F330093

General Info

Members Datasets Scaffolds Average Seq Length
218 155 217 250

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10064792|Ga0307515_100647924
Length 289
Sequence VTWPPTEFGPATPHASSSSIAHQLLAAARELSEALAVLRFGSPIAHVYDPLQYAWAPYESYVARYGNSRKRVVLLGMNPGPFGMMQTGVPFGEVAAVRDWMGLHARVERPDSEHPRRPIEGFDCPRSEVSGRRLWGWAALRFGAAPAFFRDWFVLNYCPLVFLEASGRNFTPDKLPAAQRKAVAQACDRHLAAALTALQPEWAIGVGAFAERCLRTVLDSDRVGSTLARRVKVAQILHPSPASPAANRGWSDAVDRTLAQLGVPLGAAEGAAAPSIRWEGFVDRPLPDA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
102 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
103 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 0.46
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000287 3300001977 Bacteria 7210
2 rootH1_10002102 3300003323 Bacteria 7766
3 Ga0065707_10083596 3300005295 Bacteria 8667
4 Ga0070666_10340539 3300005335 Bacteria 1072
5 Ga0070689_100564467 3300005340 Bacteria 982
6 Ga0070669_100271878 3300005353 Bacteria 1355
7 Ga0070671_100030427 3300005355 Bacteria 4455
8 Ga0070673_100029745 3300005364 Bacteria 4077
9 Ga0070673_100622155 3300005364 Bacteria 986
10 Ga0070688_100109578 3300005365 Bacteria 1834
11 Ga0070667_100108867 3300005367 Bacteria 2401
12 Ga0070701_10020744 3300005438 Bacteria 3124
13 Ga0070705_100110405 3300005440 Bacteria 1756
14 Ga0070700_100031884 3300005441 Bacteria 3163
15 Ga0070700_100590130 3300005441 Bacteria 869
16 Ga0070694_100009361 3300005444 Bacteria 6013
17 Ga0070694_100139485 3300005444 Bacteria 1759
18 Ga0068867_100000052 3300005459 Bacteria 69733
19 Ga0068867_100000287 3300005459 Bacteria 33183
20 Ga0070706_100134155 3300005467 Bacteria 2311
21 Ga0070707_100196519 3300005468 Bacteria 1966
22 Ga0070698_100018337 3300005471 Bacteria 7369
23 Ga0070672_100004311 3300005543 Bacteria 9306
24 Ga0070686_100002638 3300005544 Bacteria 9887
25 Ga0070696_100226214 3300005546 Bacteria 1406
26 Ga0070704_100001459 3300005549 Bacteria 12685
27 Ga0070704_100006628 3300005549 Bacteria 6835
28 Ga0068855_100166180 3300005563 Bacteria 2501
29 Ga0068857_100504999 3300005577 Bacteria 1135
30 Ga0068857_100588578 3300005577 Bacteria 1051
31 Ga0068856_100000573 3300005614 Bacteria 40247
32 Ga0068852_100238616 3300005616 Unclassified 1736
33 Ga0068859_100042115 3300005617 Bacteria 4586
34 Ga0068859_100796352 3300005617 Bacteria 1033
35 Ga0068864_100038170 3300005618 Bacteria 4100
36 Ga0068864_100486138 3300005618 Bacteria 1186
37 Ga0068861_100023717 3300005719 Bacteria 4429
38 Ga0068861_100186666 3300005719 Bacteria 1730
39 Ga0068870_10044362 3300005840 Bacteria 2323
40 Ga0068863_100019530 3300005841 Bacteria 6483
41 Ga0068863_100095817 3300005841 Bacteria 2817
42 Ga0068863_100294339 3300005841 Bacteria 1574
43 Ga0068858_100081343 3300005842 Bacteria 3011
44 Ga0068858_100125945 3300005842 Bacteria 2399
45 Ga0068860_100000444 3300005843 Bacteria 52273
46 Ga0068860_100248143 3300005843 Bacteria 1733
47 Ga0068862_100006857 3300005844 Bacteria 9446
48 Ga0068862_100028304 3300005844 Bacteria 4717
49 Ga0068862_100086001 3300005844 Bacteria 2733
50 Ga0075366_10188017 3300006195 Bacteria 1255
51 Ga0097621_100074077 3300006237 Bacteria 2819
52 Ga0075428_100015784 3300006844 Bacteria 8365
53 Ga0075430_100172493 3300006846 Bacteria 1799
54 Ga0075431_100040181 3300006847 Bacteria 4820
