F330093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 218 | 155 | 217 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10064792|Ga0307515_100647924 |
| Length | 289 |
| Sequence | VTWPPTEFGPATPHASSSSIAHQLLAAARELSEALAVLRFGSPIAHVYDPLQYAWAPYESYVARYGNSRKRVVLLGMNPGPFGMMQTGVPFGEVAAVRDWMGLHARVERPDSEHPRRPIEGFDCPRSEVSGRRLWGWAALRFGAAPAFFRDWFVLNYCPLVFLEASGRNFTPDKLPAAQRKAVAQACDRHLAAALTALQPEWAIGVGAFAERCLRTVLDSDRVGSTLARRVKVAQILHPSPASPAANRGWSDAVDRTLAQLGVPLGAAEGAAAPSIRWEGFVDRPLPDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 90 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 92 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 93 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 97 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 102 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 104 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 105 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 106 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 107 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 119 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 120 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 123 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 149 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 96.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000287 | 3300001977 | Bacteria | 7210 |
| 2 | rootH1_10002102 | 3300003323 | Bacteria | 7766 |
| 3 | Ga0065707_10083596 | 3300005295 | Bacteria | 8667 |
| 4 | Ga0070666_10340539 | 3300005335 | Bacteria | 1072 |
| 5 | Ga0070689_100564467 | 3300005340 | Bacteria | 982 |
| 6 | Ga0070669_100271878 | 3300005353 | Bacteria | 1355 |
| 7 | Ga0070671_100030427 | 3300005355 | Bacteria | 4455 |
| 8 | Ga0070673_100029745 | 3300005364 | Bacteria | 4077 |
| 9 | Ga0070673_100622155 | 3300005364 | Bacteria | 986 |
| 10 | Ga0070688_100109578 | 3300005365 | Bacteria | 1834 |
| 11 | Ga0070667_100108867 | 3300005367 | Bacteria | 2401 |
| 12 | Ga0070701_10020744 | 3300005438 | Bacteria | 3124 |
| 13 | Ga0070705_100110405 | 3300005440 | Bacteria | 1756 |
| 14 | Ga0070700_100031884 | 3300005441 | Bacteria | 3163 |
| 15 | Ga0070700_100590130 | 3300005441 | Bacteria | 869 |
| 16 | Ga0070694_100009361 | 3300005444 | Bacteria | 6013 |
| 17 | Ga0070694_100139485 | 3300005444 | Bacteria | 1759 |
| 18 | Ga0068867_100000052 | 3300005459 | Bacteria | 69733 |
| 19 | Ga0068867_100000287 | 3300005459 | Bacteria | 33183 |
| 20 | Ga0070706_100134155 | 3300005467 | Bacteria | 2311 |
| 21 | Ga0070707_100196519 | 3300005468 | Bacteria | 1966 |
| 22 | Ga0070698_100018337 | 3300005471 | Bacteria | 7369 |
| 23 | Ga0070672_100004311 | 3300005543 | Bacteria | 9306 |
| 24 | Ga0070686_100002638 | 3300005544 | Bacteria | 9887 |
| 25 | Ga0070696_100226214 | 3300005546 | Bacteria | 1406 |
| 26 | Ga0070704_100001459 | 3300005549 | Bacteria | 12685 |
| 27 | Ga0070704_100006628 | 3300005549 | Bacteria | 6835 |
| 28 | Ga0068855_100166180 | 3300005563 | Bacteria | 2501 |
| 29 | Ga0068857_100504999 | 3300005577 | Bacteria | 1135 |
| 30 | Ga0068857_100588578 | 3300005577 | Bacteria | 1051 |
| 31 | Ga0068856_100000573 | 3300005614 | Bacteria | 40247 |
| 32 | Ga0068852_100238616 | 3300005616 | Unclassified | 1736 |
| 33 | Ga0068859_100042115 | 3300005617 | Bacteria | 4586 |
| 34 | Ga0068859_100796352 | 3300005617 | Bacteria | 1033 |
| 35 | Ga0068864_100038170 | 3300005618 | Bacteria | 4100 |
| 36 | Ga0068864_100486138 | 3300005618 | Bacteria | 1186 |
| 37 | Ga0068861_100023717 | 3300005719 | Bacteria | 4429 |
| 38 | Ga0068861_100186666 | 3300005719 | Bacteria | 1730 |
| 39 | Ga0068870_10044362 | 3300005840 | Bacteria | 2323 |
| 40 | Ga0068863_100019530 | 3300005841 | Bacteria | 6483 |
| 41 | Ga0068863_100095817 | 3300005841 | Bacteria | 2817 |
| 42 | Ga0068863_100294339 | 3300005841 | Bacteria | 1574 |
| 43 | Ga0068858_100081343 | 3300005842 | Bacteria | 3011 |
| 44 | Ga0068858_100125945 | 3300005842 | Bacteria | 2399 |
| 45 | Ga0068860_100000444 | 3300005843 | Bacteria | 52273 |
