3300049578 Bacteria 11352
122 Ga0501042_0039303 3300049578 Bacteria 3361
123 Ga0501042_0309595 3300049578 Unclassified 1141
124 Ga0501042_0330552 3300049578 Bacteria 1102
125 Ga0501043_0106829 3300049579 Bacteria 2198
126 Ga0501043_0267682 3300049579 Bacteria 1312
127 Ga0501046_0005795 3300049580 Bacteria 11024
128 Ga0501046_0080953 3300049580 Bacteria 2508
129 Ga0501046_0143493 3300049580 Bacteria 1805
130 Ga0501046_0309165 3300049580 Unclassified 1153
131 Ga0501048_0005424 3300049582 Bacteria 9697
132 Ga0501048_0035298 3300049582 Bacteria 3600
133 Ga0501048_0336190 3300049582 Bacteria 1076
134 Ga0501048_0350403 3300049582 Unclassified 1053
135 Ga0501048_0465769 3300049582 Bacteria 905
136 Ga0501068_0161443 3300049584 Bacteria 1412
137 Ga0501069_0013643 3300049585 Bacteria 4335
138 Ga0501070_0212117 3300049586 Bacteria 1589
139 Ga0501071_0001541 3300049587 Bacteria 13454
140 Ga0501071_0057753 3300049587 Bacteria 2804
141 Ga0501071_0172421 3300049587 Bacteria 1620
142 Ga0501072_0015542 3300049588 Bacteria 5832
143 Ga0501072_0022479 3300049588 Bacteria 4892
144 Ga0501072_0078282 3300049588 Bacteria 2617
145 Ga0501072_0274001 3300049588 Bacteria 1342
146 Ga0501072_0508620 3300049588 Unclassified 952
147 Ga0501073_0049339 3300049589 Bacteria 2952
148 Ga0501074_0015176 3300049590 Bacteria 5601
149 Ga0501074_0078613 3300049590 Bacteria 2367
150 Ga0501075_0013580 3300049591 Bacteria 5815
151 Ga0501075_0031025 3300049591 Bacteria 3964
152 Ga0501075_0076637 3300049591 Unclassified 2529
153 Ga0501075_0091806 3300049591 Bacteria 2304
154 Ga0501075_0132161 3300049591 Bacteria 1901
155 Ga0501075_0135768 3300049591 Bacteria 1874
156 Ga0501075_0249935 3300049591 Unclassified 1351
157 Ga0501076_0004172 3300049592 Bacteria 10234
158 Ga0501076_0020866 3300049592 Bacteria 5016
159 Ga0501076_0044127 3300049592 Bacteria 3515
160 Ga0501076_0101160 3300049592 Bacteria 2323
161 Ga0501076_0328811 3300049592 Bacteria 1254
162 Ga0501077_0004455 3300049593 Bacteria 8510
163 Ga0501077_0044302 3300049593 Bacteria 2827
164 Ga0501077_0109120 3300049593 Bacteria 1753
165 Ga0501079_0010910 3300049741 Bacteria 6921
166 Ga0501079_0011636 3300049741 Bacteria 6718
167 Ga0501079_0064222 3300049741 Bacteria 2832
168 Ga0501079_0077461 3300049741 Unclassified 2572
169 Ga0501079_0125745 3300049741 Bacteria 1995
170 Ga0501079_0190081 3300049741 Bacteria 1602
171 Ga0501080_0014491 3300049742 Bacteria 7262
172 Ga0501080_0029192 3300049742 Bacteria 5134
173 Ga0501081_0084059 3300049743 Bacteria 2232
174 Ga0501081_0103946 3300049743 Bacteria 2010
175 Ga0501081_0192601 3300049743 Bacteria 1477
176 Ga0501081_0210150 3300049743 Bacteria 1413
177 Ga0501081_0394368 3300049743 Unclassified 1024
178 Ga0501083_0025944 3300049744 Bacteria 4055
179 Ga0501035_0006970 3300049822 Bacteria 10555
180 Ga0501035_0059781 3300049822 Bacteria 3394