55 Ga0075431_100264506 3300006847 Bacteria 1745
56 Ga0075431_100412626 3300006847 Bacteria 1350
57 Ga0075433_10493569 3300006852 Bacteria 1078
58 Ga0075434_100447918 3300006871 Bacteria 1312
59 Ga0075429_100000107 3300006880 Bacteria 47068
60 Ga0068865_100089311 3300006881 Bacteria 2231
61 Ga0097620_100042119 3300006931 Bacteria 4586
62 Ga0097620_100796402 3300006931 Bacteria 1033
63 Ga0105240_10200236 3300009093 Bacteria 2340
64 Ga0105240_10556554 3300009093 Bacteria 1268
65 Ga0111539_10190375 3300009094 Bacteria 2394
66 Ga0111539_10271548 3300009094 Unclassified 1974
67 Ga0111539_10721652 3300009094 Bacteria 1160
68 Ga0105245_10021297 3300009098 Bacteria 5684
69 Ga0105245_10062848 3300009098 Bacteria 3351
70 Ga0114129_10021420 3300009147 Bacteria 9176
71 Ga0114129_10108140 3300009147 Bacteria 3840
72 Ga0105243_10000062 3300009148 Bacteria 127525
73 Ga0105243_10278645 3300009148 Bacteria 1505
74 Ga0105243_10334892 3300009148 Bacteria 1384
75 Ga0105242_10470569 3300009176 Unclassified 1189
76 Ga0105238_10011888 3300009551 Bacteria 8770
77 Ga0105249_10052911 3300009553 Bacteria 3710
78 Ga0105249_10258633 3300009553 Bacteria 1729
79 Ga0105249_10631096 3300009553 Bacteria 1128
80 Ga0105246_10340450 3300011119 Bacteria 1226
81 Ga0157374_10431320 3300013296 Bacteria 1318
82 Ga0157378_10020043 3300013297 Bacteria 5881
83 Ga0163162_10005859 3300013306 Bacteria 11891
84 Ga0157375_10064003 3300013308 Bacteria 3661
85 Ga0157375_10317565 3300013308 Unclassified 1722
86 Ga0163163_10351613 3300014325 Bacteria 1530
87 Ga0157380_10024711 3300014326 Bacteria 4550
88 Ga0157377_10068950 3300014745 Bacteria 2039
89 Ga0157379_10066756 3300014968 Bacteria 3216
90 Ga0157376_10218517 3300014969 Bacteria 1764
91 Ga0163161_10129793 3300017792 Bacteria 1900
92 Ga0209051_1069725 3300025303 Bacteria 1064
93 Ga0207645_10093008 3300025907 Bacteria 1940
94 Ga0207695_10121801 3300025913 Bacteria 2575
95 Ga0207681_10229227 3300025923 Bacteria 1441
96 Ga0207681_10664280 3300025923 Bacteria 865
97 Ga0207694_10004382 3300025924 Bacteria 11022
98 Ga0207659_10259320 3300025926 Bacteria 1413
99 Ga0207687_10130287 3300025927 Bacteria 1894
100 Ga0207644_10133849 3300025931 Bacteria 1901
101 Ga0207686_10278168 3300025934 Bacteria 1234
102 Ga0207709_10035104 3300025935 Bacteria 2962
103 Ga0207709_10193314 3300025935 Bacteria 1447
104 Ga0207709_10259645 3300025935 Unclassified 1273
105 Ga0207704_10072733 3300025938 Bacteria 2187
106 Ga0207704_10245069 3300025938 Bacteria 1341
107 Ga0207689_10001697 3300025942 Bacteria 20916
108 Ga0207667_10426329 3300025949 Bacteria 1349
109 Ga0207651_10449141 3300025960 Bacteria 1106
110 Ga0207712_10180679 3300025961 Unclassified 1657
111 Ga0207677_10015471 3300026023 Bacteria 4490
112 Ga0207677_10418003 3300026023 Bacteria 1141
113 Ga0207708_10023618 3300026075 Bacteria 4649
114 Ga0207702_10001003 3300026078 Bacteria 28977
115 Ga0207641_10077950 3300026088 Bacteria 2869
116 Ga0207641_10141757 3300026088 Bacteria 2169
117 Ga0207641_10191492 3300026088 Unclassified 1880
118 Ga0207648_10000153 3300026089 Bacteria 69762
119 Ga0207648_10000283 3300026089 Bacteria 55253
120 Ga0207648_10342004 3300026089 Unclassified 1347
121 Ga0207676_10197629 3300026095 Bacteria 1774
122 Ga0207674_10508609 3300026116 Bacteria 1164