| 46 | Ga0068860_100248143 | 3300005843 | Bacteria | 1733 |
| 47 | Ga0068862_100006857 | 3300005844 | Bacteria | 9446 |
| 48 | Ga0068862_100028304 | 3300005844 | Bacteria | 4717 |
| 49 | Ga0068862_100086001 | 3300005844 | Bacteria | 2733 |
| 50 | Ga0075366_10188017 | 3300006195 | Bacteria | 1255 |
| 51 | Ga0097621_100074077 | 3300006237 | Bacteria | 2819 |
| 52 | Ga0075428_100015784 | 3300006844 | Bacteria | 8365 |
| 53 | Ga0075430_100172493 | 3300006846 | Bacteria | 1799 |
| 54 | Ga0075431_100040181 | 3300006847 | Bacteria | 4820 |
| 55 | Ga0075431_100264506 | 3300006847 | Bacteria | 1745 |
| 56 | Ga0075431_100412626 | 3300006847 | Bacteria | 1350 |
| 57 | Ga0075433_10493569 | 3300006852 | Bacteria | 1078 |
| 58 | Ga0075434_100447918 | 3300006871 | Bacteria | 1312 |
| 59 | Ga0075429_100000107 | 3300006880 | Bacteria | 47068 |
| 60 | Ga0068865_100089311 | 3300006881 | Bacteria | 2231 |
| 61 | Ga0097620_100042119 | 3300006931 | Bacteria | 4586 |
| 62 | Ga0097620_100796402 | 3300006931 | Bacteria | 1033 |
| 63 | Ga0105240_10200236 | 3300009093 | Bacteria | 2340 |
| 64 | Ga0105240_10556554 | 3300009093 | Bacteria | 1268 |
| 65 | Ga0111539_10190375 | 3300009094 | Bacteria | 2394 |
| 66 | Ga0111539_10271548 | 3300009094 | Unclassified | 1974 |
| 67 | Ga0111539_10721652 | 3300009094 | Bacteria | 1160 |
| 68 | Ga0105245_10021297 | 3300009098 | Bacteria | 5684 |
| 69 | Ga0105245_10062848 | 3300009098 | Bacteria | 3351 |
| 70 | Ga0114129_10021420 | 3300009147 | Bacteria | 9176 |
| 71 | Ga0114129_10108140 | 3300009147 | Bacteria | 3840 |
| 72 | Ga0105243_10000062 | 3300009148 | Bacteria | 127525 |
| 73 | Ga0105243_10278645 | 3300009148 | Bacteria | 1505 |
| 74 | Ga0105243_10334892 | 3300009148 | Bacteria | 1384 |
| 75 | Ga0105242_10470569 | 3300009176 | Unclassified | 1189 |
| 76 | Ga0105238_10011888 | 3300009551 | Bacteria | 8770 |
| 77 | Ga0105249_10052911 | 3300009553 | Bacteria | 3710 |
| 78 | Ga0105249_10258633 | 3300009553 | Bacteria | 1729 |
| 79 | Ga0105249_10631096 | 3300009553 | Bacteria | 1128 |
| 80 | Ga0105246_10340450 | 3300011119 | Bacteria | 1226 |
| 81 | Ga0157374_10431320 | 3300013296 | Bacteria | 1318 |
| 82 | Ga0157378_10020043 | 3300013297 | Bacteria | 5881 |
| 83 | Ga0163162_10005859 | 3300013306 | Bacteria | 11891 |
| 84 | Ga0157375_10064003 | 3300013308 | Bacteria | 3661 |
| 85 | Ga0157375_10317565 | 3300013308 | Unclassified | 1722 |
| 86 | Ga0163163_10351613 | 3300014325 | Bacteria | 1530 |
| 87 | Ga0157380_10024711 | 3300014326 | Bacteria | 4550 |
| 88 | Ga0157377_10068950 | 3300014745 | Bacteria | 2039 |
| 89 | Ga0157379_10066756 | 3300014968 | Bacteria | 3216 |
| 90 | Ga0157376_10218517 | 3300014969 | Bacteria | 1764 |
| 91 | Ga0163161_10129793 | 3300017792 | Bacteria | 1900 |
| 92 | Ga0209051_1069725 | 3300025303 | Bacteria | 1064 |
| 93 | Ga0207645_10093008 | 3300025907 | Bacteria | 1940 |
| 94 | Ga0207695_10121801 | 3300025913 | Bacteria | 2575 |
| 95 | Ga0207681_10229227 | 3300025923 | Bacteria | 1441 |
| 96 | Ga0207681_10664280 | 3300025923 | Bacteria | 865 |
| 97 | Ga0207694_10004382 | 3300025924 | Bacteria | 11022 |
| 98 | Ga0207659_10259320 | 3300025926 | Bacteria | 1413 |
| 99 | Ga0207687_10130287 | 3300025927 | Bacteria | 1894 |
| 100 | Ga0207644_10133849 | 3300025931 | Bacteria | 1901 |
| 101 | Ga0207686_10278168 | 3300025934 | Bacteria | 1234 |
| 102 | Ga0207709_10035104 | 3300025935 | Bacteria | 2962 |
| 103 | Ga0207709_10193314 | 3300025935 | Bacteria | 1447 |
| 104 | Ga0207709_10259645 | 3300025935 | Unclassified | 1273 |
| 105 | Ga0207704_10072733 | 3300025938 | Bacteria | 2187 |
| 106 | Ga0207704_10245069 | 3300025938 | Bacteria | 1341 |
| 107 | Ga0207689_10001697 | 3300025942 | Bacteria | 20916 |
| 108 | Ga0207667_10426329 | 3300025949 | Bacteria | 1349 |
| 109 | Ga0207651_10449141 | 3300025960 | Bacteria | 1106 |
| 110 | Ga0207712_10180679 | 3300025961 | Unclassified | 1657 |
| 111 | Ga0207677_10015471 | 3300026023 | Bacteria | 4490 |
| 112 | Ga0207677_10418003 | 3300026023 | Bacteria | 1141 |
