F331272

General Info

Members Datasets Scaffolds Average Seq Length
219 144 438 160

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100445204|Ga0307415_1004452042
Length 169
Sequence LGNDGSMALTNRYRSAPGAGTIAALILVLVFGSPWYADWAEDNTDPDTAGGWWLRLLAWPHWRFDSDDSLRSIVIGDLKAILVVVLTLLFLYLLPGSQLARARGTLSQFFAGWAAYVFAGGFAALLTTLFLANPSLLTAFRTAGEGATYGLFVGWIIGLATLGGRRGTR

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
87 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
88 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
89 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
97 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
113 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
114 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
115 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
116 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
119 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
120 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
121 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
122 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
123 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
124 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
125 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
126 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
127 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
128 2858882152 Micromonospora noduli MED15 Isolate Nodule
129 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
130 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
131 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
132 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
133 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
134 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
135 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
136 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
137 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
138 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
139 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
140 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
141 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
142 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
143 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
144 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.39
Metatranscriptomes 2.28
Isolates 12.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 2.28
Rhizoplane 0.91
Rhizosphere 77.17
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100445204 3300032126 Bacteria 1118
2 JGI25406J46586_10001458 3300003203 Bacteria 11147
3 JGI25406J46586_10017721 3300003203 Bacteria 2939
4 JGI25406J46586_10039078 3300003203 Bacteria 1695
5 JGI25406J46586_10186024 3300003203 Bacteria 606
6 rootH2_10016566 3300003320 Bacteria 3563
7 Ga0007429J51699_1025076 3300003579 Bacteria 697
8 Ga0070658_10519007 3300005327 Bacteria 1030
9 Ga0070683_100384697 3300005329 Bacteria 1337
10 Ga0070666_10225313 3300005335 Bacteria 1323
11 Ga0068868_100602160 3300005338 Bacteria 974
12 Ga0070661_101209619 3300005344 Bacteria 632
13 Ga0070668_100046818 3300005347 Bacteria 3323
14 Ga0070668_100071708 3300005347 Bacteria 2699