181 Ga0501035_0249018 3300049822 Bacteria 1509
182 Ga0501044_0012651 3300049823 Bacteria 9137
183 Ga0501044_0249757 3300049823 Bacteria 1715
184 Ga0501044_0344762 3300049823 Bacteria 1410
185 Ga0501045_0003092 3300049824 Bacteria 11377
186 Ga0501045_0038752 3300049824 Bacteria 3467
187 Ga0501045_0108425 3300049824 Bacteria 2058
188 nmdc:mga05p37_9743_c1 3300050507 Bacteria 11392
189 nmdc:mga09592_57904_c1 3300050508 Bacteria 3276
190 nmdc:mga0qj67_1761_c1 3300050509 Bacteria 15320
191 nmdc:mga0qj67_42189_c1 3300050509 Bacteria 3591
192 nmdc:mga06r32_87826_c1 3300050510 Bacteria 3034
193 nmdc:mga0n895_235102_c1 3300050512 Bacteria 1860
194 nmdc:mga0n895_29567_c1 3300050512 Bacteria 5228
195 nmdc:mga08x19_116073_c1 3300050514 Bacteria 1790
196 nmdc:mga0a205_253790_c1 3300050515 Bacteria 1638
197 Ga0500608_041828 3300053122 Bacteria 2199
198 Ga0500618_003011 3300053125 Bacteria 5987
199 Ga0500658_0029683 3300053134 Bacteria 2129
200 Ga0500590_000344 3300053148 Bacteria 15217
201 Ga0500616_0010161 3300053153 Bacteria 5651
202 Ga0501084_0009393 3300054114 Bacteria 8091
203 Ga0501084_0023328 3300054114 Bacteria 5164
204 Ga0501084_0026677 3300054114 Bacteria 4823
205 Ga0501084_0081735 3300054114 Bacteria 2710
206 Ga0501084_0101747 3300054114 Bacteria 2413
207 Ga0501084_0166779 3300054114 Bacteria 1858
208 Ga0501082_0008321 3300060353 Bacteria 8948
209 Ga0501082_0052593 3300060353 Bacteria 3511
210 Ga0501082_0084803 3300060353 Bacteria 2732
211 Ga0501082_0112454 3300060353 Unclassified 2358
212 Ga0530510_0015769 3300061734 Bacteria 5342
213 Ga0530510_0018085 3300061734 Bacteria 4996
214 Ga0530510_0217693 3300061734 Unclassified 1419
215 Ga0530510_0266429 3300061734 Bacteria 1278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0091806 Ga0501075_0091806_38_739 193
2 3300049582 Ga0501048_0336190 Ga0501048_0336190_339_1046 194
3 3300061734 Ga0530510_0217693 Ga0530510_0217693_21_740 199
4 3300060353 Ga0501082_0112454 Ga0501082_0112454_1593_2333 206
5 3300048914 Ga0496111_0408396 Ga0496111_0408396_193_972 219
6 3300049743 Ga0501081_0210150 Ga0501081_0210150_508_1398 228
7 3300049580 Ga0501046_0309165 Ga0501046_0309165_26_841 229
8 3300049579 Ga0501043_0267682 Ga0501043_0267682_482_1297 230
9 3300049580 Ga0501046_0080953 Ga0501046_0080953_14_829 230
10 3300049584 Ga0501068_0161443 Ga0501068_0161443_27_842 230
11 3300049586 Ga0501070_0212117 Ga0501070_0212117_48_863 230
12 3300049588 Ga0501072_0508620 Ga0501072_0508620_37_939 230
13 3300054114 Ga0501084_0081735 Ga0501084_0081735_1810_2625 230
14 3300049588 Ga0501072_0274001 Ga0501072_0274001_444_1310 234
15 3300049592 Ga0501076_0328811 Ga0501076_0328811_84_950 234
16 3300006914 Ga0075436_100295222 Ga0075436_1002952221 235
17 3300050514 nmdc:mga08x19_116073_c1 nmdc:mga08x19_116073_c1_128_991 235
18 3300049568 Ga0501031_0283614 Ga0501031_0283614_170_1003 236