| 113 | Ga0207708_10023618 | 3300026075 | Bacteria | 4649 |
| 114 | Ga0207702_10001003 | 3300026078 | Bacteria | 28977 |
| 115 | Ga0207641_10077950 | 3300026088 | Bacteria | 2869 |
| 116 | Ga0207641_10141757 | 3300026088 | Bacteria | 2169 |
| 117 | Ga0207641_10191492 | 3300026088 | Unclassified | 1880 |
| 118 | Ga0207648_10000153 | 3300026089 | Bacteria | 69762 |
| 119 | Ga0207648_10000283 | 3300026089 | Bacteria | 55253 |
| 120 | Ga0207648_10342004 | 3300026089 | Unclassified | 1347 |
| 121 | Ga0207676_10197629 | 3300026095 | Bacteria | 1774 |
| 122 | Ga0207674_10508609 | 3300026116 | Bacteria | 1164 |
| 123 | Ga0207675_100250572 | 3300026118 | Bacteria | 1714 |
| 124 | Ga0268265_10008660 | 3300028380 | Bacteria | 6876 |
| 125 | Ga0268265_10071105 | 3300028380 | Bacteria | 2708 |
| 126 | Ga0268264_10009350 | 3300028381 | Bacteria | 8113 |
| 127 | Ga0265337_1017997 | 3300028556 | Bacteria | 2252 |
| 128 | Ga0265337_1037460 | 3300028556 | Unclassified | 1411 |
| 129 | Ga0265319_1051333 | 3300028563 | Bacteria | 1360 |
| 130 | Ga0265336_10020866 | 3300028666 | Bacteria | 2099 |
| 131 | Ga0307515_10064792 | 3300028794 | Bacteria | 5103 |
| 132 | Ga0265338_10000974 | 3300028800 | Bacteria | 48196 |
| 133 | Ga0265338_10080457 | 3300028800 | Bacteria | 2737 |
| 134 | Ga0265324_10001027 | 3300029957 | Bacteria | 17144 |
| 135 | Ga0265324_10006251 | 3300029957 | Bacteria | 5002 |
| 136 | Ga0265330_10004980 | 3300031235 | Bacteria | 6678 |
| 137 | Ga0265330_10166024 | 3300031235 | Bacteria | 936 |
| 138 | Ga0265320_10000316 | 3300031240 | Bacteria | 39398 |
| 139 | Ga0265331_10005969 | 3300031250 | Bacteria | 7273 |
| 140 | Ga0265327_10000387 | 3300031251 | Bacteria | 82859 |
| 141 | Ga0307513_10032342 | 3300031456 | Bacteria | 5900 |
| 142 | Ga0307414_10115231 | 3300032004 | Bacteria | 2055 |
| 143 | Ga0373930_0000422 | 3300034816 | Bacteria | 5634 |
| 144 | Ga0373950_0018049 | 3300034818 | Bacteria | 1221 |
| 145 | Ga0373928_0000004 | 3300035084 | Bacteria | 45792 |
| 146 | Ga0373929_0001526 | 3300035085 | Bacteria | 4401 |
| 147 | Ga0373944_0001325 | 3300035089 | Bacteria | 6226 |
| 148 | Ga0373949_0005000 | 3300035090 | Bacteria | 2987 |
| 149 | Ga0373951_0001821 | 3300035091 | Bacteria | 5529 |
| 150 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 151 | Ga0373932_0044970 | 3300035112 | Bacteria | 1290 |
| 152 | Ga0373945_0063440 | 3300035116 | Bacteria | 1383 |
| 153 | Ga0373943_0203822 | 3300035170 | Bacteria | 1096 |
| 154 | Ga0373946_0175041 | 3300035171 | Bacteria | 1015 |
| 155 | Ga0373946_0188318 | 3300035171 | Bacteria | 983 |
| 156 | Ga0373955_0059340 | 3300035172 | Bacteria | 2107 |
| 157 | Ga0373962_0002814 | 3300035242 | Bacteria | 4152 |
| 158 | Ga0373931_0000008 | 3300035691 | Bacteria | 362269 |
| 159 | Ga0373927_0008000 | 3300035695 | Bacteria | 7139 |
| 160 | Ga0373927_0187854 | 3300035695 | Bacteria | 1355 |
| 161 | Ga0373947_0035040 | 3300035725 | Bacteria | 2971 |
| 162 | Ga0373925_0000077 | 3300037068 | Bacteria | 105383 |
| 163 | Ga0373925_0105738 | 3300037068 | Bacteria | 2169 |
| 164 | Ga0400483_151618 | 3300039062 | Bacteria | 1251 |
| 165 | Ga0451807_1411794 | 3300041486 | Unclassified | 1749 |
| 166 | Ga0439434_0073319 | 3300042435 | Bacteria | 1080 |
| 167 | Ga0451577_0012581 | 3300042876 | Bacteria | 7945 |
| 168 | Ga0451577_0606777 | 3300042876 | Bacteria | 993 |
| 169 | Ga0451576_0068560 | 3300045051 | Bacteria | 3691 |
| 170 | Ga0451576_0131559 | 3300045051 | Bacteria | 2608 |
| 171 | Ga0451576_0180418 | 3300045051 | Bacteria | 2204 |
| 172 | Ga0451576_0287688 | 3300045051 | Bacteria | 1718 |
| 173 | Ga0495641_0138382 | 3300046461 | Bacteria | 1087 |
| 174 | Ga0501031_0000113 | 3300049568 | Bacteria | 43219 |
| 175 | Ga0501032_0001671 | 3300049569 | Bacteria | 17620 |
| 176 | Ga0501033_0007884 | 3300049570 | Bacteria | 8251 |
| 177 | Ga0501036_0126397 | 3300049572 | Bacteria | 2159 |
| 178 | Ga0501036_0527037 | 3300049572 | Unclassified | 982 |
| 179 | Ga0501038_0144404 | 3300049574 | Bacteria | 1944 |