15 Ga0070669_100303851 3300005353 Bacteria 1284
16 Ga0070675_100979677 3300005354 Bacteria 776
17 Ga0070667_100134414 3300005367 Bacteria 2162
18 Ga0070709_10903783 3300005434 Bacteria 698
19 Ga0070713_100172024 3300005436 Bacteria 1941
20 Ga0070710_10103823 3300005437 Bacteria 1697
21 Ga0070663_100141191 3300005455 Bacteria 1839
22 Ga0068867_100372565 3300005459 Bacteria 1197
23 Ga0070685_10108973 3300005466 Bacteria 1703
24 Ga0070684_100427621 3300005535 Bacteria 1223
25 Ga0070665_100430364 3300005548 Bacteria 1329
26 Ga0068852_101175546 3300005616 Bacteria 788
27 Ga0068859_100193543 3300005617 Bacteria 2118
28 Ga0068859_101514313 3300005617 Bacteria 740
29 Ga0068864_100481147 3300005618 Bacteria 1192
30 Ga0068860_100034450 3300005843 Bacteria 4856
31 Ga0068860_100928684 3300005843 Bacteria 887
32 Ga0081540_1025296 3300005983 Bacteria 3420
33 Ga0081539_10001096 3300005985 Bacteria 49234
34 Ga0081539_10002399 3300005985 Bacteria 26618
35 Ga0081539_10005125 3300005985 Bacteria 13687
36 Ga0081539_10005655 3300005985 Bacteria 12558
37 Ga0081539_10016734 3300005985 Bacteria 5208
38 Ga0081539_10036153 3300005985 Bacteria 2960
39 Ga0070717_10161492 3300006028 Bacteria 1944
40 Ga0070717_10473164 3300006028 Bacteria 1131
41 Ga0075428_100007635 3300006844 Bacteria 11988
42 Ga0075428_100073604 3300006844 Bacteria 3731
43 Ga0075428_100229522 3300006844 Bacteria 2003
44 Ga0075428_100431318 3300006844 Bacteria 1412
45 Ga0075428_100440846 3300006844 Bacteria 1395
46 Ga0075430_100001256 3300006846 Bacteria 20434
47 Ga0075430_100013811 3300006846 Bacteria 6881
48 Ga0075430_100102509 3300006846 Bacteria 2389
49 Ga0075431_100014810 3300006847 Bacteria 7896
50 Ga0075431_100480623 3300006847 Bacteria 1235
51 Ga0075429_100008000 3300006880 Bacteria 9183
52 Ga0097620_100193558 3300006931 Bacteria 2118
53 Ga0097620_101514366 3300006931 Bacteria 740
54 Ga0105247_10088775 3300009101 Bacteria 1959
55 Ga0114129_10026755 3300009147 Bacteria 8170
56 Ga0105242_11013305 3300009176 Bacteria 839
57 Ga0157369_11215475 3300013105 Bacteria 769
58 Ga0157378_10407892 3300013297 Bacteria 1340
59 Ga0157372_10731449 3300013307 Bacteria 1151
60 Ga0157375_10707536 3300013308 Bacteria 1161
61 Ga0163163_10027468 3300014325 Bacteria 5451
62 Ga0163163_12028710 3300014325 Bacteria 635
63 Ga0157380_10632158 3300014326 Bacteria 1065
64 Ga0157380_11892367 3300014326 Bacteria 657
65 Ga0206352_10190662 3300020078 Unclassified 659
66 Ga0224712_10520200 3300022467 Bacteria 576
67 Ga0207680_10352457 3300025903 Bacteria 1034
68 Ga0207699_10787382 3300025906 Bacteria 699
69 Ga0207643_10486729 3300025908 Bacteria 788
70 Ga0207705_10822111 3300025909 Unclassified 721
71 Ga0207681_10378245 3300025923 Bacteria 1139
72 Ga0207700_10495667 3300025928 Bacteria 1081
73 Ga0207644_11296930 3300025931 Bacteria 612
74 Ga0207712_10608421 3300025961 Bacteria 946
75 Ga0207668_10001447 3300025972 Bacteria 13956
76 Ga0207668_10319732 3300025972 Bacteria 1287
77 Ga0207668_11108843 3300025972 Bacteria 710
78 Ga0207658_10105788 3300025986 Bacteria 2214
79 Ga0207677_10454594 3300026023 Bacteria 1098
80 Ga0207703_10020591 3300026035 Bacteria 5160
81 Ga0207708_10090909 3300026075 Bacteria 2353