19 3300028380 Ga0268265_10451561 Ga0268265_104515612 239
20 3300049591 Ga0501075_0135768 Ga0501075_0135768_346_1194 240
21 3300049592 Ga0501076_0101160 Ga0501076_0101160_238_1086 240
22 3300049593 Ga0501077_0044302 Ga0501077_0044302_1930_2778 240
23 3300049741 Ga0501079_0125745 Ga0501079_0125745_248_1096 240
24 3300049743 Ga0501081_0192601 Ga0501081_0192601_327_1175 240
25 3300061734 Ga0530510_0266429 Ga0530510_0266429_85_933 240
26 3300006847 Ga0075431_100000347 Ga0075431_10000034713 241
27 3300009147 Ga0114129_10008077 Ga0114129_1000807712 241
28 3300049574 Ga0501038_0254093 Ga0501038_0254093_270_1136 241
29 3300050507 nmdc:mga05p37_9743_c1 nmdc:mga05p37_9743_c1_5661_6566 241
30 3300050509 nmdc:mga0qj67_1761_c1 nmdc:mga0qj67_1761_c1_11180_12085 241
31 3300005468 Ga0070707_100516697 Ga0070707_1005166972 242
32 iso_pu_bacteria 2919138771 2919142321 243
33 3300031251 Ga0265327_10000260 Ga0265327_1000026070 244
34 3300049572 Ga0501036_0003037 Ga0501036_0003037_6542_7399 244
35 3300049574 Ga0501038_0051832 Ga0501038_0051832_184_1041 244
36 3300049575 Ga0501039_0005431 Ga0501039_0005431_1338_2195 244
37 3300049575 Ga0501039_0469378 Ga0501039_0469378_44_901 244
38 3300049576 Ga0501040_0037318 Ga0501040_0037318_2396_3253 244
39 3300049577 Ga0501041_0007965 Ga0501041_0007965_3655_4512 244
40 3300049577 Ga0501041_0042514 Ga0501041_0042514_1846_2703 244
41 3300049578 Ga0501042_0002472 Ga0501042_0002472_3384_4241 244
42 3300049579 Ga0501043_0106829 Ga0501043_0106829_358_1215 244
43 3300049580 Ga0501046_0005795 Ga0501046_0005795_2044_2901 244
44 3300049580 Ga0501046_0143493 Ga0501046_0143493_883_1740 244
45 3300049582 Ga0501048_0005424 Ga0501048_0005424_1709_2566 244
46 3300049582 Ga0501048_0465769 Ga0501048_0465769_20_877 244
47 3300049585 Ga0501069_0013643 Ga0501069_0013643_2386_3243 244
48 3300049587 Ga0501071_0001541 Ga0501071_0001541_5842_6699 244
49 3300049588 Ga0501072_0022479 Ga0501072_0022479_3511_4368 244
50 3300049589 Ga0501073_0049339 Ga0501073_0049339_154_1011 244
51 3300049590 Ga0501074_0015176 Ga0501074_0015176_2713_3570 244
52 3300049591 Ga0501075_0013580 Ga0501075_0013580_3553_4410 244
53 3300049591 Ga0501075_0031025 Ga0501075_0031025_3039_3896 244
54 3300049592 Ga0501076_0004172 Ga0501076_0004172_9259_10116 244
55 3300049592 Ga0501076_0044127 Ga0501076_0044127_2566_3423 244
56 3300049593 Ga0501077_0004455 Ga0501077_0004455_1406_2263 244
57 3300049741 Ga0501079_0011636 Ga0501079_0011636_3372_4229 244
58 3300049741 Ga0501079_0064222 Ga0501079_0064222_252_1109 244
59 3300049742 Ga0501080_0014491 Ga0501080_0014491_118_975 244
60 3300049743 Ga0501081_0084059 Ga0501081_0084059_1336_2193 244
61 3300049744 Ga0501083_0025944 Ga0501083_0025944_1480_2337 244
62 3300049822 Ga0501035_0006970 Ga0501035_0006970_6372_7229 244
63 3300049824 Ga0501045_0003092 Ga0501045_0003092_8476_9333 244
