F330819

General Info

Members Datasets Scaffolds Average Seq Length
219 169 438 283

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100007902|Ga0070706_1000079026
Length 324
Sequence MPNVHAKHRVVVDNVFTEAPDPELRRNNLMNNRVKKMIVTGGSGKAGRACVNDLIAHGYQVFNVDTVLPAKEVCPFIMADLSDFGQTLDALSSVDTSGKTGLQAFDAIVHLAAIPAPRRFSDAVTFSNNTLSTYNVFEAARRLGIKNIVWASSETVLGLPFEIPPPYVPVDEECARPESAYSLSKLLGEEMAKQFCRWDPEMKIIGLRFSNVMEPHDYAAFPDFDKDPHRRKWNLWGYIDARDAAQAIRRSLEATLKGAEVFIIANADTVMSRPTSELLAEVFPDVPVKKQLGRNETLLSIEKARRVLGFEPKYSWRDPASRSS

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
35 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
36 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
37 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
41 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
72 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
73 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
74 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
77 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
80 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
115 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
116 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
117 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
118 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
119 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
120 2643221610 Ensifer sp. Root74 Isolate Unclassified
121 2643221675 Ensifer sp. Root1298 Isolate Unclassified
122 2643221680 Ensifer sp. Root1312 Isolate Unclassified
123 2643221726 Ensifer sp. Root954 Isolate Unclassified
124 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
125 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
126 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
127 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
128 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
129 2791355256 Rhizobium sp. M10 Isolate Nodule
130 2791355260 Rhizobium sp. L9 Isolate Nodule
131 2791355266 Rhizobium sp. L43 Isolate Nodule
132 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
133 2802429633 Rhizobium anhuiense J3 Isolate Nodule
134 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
135 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
136 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
137 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
138 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
139 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
140 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
141 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
142 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
143 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
144 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
145 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
146 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
147 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
148 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
149 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
150 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
151 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
152 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
153 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
154 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
155 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