| 180 | Ga0501039_0043740 | 3300049575 | Bacteria | 3459 |
| 181 | Ga0501039_0401451 | 3300049575 | Bacteria | 1076 |
| 182 | Ga0501040_0015593 | 3300049576 | Bacteria | 5023 |
| 183 | Ga0501042_0087103 | 3300049578 | Bacteria | 2240 |
| 184 | Ga0501043_0309779 | 3300049579 | Unclassified | 1205 |
| 185 | Ga0501043_0420641 | 3300049579 | Bacteria | 1007 |
| 186 | Ga0501046_0542975 | 3300049580 | Bacteria | 829 |
| 187 | Ga0501047_0338044 | 3300049581 | Bacteria | 1344 |
| 188 | Ga0501048_0022375 | 3300049582 | Bacteria | 4624 |
| 189 | Ga0501070_0409001 | 3300049586 | Unclassified | 1097 |
| 190 | Ga0501071_0436636 | 3300049587 | Bacteria | 1001 |
| 191 | Ga0501072_0059583 | 3300049588 | Bacteria | 3010 |
| 192 | Ga0501072_0169322 | 3300049588 | Bacteria | 1743 |
| 193 | Ga0501075_0011080 | 3300049591 | Bacteria | 6365 |
| 194 | Ga0501075_0074896 | 3300049591 | Bacteria | 2560 |
| 195 | Ga0501076_0013034 | 3300049592 | Bacteria | 6224 |
| 196 | Ga0501076_0023344 | 3300049592 | Bacteria | 4766 |
| 197 | Ga0501079_0009876 | 3300049741 | Bacteria | 7241 |
| 198 | Ga0501080_0166404 | 3300049742 | Bacteria | 2034 |
| 199 | Ga0501080_0199499 | 3300049742 | Bacteria | 1837 |
| 200 | Ga0501081_0015025 | 3300049743 | Bacteria | 5109 |
| 201 | Ga0501083_0189478 | 3300049744 | Bacteria | 1342 |
| 202 | Ga0501035_0003627 | 3300049822 | Bacteria | 14724 |
| 203 | Ga0501044_0000792 | 3300049823 | Bacteria | 38210 |
| 204 | Ga0501044_0410326 | 3300049823 | Bacteria | 1266 |
| 205 | Ga0501045_0014290 | 3300049824 | Bacteria | 5626 |
| 206 | Ga0501045_0052154 | 3300049824 | Bacteria | 2986 |
| 207 | nmdc:mga0k408_253567_c1 | 3300050493 | Bacteria | 1050 |
| 208 | nmdc:mga05p37_500_c1 | 3300050507 | Bacteria | 43103 |
| 209 | nmdc:mga09592_100_c1 | 3300050508 | Bacteria | 52155 |
| 210 | nmdc:mga06r32_14781_c1 | 3300050510 | Bacteria | 7082 |
| 211 | nmdc:mga06r32_17175_c1 | 3300050510 | Bacteria | 6605 |
| 212 | nmdc:mga06r32_397176_c1 | 3300050510 | Bacteria | 1361 |
| 213 | nmdc:mga08y16_232598_c1 | 3300050511 | Unclassified | 1906 |
| 214 | Ga0501084_0095110 | 3300054114 | Bacteria | 2502 |
| 215 | Ga0501082_0089007 | 3300060353 | Bacteria | 2665 |
| 216 | Ga0501082_0150026 | 3300060353 | Bacteria | 2024 |
| 217 | Ga0530510_0000408 | 3300061734 | Bacteria | 27909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031235 | Ga0265330_10004980 | Ga0265330_100049805 | 207 |
| 2 | 3300006844 | Ga0075428_100015784 | Ga0075428_1000157849 | 215 |
| 3 | 3300006847 | Ga0075431_100264506 | Ga0075431_1002645062 | 215 |
| 4 | 3300006880 | Ga0075429_100000107 | Ga0075429_1000001073 | 215 |
| 5 | 3300009147 | Ga0114129_10021420 | Ga0114129_100214205 | 215 |
| 6 | 3300050507 | nmdc:mga05p37_500_c1 | nmdc:mga05p37_500_c1_29378_30091 | 215 |
| 7 | 3300050508 | nmdc:mga09592_100_c1 | nmdc:mga09592_100_c1_7613_8326 | 215 |
| 8 | 3300050510 | nmdc:mga06r32_17175_c1 | nmdc:mga06r32_17175_c1_4950_5663 | 215 |
| 9 | 3300005340 | Ga0070689_100564467 | Ga0070689_1005644671 | 222 |
| 10 | 3300005577 | Ga0068857_100504999 | Ga0068857_1005049992 | 222 |
| 11 | 3300006846 | Ga0075430_100172493 | Ga0075430_1001724932 | 233 |
| 12 | 3300009094 | Ga0111539_10721652 | Ga0111539_107216521 | 234 |
| 13 | 3300003323 | rootH1_10002102 | rootH1_100021022 | 235 |
| 14 | 3300005440 | Ga0070705_100110405 | Ga0070705_1001104052 | 235 |
| 15 | 3300005441 | Ga0070700_100590130 | Ga0070700_1005901301 | 235 |
| 16 | 3300005444 | Ga0070694_100139485 | Ga0070694_1001394852 | 235 |
| 17 | 3300005471 | Ga0070698_100018337 | Ga0070698_1000183376 | 235 |
| 18 | 3300005546 | Ga0070696_100226214 | Ga0070696_1002262142 | 235 |
| 19 | 3300005549 | Ga0070704_100001459 | Ga0070704_1000014595 | 235 |
| 20 | 3300006847 | Ga0075431_100412626 | Ga0075431_1004126262 | 235 |
| 21 | 3300006852 | Ga0075433_10493569 | Ga0075433_104935692 | 235 |
| 22 | 3300009094 | Ga0111539_10271548 | Ga0111539_102715483 | 235 |
| 23 | 3300009148 | Ga0105243_10278645 | Ga0105243_102786452 | 235 |