64 3300049824 Ga0501045_0108425 Ga0501045_0108425_1156_2013 244
65 3300054114 Ga0501084_0009393 Ga0501084_0009393_5332_6189 244
66 3300054114 Ga0501084_0166779 Ga0501084_0166779_926_1783 244
67 3300060353 Ga0501082_0052593 Ga0501082_0052593_2601_3458 244
68 3300061734 Ga0530510_0018085 Ga0530510_0018085_4090_4947 244
69 3300005336 Ga0070680_100063228 Ga0070680_1000632283 245
70 3300006852 Ga0075433_10355894 Ga0075433_103558942 245
71 3300006871 Ga0075434_100057753 Ga0075434_1000577534 245
72 3300009147 Ga0114129_10255091 Ga0114129_102550911 245
73 3300025907 Ga0207645_10097644 Ga0207645_100976442 245
74 3300025912 Ga0207707_10010396 Ga0207707_100103963 245
75 3300045051 Ga0451576_0097882 Ga0451576_0097882_1936_2799 245
76 3300049576 Ga0501040_0096028 Ga0501040_0096028_825_1688 245
77 3300049578 Ga0501042_0309595 Ga0501042_0309595_60_923 245
78 3300049743 Ga0501081_0394368 Ga0501081_0394368_149_1012 245
79 3300050512 nmdc:mga0n895_235102_c1 nmdc:mga0n895_235102_c1_797_1660 245
80 3300050512 nmdc:mga0n895_29567_c1 nmdc:mga0n895_29567_c1_3962_4837 245
81 3300050515 nmdc:mga0a205_253790_c1 nmdc:mga0a205_253790_c1_477_1352 245
82 3300054114 Ga0501084_0101747 Ga0501084_0101747_380_1243 245
83 3300060353 Ga0501082_0084803 Ga0501082_0084803_1520_2383 245
84 iso_pu_bacteria 2852680915 2852683792 245
85 3300049575 Ga0501039_0178747 Ga0501039_0178747_25_891 246
86 3300049578 Ga0501042_0330552 Ga0501042_0330552_30_893 246
87 3300049591 Ga0501075_0249935 Ga0501075_0249935_392_1258 246
88 3300049741 Ga0501079_0077461 Ga0501079_0077461_1629_2495 246
89 3300054114 Ga0501084_0026677 Ga0501084_0026677_12_878 246
90 3300046539 Ga0495621_0002108 Ga0495621_0002108_3643_4518 247
91 3300049568 Ga0501031_0184008 Ga0501031_0184008_35_901 247
92 3300049572 Ga0501036_0087240 Ga0501036_0087240_451_1317 247
93 3300049573 Ga0501037_0074723 Ga0501037_0074723_1534_2400 247
94 3300049574 Ga0501038_0025718 Ga0501038_0025718_4312_5178 247
95 3300049575 Ga0501039_0016076 Ga0501039_0016076_4835_5701 247
96 3300049576 Ga0501040_0005764 Ga0501040_0005764_7122_7988 247
97 3300049577 Ga0501041_0010137 Ga0501041_0010137_4631_5497 247
98 3300049578 Ga0501042_0039303 Ga0501042_0039303_182_1048 247
99 3300049582 Ga0501048_0035298 Ga0501048_0035298_2674_3540 247
100 3300049587 Ga0501071_0172421 Ga0501071_0172421_694_1560 247
101 3300049588 Ga0501072_0078282 Ga0501072_0078282_1724_2590 247
102 3300049590 Ga0501074_0078613 Ga0501074_0078613_55_921 247
103 3300049591 Ga0501075_0132161 Ga0501075_0132161_567_1433 247
104 3300049592 Ga0501076_0020866 Ga0501076_0020866_441_1307 247
105 3300049593 Ga0501077_0109120 Ga0501077_0109120_195_1061 247
106 3300049741 Ga0501079_0010910 Ga0501079_0010910_4376_5242 247
107 3300049742 Ga0501080_0029192 Ga0501080_0029192_4209_5075 247
108 3300049743 Ga0501081_0103946 Ga0501081_0103946_68_934 247