123 Ga0207675_100250572 3300026118 Bacteria 1714
124 Ga0268265_10008660 3300028380 Bacteria 6876
125 Ga0268265_10071105 3300028380 Bacteria 2708
126 Ga0268264_10009350 3300028381 Bacteria 8113
127 Ga0265337_1017997 3300028556 Bacteria 2252
128 Ga0265337_1037460 3300028556 Unclassified 1411
129 Ga0265319_1051333 3300028563 Bacteria 1360
130 Ga0265336_10020866 3300028666 Bacteria 2099
131 Ga0307515_10064792 3300028794 Bacteria 5103
132 Ga0265338_10000974 3300028800 Bacteria 48196
133 Ga0265338_10080457 3300028800 Bacteria 2737
134 Ga0265324_10001027 3300029957 Bacteria 17144
135 Ga0265324_10006251 3300029957 Bacteria 5002
136 Ga0265330_10004980 3300031235 Bacteria 6678
137 Ga0265330_10166024 3300031235 Bacteria 936
138 Ga0265320_10000316 3300031240 Bacteria 39398
139 Ga0265331_10005969 3300031250 Bacteria 7273
140 Ga0265327_10000387 3300031251 Bacteria 82859
141 Ga0307513_10032342 3300031456 Bacteria 5900
142 Ga0307414_10115231 3300032004 Bacteria 2055
143 Ga0373930_0000422 3300034816 Bacteria 5634
144 Ga0373950_0018049 3300034818 Bacteria 1221
145 Ga0373928_0000004 3300035084 Bacteria 45792
146 Ga0373929_0001526 3300035085 Bacteria 4401
147 Ga0373944_0001325 3300035089 Bacteria 6226
148 Ga0373949_0005000 3300035090 Bacteria 2987
149 Ga0373951_0001821 3300035091 Bacteria 5529
150 Ga0373932_0000001 3300035112 Bacteria 1459067
151 Ga0373932_0044970 3300035112 Bacteria 1290
152 Ga0373945_0063440 3300035116 Bacteria 1383
153 Ga0373943_0203822 3300035170 Bacteria 1096
154 Ga0373946_0175041 3300035171 Bacteria 1015
155 Ga0373946_0188318 3300035171 Bacteria 983
156 Ga0373955_0059340 3300035172 Bacteria 2107
157 Ga0373962_0002814 3300035242 Bacteria 4152
158 Ga0373931_0000008 3300035691 Bacteria 362269
159 Ga0373927_0008000 3300035695 Bacteria 7139
160 Ga0373927_0187854 3300035695 Bacteria 1355
161 Ga0373947_0035040 3300035725 Bacteria 2971
162 Ga0373925_0000077 3300037068 Bacteria 105383
163 Ga0373925_0105738 3300037068 Bacteria 2169
164 Ga0400483_151618 3300039062 Bacteria 1251
165 Ga0451807_1411794 3300041486 Unclassified 1749
166 Ga0439434_0073319 3300042435 Bacteria 1080
167 Ga0451577_0012581 3300042876 Bacteria 7945
168 Ga0451577_0606777 3300042876 Bacteria 993
169 Ga0451576_0068560 3300045051 Bacteria 3691
170 Ga0451576_0131559 3300045051 Bacteria 2608
171 Ga0451576_0180418 3300045051 Bacteria 2204
172 Ga0451576_0287688 3300045051 Bacteria 1718
173 Ga0495641_0138382 3300046461 Bacteria 1087
174 Ga0501031_0000113 3300049568 Bacteria 43219
175 Ga0501032_0001671 3300049569 Bacteria 17620
176 Ga0501033_0007884 3300049570 Bacteria 8251
177 Ga0501036_0126397 3300049572 Bacteria 2159
178 Ga0501036_0527037 3300049572 Unclassified 982
179 Ga0501038_0144404 3300049574 Bacteria 1944
180 Ga0501039_0043740 3300049575 Bacteria 3459
181 Ga0501039_0401451 3300049575 Bacteria 1076
182 Ga0501040_0015593 3300049576 Bacteria 5023
183 Ga0501042_0087103 3300049578 Bacteria 2240
184 Ga0501043_0309779 3300049579 Unclassified 1205
185 Ga0501043_0420641 3300049579 Bacteria 1007
186 Ga0501046_0542975 3300049580 Bacteria 829
187 Ga0501047_0338044 3300049581 Bacteria 1344
188 Ga0501048_0022375 3300049582 Bacteria 4624
189 Ga0501070_0409001 3300049586 Unclassified 1097
190 Ga0501071_0436636 3300049587 Bacteria 1001