| 24 | 3300009148 | Ga0105243_10334892 | Ga0105243_103348922 | 235 |
| 25 | 3300025935 | Ga0207709_10193314 | Ga0207709_101933141 | 235 |
| 26 | 3300025935 | Ga0207709_10259645 | Ga0207709_102596452 | 235 |
| 27 | 3300035172 | Ga0373955_0059340 | Ga0373955_0059340_1037_1753 | 235 |
| 28 | 3300039062 | Ga0400483_151618 | Ga0400483_151618_376_1089 | 235 |
| 29 | 3300042435 | Ga0439434_0073319 | Ga0439434_0073319_154_870 | 235 |
| 30 | 3300045051 | Ga0451576_0131559 | Ga0451576_0131559_1806_2519 | 235 |
| 31 | 3300045051 | Ga0451576_0180418 | Ga0451576_0180418_907_1620 | 235 |
| 32 | 3300050510 | nmdc:mga06r32_397176_c1 | nmdc:mga06r32_397176_c1_461_1171 | 235 |
| 33 | 3300050511 | nmdc:mga08y16_232598_c1 | nmdc:mga08y16_232598_c1_97_804 | 235 |
| 34 | 3300025303 | Ga0209051_1069725 | Ga0209051_10697252 | 238 |
| 35 | 3300031235 | Ga0265330_10166024 | Ga0265330_101660242 | 238 |
| 36 | 3300031250 | Ga0265331_10005969 | Ga0265331_100059692 | 238 |
| 37 | 3300031250 | Ga0265331_10005969 | Ga0265331_100059695 | 238 |
| 38 | 3300042876 | Ga0451577_0012581 | Ga0451577_0012581_6186_6908 | 238 |
| 39 | 3300045051 | Ga0451576_0068560 | Ga0451576_0068560_2954_3676 | 238 |
| 40 | 3300005364 | Ga0070673_100622155 | Ga0070673_1006221551 | 239 |
| 41 | 3300005335 | Ga0070666_10340539 | Ga0070666_103405391 | 240 |
| 42 | 3300005364 | Ga0070673_100029745 | Ga0070673_1000297455 | 240 |
| 43 | 3300005367 | Ga0070667_100108867 | Ga0070667_1001088672 | 240 |
| 44 | 3300005617 | Ga0068859_100042115 | Ga0068859_1000421154 | 240 |
| 45 | 3300005618 | Ga0068864_100486138 | Ga0068864_1004861381 | 240 |
| 46 | 3300005719 | Ga0068861_100186666 | Ga0068861_1001866662 | 240 |
| 47 | 3300005840 | Ga0068870_10044362 | Ga0068870_100443622 | 240 |
| 48 | 3300005841 | Ga0068863_100095817 | Ga0068863_1000958171 | 240 |
| 49 | 3300005844 | Ga0068862_100086001 | Ga0068862_1000860011 | 240 |
| 50 | 3300006237 | Ga0097621_100074077 | Ga0097621_1000740773 | 240 |
| 51 | 3300006931 | Ga0097620_100042119 | Ga0097620_1000421194 | 240 |
| 52 | 3300009098 | Ga0105245_10062848 | Ga0105245_100628481 | 240 |
| 53 | 3300009176 | Ga0105242_10470569 | Ga0105242_104705691 | 240 |
| 54 | 3300014325 | Ga0163163_10351613 | Ga0163163_103516132 | 240 |
| 55 | 3300025923 | Ga0207681_10664280 | Ga0207681_106642801 | 240 |
| 56 | 3300025926 | Ga0207659_10259320 | Ga0207659_102593202 | 240 |
| 57 | 3300025934 | Ga0207686_10278168 | Ga0207686_102781682 | 240 |
| 58 | 3300025938 | Ga0207704_10245069 | Ga0207704_102450692 | 240 |
| 59 | 3300025942 | Ga0207689_10001697 | Ga0207689_1000169715 | 240 |
| 60 | 3300025960 | Ga0207651_10449141 | Ga0207651_104491411 | 240 |
| 61 | 3300026023 | Ga0207677_10418003 | Ga0207677_104180031 | 240 |
| 62 | 3300026088 | Ga0207641_10077950 | Ga0207641_100779501 | 240 |
| 63 | 3300026089 | Ga0207648_10342004 | Ga0207648_103420042 | 240 |
| 64 | 3300026118 | Ga0207675_100250572 | Ga0207675_1002505722 | 240 |
| 65 | 3300028556 | Ga0265337_1017997 | Ga0265337_10179973 | 240 |
| 66 | 3300028556 | Ga0265337_1037460 | Ga0265337_10374602 | 240 |
| 67 | 3300028563 | Ga0265319_1051333 | Ga0265319_10513331 | 240 |
| 68 | 3300028666 | Ga0265336_10020866 | Ga0265336_100208664 | 240 |
| 69 | 3300031240 | Ga0265320_10000316 | Ga0265320_1000031610 | 240 |
| 70 | 3300049572 | Ga0501036_0126397 | Ga0501036_0126397_917_1675 | 240 |
| 71 | 3300049574 | Ga0501038_0144404 | Ga0501038_0144404_48_806 | 240 |
| 72 | 3300049575 | Ga0501039_0401451 | Ga0501039_0401451_276_1034 | 240 |
| 73 | 3300049576 | Ga0501040_0015593 | Ga0501040_0015593_590_1348 | 240 |
| 74 | 3300049578 | Ga0501042_0087103 | Ga0501042_0087103_851_1609 | 240 |
| 75 | 3300049579 | Ga0501043_0420641 | Ga0501043_0420641_106_864 | 240 |
| 76 | 3300049580 | Ga0501046_0542975 | Ga0501046_0542975_10_768 | 240 |
| 77 | 3300049582 | Ga0501048_0022375 | Ga0501048_0022375_2280_3038 | 240 |
| 78 | 3300049586 | Ga0501070_0409001 | Ga0501070_0409001_110_838 | 240 |
| 79 | 3300049587 | Ga0501071_0436636 | Ga0501071_0436636_81_839 | 240 |