82 Ga0207641_10536453 3300026088 Bacteria 1140
83 Ga0207648_11121835 3300026089 Bacteria 738
84 Ga0207674_10195125 3300026116 Bacteria 1974
85 Ga0207683_11063515 3300026121 Bacteria 751
86 Ga0268266_10798847 3300028379 Bacteria 911
87 Ga0268266_11595607 3300028379 Bacteria 628
88 Ga0268265_10223008 3300028380 Bacteria 1651
89 Ga0268264_10050349 3300028381 Bacteria 3468
90 Ga0268264_10926863 3300028381 Bacteria 875
91 Ga0307517_10363379 3300028786 Bacteria 781
92 Ga0307515_10000083 3300028794 Bacteria 222889
93 Ga0307515_10006931 3300028794 Bacteria 22512
94 Ga0307515_10126128 3300028794 Bacteria 2858
95 Ga0307515_10370377 3300028794 Bacteria 1069
96 Ga0307512_10001451 3300030522 Bacteria 33604
97 Ga0307512_10063817 3300030522 Bacteria 2811
98 Ga0307513_10016248 3300031456 Bacteria 8985
99 Ga0307513_10177264 3300031456 Bacteria 2000
100 Ga0307509_10013463 3300031507 Bacteria 9684
101 Ga0307408_100942497 3300031548 Bacteria 792
102 Ga0307508_10005452 3300031616 Bacteria 12095
103 Ga0307516_10003673 3300031730 Bacteria 19506
104 Ga0307516_10012467 3300031730 Bacteria 9158
105 Ga0307516_10366266 3300031730 Bacteria 1105
106 Ga0307405_10006675 3300031731 Bacteria 5698
107 Ga0307405_10019234 3300031731 Bacteria 3788
108 Ga0307405_10173850 3300031731 Bacteria 1539
109 Ga0307405_10400473 3300031731 Bacteria 1074
110 Ga0307405_10721101 3300031731 Bacteria 828
111 Ga0307413_10022162 3300031824 Bacteria 3418
112 Ga0307413_10136954 3300031824 Bacteria 1685
113 Ga0307413_10198863 3300031824 Bacteria 1446
114 Ga0307413_10520077 3300031824 Bacteria 959
115 Ga0307410_10008735 3300031852 Bacteria 5638
116 Ga0307410_10034368 3300031852 Bacteria 3283
117 Ga0307410_10667772 3300031852 Bacteria 873
118 Ga0326468_10000070 3300031889 Bacteria 8332
119 Ga0307406_10019489 3300031901 Bacteria 3981
120 Ga0307406_10029151 3300031901 Bacteria 3341
121 Ga0307406_10044417 3300031901 Bacteria 2784
122 Ga0307406_10374576 3300031901 Bacteria 1120
123 Ga0307407_10060715 3300031903 Bacteria 2207
124 Ga0307407_10124423 3300031903 Bacteria 1640
125 Ga0307412_10043683 3300031911 Bacteria 2920
126 Ga0307412_10374474 3300031911 Bacteria 1151
127 Ga0307409_100004109 3300031995 Bacteria 8103
128 Ga0307409_100047325 3300031995 Bacteria 3263
129 Ga0307416_100001302 3300032002 Bacteria 13467
130 Ga0307416_100043495 3300032002 Bacteria 3517
131 Ga0307416_100087474 3300032002 Bacteria 2660
132 Ga0307416_100158359 3300032002 Bacteria 2089
133 Ga0307414_10088986 3300032004 Bacteria 2287
134 Ga0307414_10271834 3300032004 Bacteria 1420
135 Ga0307411_10062751 3300032005 Bacteria 2480
136 Ga0307411_10100032 3300032005 Bacteria 2048
137 Ga0307411_10339768 3300032005 Bacteria 1220
138 Ga0307411_10852357 3300032005 Bacteria 806
139 Ga0307411_11413856 3300032005 Bacteria 637
140 Ga0307415_100000102 3300032126 Bacteria 35964
141 Ga0307415_100016335 3300032126 Bacteria 4422
142 Ga0307415_100043978 3300032126 Bacteria 2983
143 Ga0307415_100092158 3300032126 Bacteria 2197
144 Ga0307415_100153283 3300032126 Bacteria 1776
145 Ga0307415_100204142 3300032126 Bacteria 1571
146 Ga0307415_100499105 3300032126 Bacteria 1063
147 Ga0307507_10063938 3300033179 Bacteria 3401
148 Ga0307510_10206010 3300033180 Bacteria 1495