191 Ga0501072_0059583 3300049588 Bacteria 3010
192 Ga0501072_0169322 3300049588 Bacteria 1743
193 Ga0501075_0011080 3300049591 Bacteria 6365
194 Ga0501075_0074896 3300049591 Bacteria 2560
195 Ga0501076_0013034 3300049592 Bacteria 6224
196 Ga0501076_0023344 3300049592 Bacteria 4766
197 Ga0501079_0009876 3300049741 Bacteria 7241
198 Ga0501080_0166404 3300049742 Bacteria 2034
199 Ga0501080_0199499 3300049742 Bacteria 1837
200 Ga0501081_0015025 3300049743 Bacteria 5109
201 Ga0501083_0189478 3300049744 Bacteria 1342
202 Ga0501035_0003627 3300049822 Bacteria 14724
203 Ga0501044_0000792 3300049823 Bacteria 38210
204 Ga0501044_0410326 3300049823 Bacteria 1266
205 Ga0501045_0014290 3300049824 Bacteria 5626
206 Ga0501045_0052154 3300049824 Bacteria 2986
207 nmdc:mga0k408_253567_c1 3300050493 Bacteria 1050
208 nmdc:mga05p37_500_c1 3300050507 Bacteria 43103
209 nmdc:mga09592_100_c1 3300050508 Bacteria 52155
210 nmdc:mga06r32_14781_c1 3300050510 Bacteria 7082
211 nmdc:mga06r32_17175_c1 3300050510 Bacteria 6605
212 nmdc:mga06r32_397176_c1 3300050510 Bacteria 1361
213 nmdc:mga08y16_232598_c1 3300050511 Unclassified 1906
214 Ga0501084_0095110 3300054114 Bacteria 2502
215 Ga0501082_0089007 3300060353 Bacteria 2665
216 Ga0501082_0150026 3300060353 Bacteria 2024
217 Ga0530510_0000408 3300061734 Bacteria 27909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031235 Ga0265330_10004980 Ga0265330_100049805 207
2 3300006844 Ga0075428_100015784 Ga0075428_1000157849 215
3 3300006847 Ga0075431_100264506 Ga0075431_1002645062 215
4 3300006880 Ga0075429_100000107 Ga0075429_1000001073 215
5 3300009147 Ga0114129_10021420 Ga0114129_100214205 215
6 3300050507 nmdc:mga05p37_500_c1 nmdc:mga05p37_500_c1_29378_30091 215
7 3300050508 nmdc:mga09592_100_c1 nmdc:mga09592_100_c1_7613_8326 215
8 3300050510 nmdc:mga06r32_17175_c1 nmdc:mga06r32_17175_c1_4950_5663 215
9 3300005340 Ga0070689_100564467 Ga0070689_1005644671 222
10 3300005577 Ga0068857_100504999 Ga0068857_1005049992 222
11 3300006846 Ga0075430_100172493 Ga0075430_1001724932 233
12 3300009094 Ga0111539_10721652 Ga0111539_107216521 234
13 3300003323 rootH1_10002102 rootH1_100021022 235
14 3300005440 Ga0070705_100110405 Ga0070705_1001104052 235
15 3300005441 Ga0070700_100590130 Ga0070700_1005901301 235
16 3300005444 Ga0070694_100139485 Ga0070694_1001394852 235
17 3300005471 Ga0070698_100018337 Ga0070698_1000183376 235
18 3300005546 Ga0070696_100226214 Ga0070696_1002262142 235
19 3300005549 Ga0070704_100001459 Ga0070704_1000014595 235
20 3300006847 Ga0075431_100412626 Ga0075431_1004126262 235
21 3300006852 Ga0075433_10493569 Ga0075433_104935692 235
22 3300009094 Ga0111539_10271548 Ga0111539_102715483 235
23 3300009148 Ga0105243_10278645 Ga0105243_102786452 235
24 3300009148 Ga0105243_10334892 Ga0105243_103348922 235
25 3300025935 Ga0207709_10193314 Ga0207709_101933141 235
26 3300025935 Ga0207709_10259645 Ga0207709_102596452 235
27 3300035172 Ga0373955_0059340 Ga0373955_0059340_1037_1753 235
28 3300039062 Ga0400483_151618 Ga0400483_151618_376_1089 235
29 3300042435 Ga0439434_0073319 Ga0439434_0073319_154_870 235
30 3300045051 Ga0451576_0131559 Ga0451576_0131559_1806_2519 235
31 3300045051 Ga0451576_0180418 Ga0451576_0180418_907_1620 235
32 3300050510 nmdc:mga06r32_397176_c1 nmdc:mga06r32_397176_c1_461_1171 235