109 3300049822 Ga0501035_0059781 Ga0501035_0059781_62_928 247
110 3300049823 Ga0501044_0344762 Ga0501044_0344762_483_1349 247
111 3300060353 Ga0501082_0008321 Ga0501082_0008321_67_933 247
112 3300061734 Ga0530510_0015769 Ga0530510_0015769_4443_5309 247
113 3300048929 Ga0496126_0158213 Ga0496126_0158213_707_1591 248
114 3300049572 Ga0501036_0079793 Ga0501036_0079793_426_1301 248
115 3300049575 Ga0501039_0088184 Ga0501039_0088184_450_1325 248
116 3300049587 Ga0501071_0057753 Ga0501071_0057753_208_1083 248
117 3300049588 Ga0501072_0015542 Ga0501072_0015542_3946_4821 248
118 3300049591 Ga0501075_0076637 Ga0501075_0076637_405_1280 248
119 3300049741 Ga0501079_0190081 Ga0501079_0190081_329_1204 248
120 3300049824 Ga0501045_0038752 Ga0501045_0038752_1144_2019 248
121 3300054114 Ga0501084_0023328 Ga0501084_0023328_3885_4760 248
122 3300003781 Ga0055536_1002105 Ga0055536_10021052 249
123 3300003791 Ga0055530_10000005 Ga0055530_1000000585 249
124 3300003794 Ga0055531_10001265 Ga0055531_1000126515 249
125 3300003794 Ga0055531_10002278 Ga0055531_100022787 249
126 3300025291 Ga0209675_1000357 Ga0209675_100035730 249
127 3300025292 Ga0209676_1000132 Ga0209676_100013252 249
128 3300025298 Ga0209050_1000139 Ga0209050_100013953 249
129 3300025304 Ga0209257_1000164 Ga0209257_1000164133 249
130 3300031901 Ga0307406_10061857 Ga0307406_100618572 249
131 3300031911 Ga0307412_10009713 Ga0307412_100097134 249
132 3300032004 Ga0307414_10161528 Ga0307414_101615282 249
133 iso_pu_bacteria 8057101203 8057103535 249
134 3300025294 Ga0209025_1065932 Ga0209025_10659321 250
135 3300042876 Ga0451577_0097980 Ga0451577_0097980_97_993 251
136 3300044712 Ga0453684_0086172 Ga0453684_0086172_1010_1906 251
137 3300045051 Ga0451576_0286075 Ga0451576_0286075_363_1259 251
138 3300048920 Ga0496117_0037927 Ga0496117_0037927_746_1639 251
139 3300048921 Ga0496118_0176254 Ga0496118_0176254_312_1205 251
140 3300048922 Ga0496119_0064756 Ga0496119_0064756_317_1210 251
141 3300048923 Ga0496120_0001498 Ga0496120_0001498_12753_13646 251
142 3300048925 Ga0496122_0000071 Ga0496122_0000071_74783_75676 251
143 3300048926 Ga0496123_0000006 Ga0496123_0000006_499507_500400 251
144 3300048928 Ga0496125_0109830 Ga0496125_0109830_224_1117 251
145 3300048928 Ga0496125_0123483 Ga0496125_0123483_724_1617 251
146 3300050508 nmdc:mga09592_57904_c1 nmdc:mga09592_57904_c1_1473_2351 251
147 3300053125 Ga0500618_003011 Ga0500618_003011_1892_2767 251
148 3300005844 Ga0068862_100317608 Ga0068862_1003176082 252
149 3300006880 Ga0075429_100086425 Ga0075429_1000864255 252
150 3300011119 Ga0105246_10018505 Ga0105246_100185051 252
151 3300025292 Ga0209676_1057394 Ga0209676_10573941 252
152 3300028380 Ga0268265_10392213 Ga0268265_103922132 252
153 3300045051 Ga0451576_0000073 Ga0451576_0000073_152267_153166 252
154 3300049582 Ga0501048_0350403 Ga0501048_0350403_52_954 253