156 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
157 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
158 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
159 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
160 2936381700 Rhizobium chutanense C16 Isolate Unclassified
161 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
162 2996887358 Rhizobium sp. R711 Isolate Nodule
163 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
164 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
165 8005321885 Rhizobium sp. R72 Isolate Nodule
166 8005382845 Rhizobium sp. R634 Isolate Nodule
167 8005395548 Rhizobium sp. R339 Isolate Nodule
168 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
169 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.6
Metatranscriptomes 0.46
Isolates 26.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 18.26
Rhizoplane 2.28
Rhizosphere 57.99
Stem 0
Stem Tuber 0
Unclassified 7.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100007902 3300005467 Bacteria 9933
2 JGI25159J45721_1005625 3300002987 Bacteria 3905
3 JGI25151J46595_10000245 3300003187 Bacteria 63602
4 JGI25153J46596_10018219 3300003215 Bacteria 2737
5 JGI25160J50197_1011193 3300003354 Bacteria 3196
6 Ga0070714_100014209 3300005435 Bacteria 6394
7 Ga0070714_100129036 3300005435 Bacteria 2258
8 Ga0070714_100154474 3300005435 Bacteria 2071
9 Ga0070713_100044210 3300005436 Bacteria 3645
10 Ga0070710_10052371 3300005437 Bacteria 2295
11 Ga0070711_100187651 3300005439 Unclassified 1587
12 Ga0070705_100017835 3300005440 Bacteria 3711
13 Ga0070708_100055494 3300005445 Bacteria 3524
14 Ga0070708_100172177 3300005445 Unclassified 2022
15 Ga0070706_100074653 3300005467 Bacteria 3138
16 Ga0070706_100244435 3300005467 Bacteria 1676
17 Ga0070706_100250760 3300005467 Unclassified 1653
18 Ga0070706_100275156 3300005467 Unclassified 1571
19 Ga0070707_100298461 3300005468 Bacteria 1565
20 Ga0070698_100005063 3300005471 Bacteria 14441
21 Ga0070698_100091806 3300005471 Bacteria 3018
22 Ga0070699_100039190 3300005518 Bacteria 4103
23 Ga0070699_100086491 3300005518 Bacteria 2736
24 Ga0070699_100089654 3300005518 Bacteria 2687
25 Ga0070697_100013727 3300005536 Bacteria 6354
26 Ga0070697_100587156 3300005536 Bacteria 978
27 Ga0081540_1041499 3300005983 Bacteria 2385
28 Ga0070717_10019024 3300006028 Bacteria 5378
29 Ga0070717_10070186 3300006028 Bacteria 2919
30 Ga0070717_10081755 3300006028 Bacteria 2713
31 Ga0070717_10186687 3300006028 Unclassified 1810
32 Ga0070716_100120329 3300006173 Bacteria 1642
33 Ga0075370_10076966 3300006353 Bacteria 1914
34 Ga0075433_10004341 3300006852 Bacteria 11017
35 Ga0075434_100077088 3300006871 Bacteria 3328
36 Ga0075434_100332589 3300006871 Bacteria 1539
37 Ga0099795_10035099 3300007788 Bacteria 1751
38 Ga0105244_10021164 3300009036 Bacteria 3601
39 Ga0105240_10001449 3300009093 Bacteria 40535
40 Ga0105241_10252667 3300009174 Bacteria 1495
41 Ga0105237_10000882 3300009545 Bacteria 40534
42 Ga0105238_10003212 3300009551 Bacteria 16319
43 Ga0123341_1028203 3300009765 Bacteria 4356
44 Ga0123341_1084411 3300009765 Bacteria 1207
45 Ga0123341_1090057 3300009765 Bacteria 1109
46 Ga0105239_10006391 3300010375 Bacteria 13689
47 Ga0157371_10001479 3300013102 Bacteria 24313
48 Ga0157374_10471924 3300013296 Unclassified 1257
49 Ga0157372_10003399 3300013307 Bacteria 17177
50 Ga0182008_10041043 3300014497 Bacteria 2309
51 Ga0182005_1007547 3300015265 Bacteria 3255