33 3300050511 nmdc:mga08y16_232598_c1 nmdc:mga08y16_232598_c1_97_804 235
34 3300025303 Ga0209051_1069725 Ga0209051_10697252 238
35 3300031235 Ga0265330_10166024 Ga0265330_101660242 238
36 3300031250 Ga0265331_10005969 Ga0265331_100059692 238
37 3300031250 Ga0265331_10005969 Ga0265331_100059695 238
38 3300042876 Ga0451577_0012581 Ga0451577_0012581_6186_6908 238
39 3300045051 Ga0451576_0068560 Ga0451576_0068560_2954_3676 238
40 3300005364 Ga0070673_100622155 Ga0070673_1006221551 239
41 3300005335 Ga0070666_10340539 Ga0070666_103405391 240
42 3300005364 Ga0070673_100029745 Ga0070673_1000297455 240
43 3300005367 Ga0070667_100108867 Ga0070667_1001088672 240
44 3300005617 Ga0068859_100042115 Ga0068859_1000421154 240
45 3300005618 Ga0068864_100486138 Ga0068864_1004861381 240
46 3300005719 Ga0068861_100186666 Ga0068861_1001866662 240
47 3300005840 Ga0068870_10044362 Ga0068870_100443622 240
48 3300005841 Ga0068863_100095817 Ga0068863_1000958171 240
49 3300005844 Ga0068862_100086001 Ga0068862_1000860011 240
50 3300006237 Ga0097621_100074077 Ga0097621_1000740773 240
51 3300006931 Ga0097620_100042119 Ga0097620_1000421194 240
52 3300009098 Ga0105245_10062848 Ga0105245_100628481 240
53 3300009176 Ga0105242_10470569 Ga0105242_104705691 240
54 3300014325 Ga0163163_10351613 Ga0163163_103516132 240
55 3300025923 Ga0207681_10664280 Ga0207681_106642801 240
56 3300025926 Ga0207659_10259320 Ga0207659_102593202 240
57 3300025934 Ga0207686_10278168 Ga0207686_102781682 240
58 3300025938 Ga0207704_10245069 Ga0207704_102450692 240
59 3300025942 Ga0207689_10001697 Ga0207689_1000169715 240
60 3300025960 Ga0207651_10449141 Ga0207651_104491411 240
61 3300026023 Ga0207677_10418003 Ga0207677_104180031 240
62 3300026088 Ga0207641_10077950 Ga0207641_100779501 240
63 3300026089 Ga0207648_10342004 Ga0207648_103420042 240
64 3300026118 Ga0207675_100250572 Ga0207675_1002505722 240
65 3300028556 Ga0265337_1017997 Ga0265337_10179973 240
66 3300028556 Ga0265337_1037460 Ga0265337_10374602 240
67 3300028563 Ga0265319_1051333 Ga0265319_10513331 240
68 3300028666 Ga0265336_10020866 Ga0265336_100208664 240
69 3300031240 Ga0265320_10000316 Ga0265320_1000031610 240
70 3300049572 Ga0501036_0126397 Ga0501036_0126397_917_1675 240
71 3300049574 Ga0501038_0144404 Ga0501038_0144404_48_806 240
72 3300049575 Ga0501039_0401451 Ga0501039_0401451_276_1034 240
73 3300049576 Ga0501040_0015593 Ga0501040_0015593_590_1348 240
74 3300049578 Ga0501042_0087103 Ga0501042_0087103_851_1609 240
75 3300049579 Ga0501043_0420641 Ga0501043_0420641_106_864 240
76 3300049580 Ga0501046_0542975 Ga0501046_0542975_10_768 240
77 3300049582 Ga0501048_0022375 Ga0501048_0022375_2280_3038 240
78 3300049586 Ga0501070_0409001 Ga0501070_0409001_110_838 240
79 3300049587 Ga0501071_0436636 Ga0501071_0436636_81_839 240
80 3300049588 Ga0501072_0059583 Ga0501072_0059583_2102_2860 240
81 3300049588 Ga0501072_0169322 Ga0501072_0169322_500_1258 240
82 3300049591 Ga0501075_0011080 Ga0501075_0011080_2382_3140 240
83 3300049591 Ga0501075_0074896 Ga0501075_0074896_734_1492 240
84 3300049592 Ga0501076_0013034 Ga0501076_0013034_1950_2708 240
85 3300049592 Ga0501076_0023344 Ga0501076_0023344_3654_4412 240
86 3300049741 Ga0501079_0009876 Ga0501079_0009876_6319_7077 240
87 3300049742 Ga0501080_0166404 Ga0501080_0166404_1134_1892 240
88 3300049743 Ga0501081_0015025 Ga0501081_0015025_3862_4620 240
89 3300049744 Ga0501083_0189478 Ga0501083_0189478_203_961 240
90 3300049824 Ga0501045_0014290 Ga0501045_0014290_2739_3497 240
91 3300049824 Ga0501045_0052154 Ga0501045_0052154_1765_2523 240
92 3300054114 Ga0501084_0095110 Ga0501084_0095110_891_1649 240
93 3300060353 Ga0501082_0089007 Ga0501082_0089007_526_1284 240
94 3300060353 Ga0501082_0150026 Ga0501082_0150026_1095_1853 240
95 3300061734 Ga0530510_0000408 Ga0530510_0000408_23640_24398 240
96 3300005617 Ga0068859_100796352 Ga0068859_1007963522 241
97 3300006847 Ga0075431_100040181 Ga0075431_1000401811 241
98 3300006871 Ga0075434_100447918 Ga0075434_1004479182 241
99 3300006931 Ga0097620_100796402 Ga0097620_1007964022 241
100 3300025913 Ga0207695_10121801 Ga0207695_101218012 241
101 3300026088 Ga0207641_10191492 Ga0207641_101914922 241
102 3300042876 Ga0451577_0606777 Ga0451577_0606777_68_796 241
103 3300049568 Ga0501031_0000113 Ga0501031_0000113_7610_8344 241
104 3300049569 Ga0501032_0001671 Ga0501032_0001671_15878_16612 241
105 3300049570 Ga0501033_0007884 Ga0501033_0007884_707_1441 241
106 3300049572 Ga0501036_0527037 Ga0501036_0527037_107_841 241
107 3300049579 Ga0501043_0309779 Ga0501043_0309779_382_1116 241
108 3300049822 Ga0501035_0003627 Ga0501035_0003627_284_1018 241
109 3300049823 Ga0501044_0000792 Ga0501044_0000792_30235_30969 241
110 3300050510 nmdc:mga06r32_14781_c1 nmdc:mga06r32_14781_c1_3883_4611 241
111 3300032004 Ga0307414_10115231 Ga0307414_101152313 242
112 3300049581 Ga0501047_0338044 Ga0501047_0338044_595_1326 242
113 3300049742 Ga0501080_0199499 Ga0501080_0199499_306_1037 242
114 3300005295 Ga0065707_10083596 Ga0065707_1008359611 243
115 3300005353 Ga0070669_100271878 Ga0070669_1002718782 243
116 3300005355 Ga0070671_100030427 Ga0070671_1000304273 243
117 3300005365 Ga0070688_100109578 Ga0070688_1001095782 243
118 3300005438 Ga0070701_10020744 Ga0070701_100207443 243
119 3300005441 Ga0070700_100031884 Ga0070700_1000318842 243
120 3300005444 Ga0070694_100009361 Ga0070694_1000093613 243
121 3300005459 Ga0068867_100000287 Ga0068867_10000028713 243
122 3300005468 Ga0070707_100196519 Ga0070707_1001965191 243
123 3300005543 Ga0070672_100004311 Ga0070672_1000043111 243
124 3300005544 Ga0070686_100002638 Ga0070686_1000026385 243
125 3300005549 Ga0070704_100006628 Ga0070704_1000066282 243
126 3300005616 Ga0068852_100238616 Ga0068852_1002386162 243
127 3300005618 Ga0068864_100038170 Ga0068864_1000381703 243
128 3300005719 Ga0068861_100023717 Ga0068861_1000237172 243
129 3300005841 Ga0068863_100019530 Ga0068863_1000195303 243
130 3300005841 Ga0068863_100294339 Ga0068863_1002943392 243
131 3300005842 Ga0068858_100081343 Ga0068858_1000813432 243
132 3300005842 Ga0068858_100125945 Ga0068858_1001259453 243
133 3300005843 Ga0068860_100000444 Ga0068860_10000044430 243
134 3300005843 Ga0068860_100248143 Ga0068860_1002481432 243
135 3300005844 Ga0068862_100006857 Ga0068862_1000068576 243
136 3300005844 Ga0068862_100028304 Ga0068862_1000283043 243
137 3300006195 Ga0075366_10188017 Ga0075366_101880171 243
138 3300006881 Ga0068865_100089311 Ga0068865_1000893111 243
139 3300009094 Ga0111539_10190375 Ga0111539_101903752 243
140 3300009098 Ga0105245_10021297 Ga0105245_100212973 243
141 3300009147 Ga0114129_10108140 Ga0114129_101081405 243
142 3300009553 Ga0105249_10052911 Ga0105249_100529112 243
143 3300009553 Ga0105249_10258633 Ga0105249_102586332 243
144 3300009553 Ga0105249_10631096 Ga0105249_106310961 243
145 3300011119 Ga0105246_10340450 Ga0105246_103404502 243
146 3300013296 Ga0157374_10431320 Ga0157374_104313201 243
147 3300013297 Ga0157378_10020043 Ga0157378_100200435 243
148 3300013306 Ga0163162_10005859 Ga0163162_1000585913 243
149 3300013308 Ga0157375_10064003 Ga0157375_100640033 243
150 3300013308 Ga0157375_10317565 Ga0157375_103175652 243
151 3300014326 Ga0157380_10024711 Ga0157380_100247112 243
152 3300014968 Ga0157379_10066756 Ga0157379_100667562 243
153 3300014969 Ga0157376_10218517 Ga0157376_102185171 243
154 3300017792 Ga0163161_10129793 Ga0163161_101297932 243
155 3300025923 Ga0207681_10229227 Ga0207681_102292272 243
156 3300025931 Ga0207644_10133849 Ga0207644_101338493 243
157 3300025938 Ga0207704_10072733 Ga0207704_100727332 243
158 3300025961 Ga0207712_10180679 Ga0207712_101806792 243
159 3300026023 Ga0207677_10015471 Ga0207677_100154713 243
160 3300026075 Ga0207708_10023618 Ga0207708_100236182 243
161 3300026088 Ga0207641_10141757 Ga0207641_101417573 243
162 3300026089 Ga0207648_10000283 Ga0207648_1000028323 243
163 3300026095 Ga0207676_10197629 Ga0207676_101976291 243
164 3300028380 Ga0268265_10008660 Ga0268265_100086606 243
165 3300028380 Ga0268265_10071105 Ga0268265_100711052 243
166 3300028381 Ga0268264_10009350 Ga0268264_100093502 243
167 3300028794 Ga0307515_10064792 Ga0307515_100647924 243
168 3300029957 Ga0265324_10006251 Ga0265324_100062512 243
169 3300031456 Ga0307513_10032342 Ga0307513_100323422 243
170 3300035112 Ga0373932_0044970 Ga0373932_0044970_381_1154 243
171 3300035171 Ga0373946_0175041 Ga0373946_0175041_162_929 243
172 3300035695 Ga0373927_0008000 Ga0373927_0008000_4473_5243 243
173 3300037068 Ga0373925_0105738 Ga0373925_0105738_88_855 243
174 3300045051 Ga0451576_0287688 Ga0451576_0287688_658_1395 243
175 3300046461 Ga0495641_0138382 Ga0495641_0138382_195_962 243
176 3300050493 nmdc:mga0k408_253567_c1 nmdc:mga0k408_253567_c1_156_926 243
177 3300005563 Ga0068855_100166180 Ga0068855_1001661802 244
178 3300005577 Ga0068857_100588578 Ga0068857_1005885782 244
179 3300005614 Ga0068856_100000573 Ga0068856_10000057331 244
180 3300026078 Ga0207702_10001003 Ga0207702_1000100330 244
181 3300026116 Ga0207674_10508609 Ga0207674_105086091 244
182 3300034816 Ga0373930_0000422 Ga0373930_0000422_3565_4302 244
183 3300034818 Ga0373950_0018049 Ga0373950_0018049_443_1180 244
184 3300035084 Ga0373928_0000004 Ga0373928_0000004_8635_9372 244
185 3300035085 Ga0373929_0001526 Ga0373929_0001526_1383_2120 244
186 3300035089 Ga0373944_0001325 Ga0373944_0001325_2509_3246 244
187 3300035090 Ga0373949_0005000 Ga0373949_0005000_869_1606 244
188 3300035091 Ga0373951_0001821 Ga0373951_0001821_189_926 244
189 3300035112 Ga0373932_0000001 Ga0373932_0000001_875137_875874 244
190 3300035116 Ga0373945_0063440 Ga0373945_0063440_398_1135 244
191 3300035170 Ga0373943_0203822 Ga0373943_0203822_291_1028 244
192 3300035171 Ga0373946_0188318 Ga0373946_0188318_188_925 244
193 3300035242 Ga0373962_0002814 Ga0373962_0002814_343_1080 244
194 3300035691 Ga0373931_0000008 Ga0373931_0000008_341712_342449 244
195 3300035695 Ga0373927_0187854 Ga0373927_0187854_454_1191 244
196 3300035725 Ga0373947_0035040 Ga0373947_0035040_657_1394 244
197 3300037068 Ga0373925_0000077 Ga0373925_0000077_15818_16555 244
198 3300005467 Ga0070706_100134155 Ga0070706_1001341552 248
199 3300009093 Ga0105240_10200236 Ga0105240_102002363 249
200 3300009551 Ga0105238_10011888 Ga0105238_100118886 249
201 3300025924 Ga0207694_10004382 Ga0207694_100043821 249
202 3300025949 Ga0207667_10426329 Ga0207667_104263292 249
203 3300049823 Ga0501044_0410326 Ga0501044_0410326_121_876 249
204 3300028800 Ga0265338_10000974 Ga0265338_1000097441 250
205 3300029957 Ga0265324_10001027 Ga0265324_100010274 250
206 3300031251 Ga0265327_10000387 Ga0265327_100003879 250
207 3300041486 Ga0451807_1411794 Ga0451807_1411794_565_1380 250
208 3300028800 Ga0265338_10080457 Ga0265338_100804572 251
209 3300009093 Ga0105240_10556554 Ga0105240_105565542 252
210 3300001977 JGI24746J21847_1000287 JGI24746J21847_10002878 254
211 3300005459 Ga0068867_100000052 Ga0068867_1000000522 254
212 3300009148 Ga0105243_10000062 Ga0105243_10000062122 254
213 3300014745 Ga0157377_10068950 Ga0157377_100689503 254
214 3300025907 Ga0207645_10093008 Ga0207645_100930081 254
215 3300025927 Ga0207687_10130287 Ga0207687_101302871 254
216 3300025935 Ga0207709_10035104 Ga0207709_100351042 254
217 3300026089 Ga0207648_10000153 Ga0207648_1000015372 254
218 3300049575 Ga0501039_0043740 Ga0501039_0043740_2140_2913 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

63

261

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h93-assembly4.cif.gz_D crystal structure of geobacter metallireducens smug1 0.9816 20 252
5h93-assembly3.cif.gz_C crystal structure of geobacter metallireducens smug1 0.9798 20 252
5h93-assembly2.cif.gz_B crystal structure of geobacter metallireducens smug1 0.9778 20 254
5h93-assembly1.cif.gz_A crystal structure of geobacter metallireducens smug1 0.9776 20 254
5h99-assembly1.cif.gz_A crystal structure of geobacter metallireducens smug1 mutant n58d 0.975 20 254
ID Description Score Start End Superfamily
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9707 15 253 3.40.470.10
af_Q9VEM1_36_278_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9578 17 253 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.95 20 252 3.40.470.10
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9436 15 253 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9286 20 252 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A2V6ER91-F1-model_v4 Single-stranded DNA-binding protein 0.9905 17 212 GO:0000703
GO:0003677
GO:0006284
GO:0017065
AF-A0A2V6NDK8-F1-model_v4 Single-stranded DNA-binding protein 0.9892 15 189 GO:0000703
GO:0003677
GO:0006284
GO:0017065
AF-A0A3D5K012-F1-model_v4 Single-stranded DNA-binding protein 0.9887 17 254 GO:0000703
GO:0003677
GO:0006284
GO:0017065
AF-A0A7W1J2D8-F1-model_v4 Single-stranded DNA-binding protein 0.9887 17 254 GO:0000703
GO:0003677
GO:0006284
GO:0017065
AF-A0A3D1IRS1-F1-model_v4 Single-stranded DNA-binding protein 0.9873 46 254 GO:0000703
GO:0003677
GO:0006284
GO:0017065

Feature Viewer

pLDDT pTM Quality
91.66 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map