155 3300053148 Ga0500590_000344 Ga0500590_000344_4019_4945 253
156 3300005563 Ga0068855_100087816 Ga0068855_1000878162 254
157 3300046616 Ga0495668_0000024 Ga0495668_0000024_13501_14403 254
158 3300048924 Ga0496121_0000947 Ga0496121_0000947_22975_23871 254
159 3300005336 Ga0070680_100001590 Ga0070680_1000015903 255
160 3300005458 Ga0070681_10000641 Ga0070681_1000064113 255
161 3300005530 Ga0070679_100002952 Ga0070679_1000029525 255
162 3300005530 Ga0070679_100038146 Ga0070679_1000381465 255
163 3300005563 Ga0068855_100001881 Ga0068855_10000188121 255
164 3300005563 Ga0068855_100008034 Ga0068855_1000080343 255
165 3300009093 Ga0105240_10000988 Ga0105240_1000098817 255
166 3300009093 Ga0105240_10005726 Ga0105240_100057263 255
167 3300009551 Ga0105238_10000440 Ga0105238_1000044029 255
168 3300009551 Ga0105238_10023518 Ga0105238_100235183 255
169 3300013104 Ga0157370_10001186 Ga0157370_100011864 255
170 3300013104 Ga0157370_10007395 Ga0157370_100073954 255
171 3300013105 Ga0157369_10003030 Ga0157369_100030306 255
172 3300025912 Ga0207707_10001261 Ga0207707_1000126117 255
173 3300025912 Ga0207707_10002139 Ga0207707_100021397 255
174 3300025913 Ga0207695_10015277 Ga0207695_100152772 255
175 3300025913 Ga0207695_10030894 Ga0207695_100308943 255
176 3300025917 Ga0207660_10063218 Ga0207660_100632182 255
177 3300025921 Ga0207652_10013031 Ga0207652_100130313 255
178 3300025924 Ga0207694_10014609 Ga0207694_100146095 255
179 3300025924 Ga0207694_10023654 Ga0207694_100236543 255
180 3300025949 Ga0207667_10019396 Ga0207667_100193961 255
181 3300025949 Ga0207667_10099189 Ga0207667_100991892 255
182 3300026078 Ga0207702_10142037 Ga0207702_101420372 255
183 3300046517 Ga0495630_0172715 Ga0495630_0172715_337_1248 256
184 3300049570 Ga0501033_0032331 Ga0501033_0032331_1457_2443 256
185 3300049571 Ga0501034_0032848 Ga0501034_0032848_2762_3748 256
186 3300049572 Ga0501036_0052787 Ga0501036_0052787_2078_3064 256
187 3300049575 Ga0501039_0122021 Ga0501039_0122021_435_1337 256
188 3300049822 Ga0501035_0249018 Ga0501035_0249018_118_1104 256
189 3300049823 Ga0501044_0012651 Ga0501044_0012651_756_1742 256
190 3300049823 Ga0501044_0249757 Ga0501044_0249757_87_1073 256
191 3300053122 Ga0500608_041828 Ga0500608_041828_1239_2117 256
192 3300053134 Ga0500658_0029683 Ga0500658_0029683_666_1598 256
193 3300053153 Ga0500616_0010161 Ga0500616_0010161_3876_4757 257
194 iso_pu_bacteria 8001781756 8001785629 258
195 3300005347 Ga0070668_100023534 Ga0070668_1000235344 259
196 3300005355 Ga0070671_100009478 Ga0070671_1000094781 259
197 3300005617 Ga0068859_100012359 Ga0068859_1000123596 259
198 3300005841 Ga0068863_100215688 Ga0068863_1002156881 259
199 3300005842 Ga0068858_100001179 Ga0068858_1000011793 259
200 3300006931 Ga0097620_100012359 Ga0097620_1000123595 259
201 3300009177 Ga0105248_10012112 Ga0105248_100121127 259