| 80 | 3300049588 | Ga0501072_0059583 | Ga0501072_0059583_2102_2860 | 240 |
| 81 | 3300049588 | Ga0501072_0169322 | Ga0501072_0169322_500_1258 | 240 |
| 82 | 3300049591 | Ga0501075_0011080 | Ga0501075_0011080_2382_3140 | 240 |
| 83 | 3300049591 | Ga0501075_0074896 | Ga0501075_0074896_734_1492 | 240 |
| 84 | 3300049592 | Ga0501076_0013034 | Ga0501076_0013034_1950_2708 | 240 |
| 85 | 3300049592 | Ga0501076_0023344 | Ga0501076_0023344_3654_4412 | 240 |
| 86 | 3300049741 | Ga0501079_0009876 | Ga0501079_0009876_6319_7077 | 240 |
| 87 | 3300049742 | Ga0501080_0166404 | Ga0501080_0166404_1134_1892 | 240 |
| 88 | 3300049743 | Ga0501081_0015025 | Ga0501081_0015025_3862_4620 | 240 |
| 89 | 3300049744 | Ga0501083_0189478 | Ga0501083_0189478_203_961 | 240 |
| 90 | 3300049824 | Ga0501045_0014290 | Ga0501045_0014290_2739_3497 | 240 |
| 91 | 3300049824 | Ga0501045_0052154 | Ga0501045_0052154_1765_2523 | 240 |
| 92 | 3300054114 | Ga0501084_0095110 | Ga0501084_0095110_891_1649 | 240 |
| 93 | 3300060353 | Ga0501082_0089007 | Ga0501082_0089007_526_1284 | 240 |
| 94 | 3300060353 | Ga0501082_0150026 | Ga0501082_0150026_1095_1853 | 240 |
| 95 | 3300061734 | Ga0530510_0000408 | Ga0530510_0000408_23640_24398 | 240 |
| 96 | 3300005617 | Ga0068859_100796352 | Ga0068859_1007963522 | 241 |
| 97 | 3300006847 | Ga0075431_100040181 | Ga0075431_1000401811 | 241 |
| 98 | 3300006871 | Ga0075434_100447918 | Ga0075434_1004479182 | 241 |
| 99 | 3300006931 | Ga0097620_100796402 | Ga0097620_1007964022 | 241 |
| 100 | 3300025913 | Ga0207695_10121801 | Ga0207695_101218012 | 241 |
| 101 | 3300026088 | Ga0207641_10191492 | Ga0207641_101914922 | 241 |
| 102 | 3300042876 | Ga0451577_0606777 | Ga0451577_0606777_68_796 | 241 |
| 103 | 3300049568 | Ga0501031_0000113 | Ga0501031_0000113_7610_8344 | 241 |
| 104 | 3300049569 | Ga0501032_0001671 | Ga0501032_0001671_15878_16612 | 241 |
| 105 | 3300049570 | Ga0501033_0007884 | Ga0501033_0007884_707_1441 | 241 |
| 106 | 3300049572 | Ga0501036_0527037 | Ga0501036_0527037_107_841 | 241 |
| 107 | 3300049579 | Ga0501043_0309779 | Ga0501043_0309779_382_1116 | 241 |
| 108 | 3300049822 | Ga0501035_0003627 | Ga0501035_0003627_284_1018 | 241 |
| 109 | 3300049823 | Ga0501044_0000792 | Ga0501044_0000792_30235_30969 | 241 |
| 110 | 3300050510 | nmdc:mga06r32_14781_c1 | nmdc:mga06r32_14781_c1_3883_4611 | 241 |
| 111 | 3300032004 | Ga0307414_10115231 | Ga0307414_101152313 | 242 |
| 112 | 3300049581 | Ga0501047_0338044 | Ga0501047_0338044_595_1326 | 242 |
| 113 | 3300049742 | Ga0501080_0199499 | Ga0501080_0199499_306_1037 | 242 |
| 114 | 3300005295 | Ga0065707_10083596 | Ga0065707_1008359611 | 243 |
| 115 | 3300005353 | Ga0070669_100271878 | Ga0070669_1002718782 | 243 |
| 116 | 3300005355 | Ga0070671_100030427 | Ga0070671_1000304273 | 243 |
| 117 | 3300005365 | Ga0070688_100109578 | Ga0070688_1001095782 | 243 |
| 118 | 3300005438 | Ga0070701_10020744 | Ga0070701_100207443 | 243 |
| 119 | 3300005441 | Ga0070700_100031884 | Ga0070700_1000318842 | 243 |
| 120 | 3300005444 | Ga0070694_100009361 | Ga0070694_1000093613 | 243 |
| 121 | 3300005459 | Ga0068867_100000287 | Ga0068867_10000028713 | 243 |
| 122 | 3300005468 | Ga0070707_100196519 | Ga0070707_1001965191 | 243 |
| 123 | 3300005543 | Ga0070672_100004311 | Ga0070672_1000043111 | 243 |
| 124 | 3300005544 | Ga0070686_100002638 | Ga0070686_1000026385 | 243 |
| 125 | 3300005549 | Ga0070704_100006628 | Ga0070704_1000066282 | 243 |
| 126 | 3300005616 | Ga0068852_100238616 | Ga0068852_1002386162 | 243 |
| 127 | 3300005618 | Ga0068864_100038170 | Ga0068864_1000381703 | 243 |
| 128 | 3300005719 | Ga0068861_100023717 | Ga0068861_1000237172 | 243 |
| 129 | 3300005841 | Ga0068863_100019530 | Ga0068863_1000195303 | 243 |
| 130 | 3300005841 | Ga0068863_100294339 | Ga0068863_1002943392 | 243 |
| 131 | 3300005842 | Ga0068858_100081343 | Ga0068858_1000813432 | 243 |
| 132 | 3300005842 | Ga0068858_100125945 | Ga0068858_1001259453 | 243 |
| 133 | 3300005843 | Ga0068860_100000444 | Ga0068860_10000044430 | 243 |