52 Ga0214544_1000097 3300021320 Bacteria 116548
53 Ga0214542_1029274 3300021321 Bacteria 2273
54 Ga0214543_1018752 3300021327 Bacteria 6222
55 Ga0213872_10008818 3300021361 Bacteria 4867
56 Ga0213876_10002113 3300021384 Bacteria 11753
57 Ga0213871_10039518 3300021441 Bacteria 1263
58 Ga0209677_100721 3300025253 Bacteria 16836
59 Ga0209233_1000216 3300025261 Bacteria 108123
60 Ga0209233_1017983 3300025261 Bacteria 1913
61 Ga0209130_1000887 3300025284 Bacteria 24382
62 Ga0209025_1000192 3300025294 Bacteria 150108
63 Ga0209758_1002499 3300025297 Bacteria 18669
64 Ga0209758_1005405 3300025297 Bacteria 9868
65 Ga0207426_1000301 3300025302 Bacteria 96798
66 Ga0207692_10180659 3300025898 Unclassified 1229
67 Ga0207699_10033992 3300025906 Bacteria 2887
68 Ga0207684_10018079 3300025910 Bacteria 6041
69 Ga0207684_10064703 3300025910 Bacteria 3104
70 Ga0207684_10164811 3300025910 Bacteria 1909
71 Ga0207684_10191995 3300025910 Bacteria 1762
72 Ga0207695_10011599 3300025913 Bacteria 10656
73 Ga0207671_10004752 3300025914 Bacteria 12822
74 Ga0207663_10079175 3300025916 Bacteria 2145
75 Ga0207694_10002629 3300025924 Bacteria 14563
76 Ga0207700_10086414 3300025928 Bacteria 2465
77 Ga0207664_10363814 3300025929 Bacteria 1282
78 Ga0207690_10043598 3300025932 Bacteria 2953
79 Ga0207665_10059524 3300025939 Unclassified 2585
80 Ga0207675_100066471 3300026118 Bacteria 3370
81 Ga0307512_10192128 3300030522 Bacteria 1124
82 Ga0307409_100626550 3300031995 Bacteria 1066
83 Ga0316593_10080620 3300032168 Bacteria 1136
84 Ga0373934_0037904 3300035086 Bacteria 1898
85 Ga0373955_0222165 3300035172 Bacteria 1128
86 Ga0395898_0315355 3300037466 Bacteria 1492
87 Ga0395905_0084841 3300037471 Bacteria 2968
88 Ga0436364_0898665 3300037853 Bacteria 10658
89 Ga0436364_1372547 3300037853 Bacteria 6866
90 Ga0436364_1458963 3300037853 Bacteria 4334
91 Ga0436365_0024450 3300039437 Bacteria 1291
92 Ga0436365_0138049 3300039437 Unclassified 2356
93 Ga0436365_0843493 3300039437 Bacteria 55611
94 Ga0436365_0889692 3300039437 Bacteria 98713
95 Ga0436360_0065020 3300039438 Unclassified 2395
96 Ga0436360_0563570 3300039438 Bacteria 8565
97 Ga0436360_0589056 3300039438 Unclassified 1658
98 Ga0436360_0867366 3300039438 Bacteria 1211
99 Ga0436361_0287815 3300039447 Bacteria 3047
100 Ga0436361_0374685 3300039447 Bacteria 5144
101 Ga0436361_0974189 3300039447 Unclassified 3284
102 Ga0436361_1081003 3300039447 Bacteria 12578
103 Ga0436361_1146298 3300039447 Unclassified 2288
104 Ga0436361_1194506 3300039447 Unclassified 1169
105 Ga0436362_0640387 3300039453 Bacteria 1156
106 Ga0436362_0756846 3300039453 Unclassified 3449
107 Ga0436362_1202100 3300039453 Bacteria 1634
108 Ga0439436_0030761 3300041404 Bacteria 1559
109 Ga0439438_005732 3300041405 Bacteria 4519
110 Ga0439439_0032221 3300041406 Bacteria 1338
111 Ga0439461_0016546 3300041410 Bacteria 1425
112 Ga0439465_0051432 3300041413 Bacteria 1350
113 Ga0439431_0057223 3300041997 Bacteria 1020
114 Ga0439432_007588 3300042006 Bacteria 3836
115 Ga0439449_0006319 3300042007 Bacteria 4527
116 Ga0439462_0001474 3300042015 Bacteria 5249
117 Ga0439462_0002594 3300042015 Bacteria 4222
118 Ga0439446_0009336 3300042156 Bacteria 2625
119 Ga0466972_0102281 3300044658 Unclassified 1355
120 Ga0451576_0000224 3300045051 Bacteria 138894
121 Ga0495603_0034371 3300046455 Bacteria 3048
122 Ga0495629_0174959 3300046459 Bacteria 1489
123 Ga0495653_0084335 3300046463 Bacteria 2340
124 Ga0495610_0136403 3300046512 Bacteria 1060
125 Ga0495618_0115048 3300046514 Bacteria 1722
126 Ga0495640_0212394 3300046533 Bacteria 1223
127 Ga0495667_0129787 3300046559 Bacteria 1626
128 Ga0495634_0052015 3300046642 Bacteria 2747
129 Ga0495635_0023630 3300046663 Bacteria 4282
130 Ga0495635_0100580 3300046663 Bacteria 1976
131 Ga0495649_0130882 3300046694 Bacteria 1324
132 Ga0495674_0029986 3300047319 Bacteria 4949
133 Ga0496100_0023992 3300048903 Bacteria 3714
134 Ga0496101_0209838 3300048904 Bacteria 1508
135 Ga0496106_0003022 3300048909 Bacteria 12527
136 Ga0496111_0357130 3300048914 Bacteria 1081
137 Ga0496114_0117381 3300048917 Bacteria 2286
138 Ga0496116_0000556 3300048919 Bacteria 50008
139 Ga0496116_0004613 3300048919 Bacteria 13063
140 Ga0496119_0001048 3300048922 Bacteria 35361
141 Ga0496120_0000114 3300048923 Bacteria 136671
142 Ga0496121_0003747 3300048924 Bacteria 21297
143 Ga0496124_0000176 3300048927 Bacteria 128635
144 Ga0496124_0007443 3300048927 Bacteria 11632
145 Ga0501033_0012961 3300049570 Bacteria 6359
146 Ga0501033_0104750 3300049570 Bacteria 2062
147 Ga0501034_0388462 3300049571 Bacteria 1320
148 Ga0501047_0028045 3300049581 Bacteria 5426
149 Ga0501083_0000162 3300049744 Bacteria 43696
150 Ga0501083_0004562 3300049744 Bacteria 9784
151 Ga0501044_0146228 3300049823 Bacteria 2349
152 nmdc:mga06r32_208371_c1 3300050510 Bacteria 1943
153 nmdc:mga0n895_538297_c1 3300050512 Bacteria 1174
154 nmdc:mga0a205_17127_c1 3300050515 Bacteria 6786
155 nmdc:mga0a205_76517_c1 3300050515 Bacteria 3234
156 Ga0495612_0139472 3300053078 Bacteria 1051
157 Ga0495619_0031685 3300053085 Bacteria 3427
158 Ga0495619_0105024 3300053085 Bacteria 1926
159 Ga0495619_0155159 3300053085 Bacteria 1580
160 Ga0500627_0047188 3300053158 Bacteria 1868
161 2513881973 2513237140 Bacteria 7076289
162 2513998722 2513237159 Bacteria 6810126
163 2524460853 2524023209 Bacteria 6679728
164 2524461779 2524023209 Bacteria 6679728
165 2558862624 2558860100 Bacteria 8458965
166 2616310002 2615840626 Bacteria 7921970
167 2644067199 2643221610 Bacteria 7480339
168 2644418291 2643221675 Bacteria 7473456
169 2644451713 2643221680 Bacteria 7473610
170 2644691256 2643221726 Bacteria 7455827
171 2720616964 2718218233 Bacteria 6662049
172 2775539104 2775506706 Bacteria 4873073
173 2776263151 2775506901 Bacteria 9631051
174 2778179940 2775507266 Bacteria 7392367
175 2778180246 2775507266 Bacteria 7392367
176 2792641233 2791355094 Bacteria 7011481
177 2793298122 2791355256 Bacteria 6798008
178 2793324168 2791355260 Bacteria 6598818
179 2793363555 2791355266 Bacteria 7116587
180 2805936551 2802429606 Bacteria 6346811
181 2806043296 2802429633 Bacteria 7341974
182 2812374645 2811994882 Bacteria 4688362
183 2819666268 2818991458 Bacteria 4794049
184 2819693103 2818991462 Bacteria 4320267
185 2819730257 2818991469 Bacteria 4644110
186 2821445090 2821443989 Bacteria 7658172
187 2824696982 2824696289 Bacteria 8335049
188 2837268837 2837268691 Bacteria 7850704
189 2841856517 2841851746 Bacteria 7532261
190 2841862661 2841859092 Bacteria 5436171
191 2841870136 2841864319 Bacteria 6742987
192 2841946128 2841941048 Bacteria 8688029
193 2842302292 2842298080 Bacteria 6123127
194 2842303253 2842298080 Bacteria 6123127
195 2842407737 2842402390 Bacteria 6681310
196 2842414474 2842409023 Bacteria 6687331
197 2842421165 2842415677 Bacteria 6596907
198 2842514025 2842509118 Bacteria 6850950
199 2842519821 2842515876 Bacteria 5436280
200 2842523938 2842521101 Bacteria 6569494
201 2844537434 2844533157 Bacteria 7517899
202 2852633777 2852632344 Bacteria 3463163
203 2855872838 2855872281 Bacteria 6964271
204 2868093498 2868088558 Bacteria 7609351
205 2879085030 2879083081 Bacteria 8587928
206 2882463289 2882456835 Bacteria 6863978
207 2896385507 2896384573 Bacteria 7700774
208 2933011888 2933011516 Bacteria 5439334
209 2936382931 2936381700 Bacteria 7006523
210 2939671934 2939669807 Bacteria 5028511
211 2996891063 2996887358 Bacteria 5795980
212 3005488806 3005483717 Bacteria 7877331
213 643824825 643692032 Bacteria 6891900
214 8005325590 8005321885 Bacteria 5795980
215 8005386695 8005382845 Bacteria 6732062
216 8005386961 8005382845 Bacteria 6732062
217 8005402041 8005395548 Bacteria 6806915
218 8055098932 8055097453 Bacteria 4865496
219 8056057055 8056054917 Bacteria 5736694
220 Ga0070706_100007902
221 JGI25159J45721_1005625
222 JGI25151J46595_10000245
223 JGI25153J46596_10018219
224 JGI25160J50197_1011193
225 Ga0070714_100014209
226 Ga0070714_100129036
227 Ga0070714_100154474
228 Ga0070713_100044210
229 Ga0070710_10052371
230 Ga0070711_100187651
231 Ga0070705_100017835
232 Ga0070708_100055494
233 Ga0070708_100172177
234 Ga0070706_100074653
235 Ga0070706_100244435
236 Ga0070706_100250760
237 Ga0070706_100275156
238 Ga0070707_100298461
239 Ga0070698_100005063
240 Ga0070698_100091806
241 Ga0070699_100039190
242 Ga0070699_100086491
243 Ga0070699_100089654
244 Ga0070697_100013727
245 Ga0070697_100587156
246 Ga0081540_1041499
247 Ga0070717_10019024
248 Ga0070717_10070186
249 Ga0070717_10081755
250 Ga0070717_10186687
251 Ga0070716_100120329
252 Ga0075370_10076966
253 Ga0075433_10004341
254 Ga0075434_100077088
255 Ga0075434_100332589
256 Ga0099795_10035099
257 Ga0105244_10021164
258 Ga0105240_10001449
259 Ga0105241_10252667
260 Ga0105237_10000882
261 Ga0105238_10003212
262 Ga0123341_1028203
263 Ga0123341_1084411
264 Ga0123341_1090057
265 Ga0105239_10006391
266 Ga0157371_10001479
267 Ga0157374_10471924
268 Ga0157372_10003399
269 Ga0182008_10041043
270 Ga0182005_1007547
271 Ga0214544_1000097
272 Ga0214542_1029274
273 Ga0214543_1018752
274 Ga0213872_10008818
275 Ga0213876_10002113
276 Ga0213871_10039518
277 Ga0209677_100721
278 Ga0209233_1000216
279 Ga0209233_1017983
280 Ga0209130_1000887
281 Ga0209025_1000192
282 Ga0209758_1002499
283 Ga0209758_1005405
284 Ga0207426_1000301
285 Ga0207692_10180659
286 Ga0207699_10033992
287 Ga0207684_10018079
288 Ga0207684_10064703
289 Ga0207684_10164811
290 Ga0207684_10191995
291 Ga0207695_10011599
292 Ga0207671_10004752
293 Ga0207663_10079175
294 Ga0207694_10002629
295 Ga0207700_10086414
296 Ga0207664_10363814
297 Ga0207690_10043598
298 Ga0207665_10059524
299 Ga0207675_100066471
300 Ga0307512_10192128
301 Ga0307409_100626550
302 Ga0316593_10080620
303 Ga0373934_0037904
304 Ga0373955_0222165
305 Ga0395898_0315355
306 Ga0395905_0084841
307 Ga0436364_0898665
308 Ga0436364_1372547
309 Ga0436364_1458963
310 Ga0436365_0024450
311 Ga0436365_0138049
312 Ga0436365_0843493
313 Ga0436365_0889692
314 Ga0436360_0065020
315 Ga0436360_0563570
316 Ga0436360_0589056
317 Ga0436360_0867366
318 Ga0436361_0287815
319 Ga0436361_0374685
320 Ga0436361_0974189
321 Ga0436361_1081003
322 Ga0436361_1146298
323 Ga0436361_1194506
324 Ga0436362_0640387
325 Ga0436362_0756846
326 Ga0436362_1202100
327 Ga0439436_0030761
328 Ga0439438_005732
329 Ga0439439_0032221
330 Ga0439461_0016546
331 Ga0439465_0051432
332 Ga0439431_0057223
333 Ga0439432_007588
334 Ga0439449_0006319
335 Ga0439462_0001474
336 Ga0439462_0002594
337 Ga0439446_0009336
338 Ga0466972_0102281
339 Ga0451576_0000224
340 Ga0495603_0034371
341 Ga0495629_0174959
342 Ga0495653_0084335
343 Ga0495610_0136403
344 Ga0495618_0115048
345 Ga0495640_0212394
346 Ga0495667_0129787
347 Ga0495634_0052015
348 Ga0495635_0023630
349 Ga0495635_0100580
350 Ga0495649_0130882
351 Ga0495674_0029986
352 Ga0496100_0023992
353 Ga0496101_0209838
354 Ga0496106_0003022
355 Ga0496111_0357130
356 Ga0496114_0117381
357 Ga0496116_0000556
358 Ga0496116_0004613
359 Ga0496119_0001048
360 Ga0496120_0000114
361 Ga0496121_0003747
362 Ga0496124_0000176
363 Ga0496124_0007443
364 Ga0501033_0012961
365 Ga0501033_0104750
366 Ga0501034_0388462
367 Ga0501047_0028045
368 Ga0501083_0000162
369 Ga0501083_0004562
370 Ga0501044_0146228
371 nmdc:mga06r32_208371_c1
372 nmdc:mga0n895_538297_c1
373 nmdc:mga0a205_17127_c1
374 nmdc:mga0a205_76517_c1
375 Ga0495612_0139472
376 Ga0495619_0031685
377 Ga0495619_0105024
378 Ga0495619_0155159
379 Ga0500627_0047188
380 2513881973
381 2513998722
382 2524460853
383 2524461779
384 2558862624
385 2616310002
386 2644067199
387 2644418291
388 2644451713
389 2644691256
390 2720616964
391 2775539104
392 2776263151
393 2778179940
394 2778180246
395 2792641233
396 2793298122
397 2793324168
398 2793363555
399 2805936551
400 2806043296
401 2812374645
402 2819666268
403 2819693103
404 2819730257
405 2821445090
406 2824696982
407 2837268837
408 2841856517
409 2841862661
410 2841870136
411 2841946128
412 2842302292
413 2842303253
414 2842407737
415 2842414474
416 2842421165
417 2842514025
418 2842519821
419 2842523938
420 2844537434
421 2852633777
422 2855872838
423 2868093498
424 2879085030
425 2882463289
426 2896385507
427 2933011888
428 2936382931
429 2939671934
430 2996891063
431 3005488806
432 643824825
433 8005325590
434 8005386695
435 8005386961
436 8005402041
437 8055098932
438 8056057055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

37

265

0.77

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

38

198

0.73

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

38

223

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jkg-assembly1.cif.gz_A the nad+-free form of human nsdhl 0.8813 2 170
6jkg-assembly1.cif.gz_B the nad+-free form of human nsdhl 0.8621 2 170
4yrb-assembly2.cif.gz_C mouse tdh mutant r180k with nad+ bound 0.8018 2 278
2ntn-assembly1.cif.gz_B-2 crystal structure of maba-c60v/g139a/s144l 0.7886 2 227
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.7874 2 278
ID Description Score Start End Superfamily
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8985 1 276 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8945 1 276 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8799 2 275 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8684 2 275 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8683 2 223 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A316I4N4-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9886 70 280 GO:0006012
GO:0016853
AF-A0A1H0E048-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9851 2 280 GO:0003677
GO:0006355
AF-A0A7Y3HCJ2-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9835 175 279
AF-A0A6V8L1M2-F1-model_v4 UDP-glucose 4-epimerase 0.9795 2 280
AF-A0A316I4N4-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9793 70 280 GO:0006012
GO:0016853

Map