149 Ga0373938_0054947 3300034957 Bacteria 918
150 Ga0373951_0000190 3300035091 Bacteria 22296
151 Ga0373932_0005588 3300035112 Bacteria 2958
152 Ga0373939_0137394 3300035114 Bacteria 878
153 Ga0373935_0011274 3300035692 Bacteria 5369
154 Ga0395899_0005742 3300037312 Bacteria 9632
155 Ga0395899_0183348 3300037312 Bacteria 1468
156 Ga0395900_0002127 3300037418 Bacteria 22170
157 Ga0395900_0191326 3300037418 Bacteria 2075
158 Ga0395898_0015255 3300037466 Bacteria 7884
159 Ga0395905_0002509 3300037471 Bacteria 20276
160 Ga0395905_0726368 3300037471 Bacteria 895
161 Ga0395901_0018443 3300038443 Bacteria 7123
162 Ga0395901_0459870 3300038443 Bacteria 1300
163 Ga0451791_0056042 3300041451 Bacteria 645
164 Ga0451849_1271516 3300041505 Bacteria 1051
165 Ga0451853_1524188 3300041512 Bacteria 2137
166 Ga0466963_0319438 3300044694 Bacteria 1093
167 Ga0466967_2123366 3300045976 Bacteria 558
168 Ga0495638_0167831 3300046460 Bacteria 1261
169 Ga0495632_0015306 3300046519 Bacteria 4307
170 Ga0495632_0086962 3300046519 Bacteria 1486
171 Ga0496108_0000089 3300048911 Bacteria 97102
172 Ga0501040_0827458 3300049576 Bacteria 670
173 Ga0501046_0277126 3300049580 Bacteria 1229
174 nmdc:mga05p37_355524_c2 3300050507 Bacteria 1388
175 nmdc:mga05p37_847726_c1 3300050507 Bacteria 993
176 nmdc:mga09592_143521_c1 3300050508 Bacteria 2059
177 nmdc:mga0qj67_1282_c1 3300050509 Bacteria 17594
178 nmdc:mga0qj67_31013_c1 3300050509 Bacteria 4163
179 nmdc:mga0qj67_3969_c1 3300050509 Bacteria 10704
180 nmdc:mga0qj67_801422_c1 3300050509 Bacteria 746
181 nmdc:mga06r32_11768_c1 3300050510 Bacteria 7879
182 nmdc:mga06r32_1265970_c1 3300050510 Bacteria 682
183 nmdc:mga06r32_379600_c1 3300050510 Bacteria 1396
184 Ga0500644_0402896 3300053088 Bacteria 596
185 Ga0500583_0162285 3300053092 Bacteria 1113
186 Ga0500641_0197732 3300053096 Bacteria 859
187 Ga0500641_0200845 3300053096 Bacteria 851
188 Ga0500569_068916 3300053109 Bacteria 1109
189 Ga0500652_072182 3300053131 Bacteria 1432
190 Ga0500630_093670 3300053159 Bacteria 1383
191 Ga0587073_0185968 3300059492 Bacteria 613
192 Ga0587111_0225800 3300060346 Bacteria 543
193 2623585427 2622736626 Bacteria 7181580
194 2676487259 2675903059 Bacteria 8644972
195 2753266973 2751185782 Bacteria 11227053
196 2772645297 2772190715 Bacteria 6959372
197 2831939553 2831935698 Bacteria 5963223
198 2832005821 2832004796 Bacteria 6538017
199 2855672397 2855670206 Bacteria 7120389
200 2855677226 2855676851 Bacteria 7063653
201 2857291437 2857288857 Bacteria 7189066
202 2858850260 2858848962 Bacteria 6963058
203 2858884718 2858882152 Bacteria 7230291
204 2858893329 2858888857 Bacteria 7060307
205 2858900379 2858895516 Bacteria 7378898
206 2866066356 2866065130 Bacteria 6518152
207 2867510548 2867507094 Bacteria 6506033
208 2869050894 2869048445 Bacteria 6875584
209 2869063234 2869061728 Bacteria 7112407
210 2869074858 2869068681 Bacteria 7205615
211 2880494791 2880489317 Bacteria 7096270
212 2880497523 2880495981 Bacteria 7340502
213 2929232749 2929226422 Bacteria 7248583
214 8003836058 8003830390 Bacteria 6541657
215 8003858546 8003856774 Bacteria 7675274
216 8003875776 8003870546 Bacteria 7396674
217 8054710671 8054704163 Bacteria 7247792
218 8054732373 8054727385 Bacteria 7558670
219 8054739336 8054734606 Bacteria 6947278
220 Ga0307415_100445204
221 JGI25406J46586_10001458
222 JGI25406J46586_10017721
223 JGI25406J46586_10039078
224 JGI25406J46586_10186024
225 rootH2_10016566
226 Ga0007429J51699_1025076
227 Ga0070658_10519007
228 Ga0070683_100384697
229 Ga0070666_10225313
230 Ga0068868_100602160
231 Ga0070661_101209619
232 Ga0070668_100046818
233 Ga0070668_100071708
234 Ga0070669_100303851
235 Ga0070675_100979677
236 Ga0070667_100134414
237 Ga0070709_10903783
238 Ga0070713_100172024
239 Ga0070710_10103823
240 Ga0070663_100141191
241 Ga0068867_100372565
242 Ga0070685_10108973
243 Ga0070684_100427621
244 Ga0070665_100430364
245 Ga0068852_101175546
246 Ga0068859_100193543
247 Ga0068859_101514313
248 Ga0068864_100481147
249 Ga0068860_100034450
250 Ga0068860_100928684
251 Ga0081540_1025296
252 Ga0081539_10001096
253 Ga0081539_10002399
254 Ga0081539_10005125
255 Ga0081539_10005655
256 Ga0081539_10016734
257 Ga0081539_10036153
258 Ga0070717_10161492
259 Ga0070717_10473164
260 Ga0075428_100007635
261 Ga0075428_100073604
262 Ga0075428_100229522
263 Ga0075428_100431318
264 Ga0075428_100440846
265 Ga0075430_100001256
266 Ga0075430_100013811
267 Ga0075430_100102509
268 Ga0075431_100014810
269 Ga0075431_100480623
270 Ga0075429_100008000
271 Ga0097620_100193558
272 Ga0097620_101514366
273 Ga0105247_10088775
274 Ga0114129_10026755
275 Ga0105242_11013305
276 Ga0157369_11215475
277 Ga0157378_10407892
278 Ga0157372_10731449
279 Ga0157375_10707536
280 Ga0163163_10027468
281 Ga0163163_12028710
282 Ga0157380_10632158
283 Ga0157380_11892367
284 Ga0206352_10190662
285 Ga0224712_10520200
286 Ga0207680_10352457
287 Ga0207699_10787382
288 Ga0207643_10486729
289 Ga0207705_10822111
290 Ga0207681_10378245
291 Ga0207700_10495667
292 Ga0207644_11296930
293 Ga0207712_10608421
294 Ga0207668_10001447
295 Ga0207668_10319732
296 Ga0207668_11108843
297 Ga0207658_10105788
298 Ga0207677_10454594
299 Ga0207703_10020591
300 Ga0207708_10090909
301 Ga0207641_10536453
302 Ga0207648_11121835
303 Ga0207674_10195125
304 Ga0207683_11063515
305 Ga0268266_10798847
306 Ga0268266_11595607
307 Ga0268265_10223008
308 Ga0268264_10050349
309 Ga0268264_10926863
310 Ga0307517_10363379
311 Ga0307515_10000083
312 Ga0307515_10006931
313 Ga0307515_10126128
314 Ga0307515_10370377
315 Ga0307512_10001451
316 Ga0307512_10063817
317 Ga0307513_10016248
318 Ga0307513_10177264
319 Ga0307509_10013463
320 Ga0307408_100942497
321 Ga0307508_10005452
322 Ga0307516_10003673
323 Ga0307516_10012467
324 Ga0307516_10366266
325 Ga0307405_10006675
326 Ga0307405_10019234
327 Ga0307405_10173850
328 Ga0307405_10400473
329 Ga0307405_10721101
330 Ga0307413_10022162
331 Ga0307413_10136954
332 Ga0307413_10198863
333 Ga0307413_10520077
334 Ga0307410_10008735
335 Ga0307410_10034368
336 Ga0307410_10667772
337 Ga0326468_10000070
338 Ga0307406_10019489
339 Ga0307406_10029151
340 Ga0307406_10044417
341 Ga0307406_10374576
342 Ga0307407_10060715
343 Ga0307407_10124423
344 Ga0307412_10043683
345 Ga0307412_10374474
346 Ga0307409_100004109
347 Ga0307409_100047325
348 Ga0307416_100001302
349 Ga0307416_100043495
350 Ga0307416_100087474
351 Ga0307416_100158359
352 Ga0307414_10088986
353 Ga0307414_10271834
354 Ga0307411_10062751
355 Ga0307411_10100032
356 Ga0307411_10339768
357 Ga0307411_10852357
358 Ga0307411_11413856
359 Ga0307415_100000102
360 Ga0307415_100016335
361 Ga0307415_100043978
362 Ga0307415_100092158
363 Ga0307415_100153283
364 Ga0307415_100204142
365 Ga0307415_100499105
366 Ga0307507_10063938
367 Ga0307510_10206010
368 Ga0373938_0054947
369 Ga0373951_0000190
370 Ga0373932_0005588
371 Ga0373939_0137394
372 Ga0373935_0011274
373 Ga0395899_0005742
374 Ga0395899_0183348
375 Ga0395900_0002127
376 Ga0395900_0191326
377 Ga0395898_0015255
378 Ga0395905_0002509
379 Ga0395905_0726368
380 Ga0395901_0018443
381 Ga0395901_0459870
382 Ga0451791_0056042
383 Ga0451849_1271516
384 Ga0451853_1524188
385 Ga0466963_0319438
386 Ga0466967_2123366
387 Ga0495638_0167831
388 Ga0495632_0015306
389 Ga0495632_0086962
390 Ga0496108_0000089
391 Ga0501040_0827458
392 Ga0501046_0277126
393 nmdc:mga05p37_355524_c2
394 nmdc:mga05p37_847726_c1
395 nmdc:mga09592_143521_c1
396 nmdc:mga0qj67_1282_c1
397 nmdc:mga0qj67_31013_c1
398 nmdc:mga0qj67_3969_c1
399 nmdc:mga0qj67_801422_c1
400 nmdc:mga06r32_11768_c1
401 nmdc:mga06r32_1265970_c1
402 nmdc:mga06r32_379600_c1
403 Ga0500644_0402896
404 Ga0500583_0162285
405 Ga0500641_0197732
406 Ga0500641_0200845
407 Ga0500569_068916
408 Ga0500652_072182
409 Ga0500630_093670
410 Ga0587073_0185968
411 Ga0587111_0225800
412 2623585427
413 2676487259
414 2753266973
415 2772645297
416 2831939553
417 2832005821
418 2855672397
419 2855677226
420 2857291437
421 2858850260
422 2858884718
423 2858893329
424 2858900379
425 2866066356
426 2867510548
427 2869050894
428 2869063234
429 2869074858
430 2880494791
431 2880497523
432 2929232749
433 8003836058
434 8003858546
435 8003875776
436 8054710671
437 8054732373
438 8054739336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nd1-assembly1.cif.gz_B cryoem structure of the sec complex from yeast 0.41 55 148
7r43-assembly1.cif.gz_Y bovine complex i in the presence of im1761092, active class iii (composite map) 0.4074 7 165
7qsd-assembly1.cif.gz_Y bovine complex i in the active state at 3.1 a 0.4057 7 165
7r43-assembly1.cif.gz_Y bovine complex i in the presence of im1761092, active class iii (composite map) 0.3579 7 165
7qsd-assembly1.cif.gz_Y bovine complex i in the active state at 3.1 a 0.3568 7 165
ID Description Score Start End Superfamily
af_Q5JJW1_207_373_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4916 66 157 1.50.40.10
af_I1JDG6_196_363_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4629 66 158 1.50.40.10
af_Q8I513_1_255_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4553 15 156 1.50.40.10
af_Q09461_28_360_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4246 12 157 1.50.40.10
af_A0A1D6DWT9_39_191_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.413 48 157 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A538N4X9-F1-model_v4 Uncharacterized protein 0.9763 11 160 GO:0016020
AF-A0A1Q4ZL32-F1-model_v4 Uncharacterized protein 0.9519 11 159 GO:0016020
AF-A0A1C4TZC2-F1-model_v4 Uncharacterized protein 0.9515 10 159 GO:0016020
AF-A0A2W2BG25-F1-model_v4 Uncharacterized protein 0.9358 10 165 GO:0016020
AF-A0A1C4VZ69-F1-model_v4 Uncharacterized protein 0.9038 20 159 GO:0016020

Map