| 134 | 3300005843 | Ga0068860_100248143 | Ga0068860_1002481432 | 243 |
| 135 | 3300005844 | Ga0068862_100006857 | Ga0068862_1000068576 | 243 |
| 136 | 3300005844 | Ga0068862_100028304 | Ga0068862_1000283043 | 243 |
| 137 | 3300006195 | Ga0075366_10188017 | Ga0075366_101880171 | 243 |
| 138 | 3300006881 | Ga0068865_100089311 | Ga0068865_1000893111 | 243 |
| 139 | 3300009094 | Ga0111539_10190375 | Ga0111539_101903752 | 243 |
| 140 | 3300009098 | Ga0105245_10021297 | Ga0105245_100212973 | 243 |
| 141 | 3300009147 | Ga0114129_10108140 | Ga0114129_101081405 | 243 |
| 142 | 3300009553 | Ga0105249_10052911 | Ga0105249_100529112 | 243 |
| 143 | 3300009553 | Ga0105249_10258633 | Ga0105249_102586332 | 243 |
| 144 | 3300009553 | Ga0105249_10631096 | Ga0105249_106310961 | 243 |
| 145 | 3300011119 | Ga0105246_10340450 | Ga0105246_103404502 | 243 |
| 146 | 3300013296 | Ga0157374_10431320 | Ga0157374_104313201 | 243 |
| 147 | 3300013297 | Ga0157378_10020043 | Ga0157378_100200435 | 243 |
| 148 | 3300013306 | Ga0163162_10005859 | Ga0163162_1000585913 | 243 |
| 149 | 3300013308 | Ga0157375_10064003 | Ga0157375_100640033 | 243 |
| 150 | 3300013308 | Ga0157375_10317565 | Ga0157375_103175652 | 243 |
| 151 | 3300014326 | Ga0157380_10024711 | Ga0157380_100247112 | 243 |
| 152 | 3300014968 | Ga0157379_10066756 | Ga0157379_100667562 | 243 |
| 153 | 3300014969 | Ga0157376_10218517 | Ga0157376_102185171 | 243 |
| 154 | 3300017792 | Ga0163161_10129793 | Ga0163161_101297932 | 243 |
| 155 | 3300025923 | Ga0207681_10229227 | Ga0207681_102292272 | 243 |
| 156 | 3300025931 | Ga0207644_10133849 | Ga0207644_101338493 | 243 |
| 157 | 3300025938 | Ga0207704_10072733 | Ga0207704_100727332 | 243 |
| 158 | 3300025961 | Ga0207712_10180679 | Ga0207712_101806792 | 243 |
| 159 | 3300026023 | Ga0207677_10015471 | Ga0207677_100154713 | 243 |
| 160 | 3300026075 | Ga0207708_10023618 | Ga0207708_100236182 | 243 |
| 161 | 3300026088 | Ga0207641_10141757 | Ga0207641_101417573 | 243 |
| 162 | 3300026089 | Ga0207648_10000283 | Ga0207648_1000028323 | 243 |
| 163 | 3300026095 | Ga0207676_10197629 | Ga0207676_101976291 | 243 |
| 164 | 3300028380 | Ga0268265_10008660 | Ga0268265_100086606 | 243 |
| 165 | 3300028380 | Ga0268265_10071105 | Ga0268265_100711052 | 243 |
| 166 | 3300028381 | Ga0268264_10009350 | Ga0268264_100093502 | 243 |
| 167 | 3300028794 | Ga0307515_10064792 | Ga0307515_100647924 | 243 |
| 168 | 3300029957 | Ga0265324_10006251 | Ga0265324_100062512 | 243 |
| 169 | 3300031456 | Ga0307513_10032342 | Ga0307513_100323422 | 243 |
| 170 | 3300035112 | Ga0373932_0044970 | Ga0373932_0044970_381_1154 | 243 |
| 171 | 3300035171 | Ga0373946_0175041 | Ga0373946_0175041_162_929 | 243 |
| 172 | 3300035695 | Ga0373927_0008000 | Ga0373927_0008000_4473_5243 | 243 |
| 173 | 3300037068 | Ga0373925_0105738 | Ga0373925_0105738_88_855 | 243 |
| 174 | 3300045051 | Ga0451576_0287688 | Ga0451576_0287688_658_1395 | 243 |
| 175 | 3300046461 | Ga0495641_0138382 | Ga0495641_0138382_195_962 | 243 |
| 176 | 3300050493 | nmdc:mga0k408_253567_c1 | nmdc:mga0k408_253567_c1_156_926 | 243 |
| 177 | 3300005563 | Ga0068855_100166180 | Ga0068855_1001661802 | 244 |
| 178 | 3300005577 | Ga0068857_100588578 | Ga0068857_1005885782 | 244 |
| 179 | 3300005614 | Ga0068856_100000573 | Ga0068856_10000057331 | 244 |
| 180 | 3300026078 | Ga0207702_10001003 | Ga0207702_1000100330 | 244 |
| 181 | 3300026116 | Ga0207674_10508609 | Ga0207674_105086091 | 244 |
| 182 | 3300034816 | Ga0373930_0000422 | Ga0373930_0000422_3565_4302 | 244 |
| 183 | 3300034818 | Ga0373950_0018049 | Ga0373950_0018049_443_1180 | 244 |
| 184 | 3300035084 | Ga0373928_0000004 | Ga0373928_0000004_8635_9372 | 244 |
| 185 | 3300035085 | Ga0373929_0001526 | Ga0373929_0001526_1383_2120 | 244 |
| 186 | 3300035089 | Ga0373944_0001325 | Ga0373944_0001325_2509_3246 | 244 |
| 187 | 3300035090 | Ga0373949_0005000 | Ga0373949_0005000_869_1606 | 244 |
| 188 | 3300035091 | Ga0373951_0001821 | Ga0373951_0001821_189_926 | 244 |