202 3300025931 Ga0207644_10030258 Ga0207644_100302581 259
203 3300025972 Ga0207668_10155445 Ga0207668_101554452 259
204 3300026035 Ga0207703_10007921 Ga0207703_100079214 259
205 3300048913 Ga0496110_0133500 Ga0496110_0133500_908_1813 259
206 3300048916 Ga0496113_0082219 Ga0496113_0082219_1127_2032 259
207 3300048917 Ga0496114_0030569 Ga0496114_0030569_624_1529 259
208 3300048927 Ga0496124_0194267 Ga0496124_0194267_567_1472 259
209 3300006844 Ga0075428_100012721 Ga0075428_1000127215 260
210 3300006846 Ga0075430_100048573 Ga0075430_1000485732 260
211 3300006847 Ga0075431_100139620 Ga0075431_1001396201 260
212 3300050509 nmdc:mga0qj67_42189_c1 nmdc:mga0qj67_42189_c1_230_1141 260
213 3300050510 nmdc:mga06r32_87826_c1 nmdc:mga06r32_87826_c1_262_1173 260
214 3300006173 Ga0070716_100343611 Ga0070716_1003436111 261
215 3300013307 Ga0157372_10070173 Ga0157372_100701732 261
216 3300025939 Ga0207665_10104812 Ga0207665_101048122 261
217 3300042461 Ga0439460_0037879 Ga0439460_0037879_46_969 263
218 3300003762 Ga0055542_1012923 Ga0055542_10129232 268
219 3300025254 Ga0209148_1000332 Ga0209148_100033255 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

37

320

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u65-assembly1.cif.gz_G structure of e. coli dgtpase bound to t7 bacteriophage protein gp1.2 0.8329 16 57
1xc3-assembly1.cif.gz_A structure of a putative fructokinase from bacillus subtilis 0.7955 6 259
4j3b-assembly1.cif.gz_A a naturally variable residue in the s1 subsite of m1-family aminopeptidases modulates catalytic properties and promotes functional specialization 0.77 5 21
3ll3-assembly1.cif.gz_B the crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus 0.7586 4 69
2w40-assembly1.cif.gz_A crystal structure of plasmodium falciparum glycerol kinase with bound glycerol 0.7581 4 69
ID Description Score Start End Superfamily
1xc3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9244 6 112 3.30.420.40
1xc3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9075 6 112 3.30.420.40
af_Q54TJ9_112_309_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8381 115 260 3.30.420.40
af_Q54TJ9_5_111_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8308 4 112 3.30.420.40
3vovB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8257 6 111 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7C4QDI0-F1-model_v4 ROK family protein 0.9608 5 91 GO:0005524
GO:0016301
GO:0046872
AF-A0A2W6C3G6-F1-model_v4 fructokinase (EC 2.7.1.4) 0.9516 4 110 GO:0005524
GO:0016301
GO:0046872
AF-A0A7S2MUE4-F1-model_v4 Uncharacterized protein 0.9414 165 242 GO:0005524
AF-A0A349Z0C7-F1-model_v4 Fructokinase 0.9384 5 84 GO:0016301
AF-W7CVM1-F1-model_v4 Fructokinase 0.9382 6 94 GO:0005524
GO:0016301
GO:0046872

Feature Viewer

pLDDT pTM Quality
85.65 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map