| 189 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_875137_875874 | 244 |
| 190 | 3300035116 | Ga0373945_0063440 | Ga0373945_0063440_398_1135 | 244 |
| 191 | 3300035170 | Ga0373943_0203822 | Ga0373943_0203822_291_1028 | 244 |
| 192 | 3300035171 | Ga0373946_0188318 | Ga0373946_0188318_188_925 | 244 |
| 193 | 3300035242 | Ga0373962_0002814 | Ga0373962_0002814_343_1080 | 244 |
| 194 | 3300035691 | Ga0373931_0000008 | Ga0373931_0000008_341712_342449 | 244 |
| 195 | 3300035695 | Ga0373927_0187854 | Ga0373927_0187854_454_1191 | 244 |
| 196 | 3300035725 | Ga0373947_0035040 | Ga0373947_0035040_657_1394 | 244 |
| 197 | 3300037068 | Ga0373925_0000077 | Ga0373925_0000077_15818_16555 | 244 |
| 198 | 3300005467 | Ga0070706_100134155 | Ga0070706_1001341552 | 248 |
| 199 | 3300009093 | Ga0105240_10200236 | Ga0105240_102002363 | 249 |
| 200 | 3300009551 | Ga0105238_10011888 | Ga0105238_100118886 | 249 |
| 201 | 3300025924 | Ga0207694_10004382 | Ga0207694_100043821 | 249 |
| 202 | 3300025949 | Ga0207667_10426329 | Ga0207667_104263292 | 249 |
| 203 | 3300049823 | Ga0501044_0410326 | Ga0501044_0410326_121_876 | 249 |
| 204 | 3300028800 | Ga0265338_10000974 | Ga0265338_1000097441 | 250 |
| 205 | 3300029957 | Ga0265324_10001027 | Ga0265324_100010274 | 250 |
| 206 | 3300031251 | Ga0265327_10000387 | Ga0265327_100003879 | 250 |
| 207 | 3300041486 | Ga0451807_1411794 | Ga0451807_1411794_565_1380 | 250 |
| 208 | 3300028800 | Ga0265338_10080457 | Ga0265338_100804572 | 251 |
| 209 | 3300009093 | Ga0105240_10556554 | Ga0105240_105565542 | 252 |
| 210 | 3300001977 | JGI24746J21847_1000287 | JGI24746J21847_10002878 | 254 |
| 211 | 3300005459 | Ga0068867_100000052 | Ga0068867_1000000522 | 254 |
| 212 | 3300009148 | Ga0105243_10000062 | Ga0105243_10000062122 | 254 |
| 213 | 3300014745 | Ga0157377_10068950 | Ga0157377_100689503 | 254 |
| 214 | 3300025907 | Ga0207645_10093008 | Ga0207645_100930081 | 254 |
| 215 | 3300025927 | Ga0207687_10130287 | Ga0207687_101302871 | 254 |
| 216 | 3300025935 | Ga0207709_10035104 | Ga0207709_100351042 | 254 |
| 217 | 3300026089 | Ga0207648_10000153 | Ga0207648_1000015372 | 254 |
| 218 | 3300049575 | Ga0501039_0043740 | Ga0501039_0043740_2140_2913 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h93-assembly4.cif.gz_D | crystal structure of geobacter metallireducens smug1 | 0.9816 | 20 | 252 |
| 5h93-assembly3.cif.gz_C | crystal structure of geobacter metallireducens smug1 | 0.9798 | 20 | 252 |
| 5h93-assembly2.cif.gz_B | crystal structure of geobacter metallireducens smug1 | 0.9778 | 20 | 254 |
| 5h93-assembly1.cif.gz_A | crystal structure of geobacter metallireducens smug1 | 0.9776 | 20 | 254 |
| 5h99-assembly1.cif.gz_A | crystal structure of geobacter metallireducens smug1 mutant n58d | 0.975 | 20 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1oe5B00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9707 | 15 | 253 | 3.40.470.10 |
| af_Q9VEM1_36_278_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9578 | 17 | 253 | 3.40.470.10 |
| 5h98A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.95 | 20 | 252 | 3.40.470.10 |
| 1oe5B00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9436 | 15 | 253 | 3.40.470.10 |
| 5h98A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9286 | 20 | 252 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6ER91-F1-model_v4 | Single-stranded DNA-binding protein | 0.9905 | 17 | 212 |
GO:0000703
GO:0003677 GO:0006284 GO:0017065 |
| AF-A0A2V6NDK8-F1-model_v4 | Single-stranded DNA-binding protein | 0.9892 | 15 | 189 |
GO:0000703
GO:0003677 GO:0006284 GO:0017065 |
| AF-A0A3D5K012-F1-model_v4 | Single-stranded DNA-binding protein | 0.9887 | 17 | 254 |
GO:0000703
GO:0003677 GO:0006284 GO:0017065 |
| AF-A0A7W1J2D8-F1-model_v4 | Single-stranded DNA-binding protein | 0.9887 | 17 | 254 |
GO:0000703
GO:0003677 GO:0006284 GO:0017065 |
| AF-A0A3D1IRS1-F1-model_v4 | Single-stranded DNA-binding protein | 0.9873 | 46 | 254 |
GO:0000703
GO:0003677 GO:0006284 GO:0017065 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar