F330040

General Info

Members Datasets Scaffolds Average Seq Length
218 134 436 162

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10433713|Ga0207686_104337132
Length 182
Sequence MAQTRERRSSDSSSERIEGELSEHIVKIKRCAAVVKGGRRFSFAAMVVVGDGKGKVGWGYGKANEVPSAVEKGTKDARKQMFKVNLKGASVPHTVTGRNGASSVVLVPARPGTGITAGKSVRPCLELVGVTDILSKAYGSTSPKNLVKATIDALRQLQNRDQVEGNRGVKLAKGAGELVTAE

Samples

Sample ID Description Type Environment
1 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
132 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
133 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
134 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 5.96
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 5.96
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207686_10433713 3300025934 Bacteria 1008
2 Ga0070690_100152003 3300005330 Bacteria 1580
3 Ga0070682_100802182 3300005337 Bacteria 765
4 Ga0068868_101368206 3300005338 Bacteria 659
5 Ga0070674_100170523 3300005356 Bacteria 1659
6 Ga0070688_100098311 3300005365 Bacteria 1925
7 Ga0070688_100988431 3300005365 Bacteria 668
8 Ga0070714_100311438 3300005435 Bacteria 1470
9 Ga0070678_100398627 3300005456 Bacteria 1195
10 Ga0070698_100572055 3300005471 Bacteria 1070
11 Ga0070699_100296549 3300005518 Bacteria 1450
12 Ga0070686_100379552 3300005544 Bacteria 1070
13 Ga0070665_100000611 3300005548 Bacteria 48974
14 Ga0070665_100034049 3300005548 Bacteria 5123
15 Ga0068855_100193583 3300005563 Bacteria 2292
16 Ga0068859_101795147 3300005617 Bacteria 677
17 Ga0068864_100976587 3300005618 Bacteria 839
18 Ga0068858_100566602 3300005842 Bacteria 1100
19 Ga0068860_101449493 3300005843 Bacteria 708
20 Ga0068862_101196593 3300005844 Bacteria 758
21 Ga0075363_100450310 3300006048 Bacteria 760
22 Ga0075428_100005581 3300006844 Bacteria 13974
23 Ga0075428_100069827 3300006844 Bacteria 3840
24 Ga0075428_101127345 3300006844 Bacteria 828
25 Ga0075431_100498709 3300006847 Bacteria 1209
26 Ga0075429_100292036 3300006880 Bacteria 1427
27 Ga0097620_101794964 3300006931 Bacteria 677
28 Ga0111539_10510453 3300009094 Bacteria 1400
29 Ga0111539_10600933 3300009094 Bacteria 1281
30 Ga0105247_10194323 3300009101 Bacteria 1360
31 Ga0105242_10859846 3300009176 Bacteria 903
32 Ga0105248_10351945 3300009177 Bacteria 1658
33 Ga0105237_10997514 3300009545 Bacteria 844
34 Ga0105249_10110152 3300009553 Bacteria 2601
35 Ga0105239_10725366 3300010375 Bacteria 1137
36 Ga0105239_10915389 3300010375 Bacteria 1007
37 Ga0105239_11643311 3300010375 Bacteria 743
38 Ga0105246_10300449 3300011119 Bacteria 1296
39 Ga0163163_10633062 3300014325 Bacteria 1133
40 Ga0184599_102391 3300019188 Bacteria 653
41 Ga0197907_10720577 3300020069 Bacteria 587
42 Ga0197907_11189346 3300020069 Bacteria 653
43 Ga0206356_11778953 3300020070 Bacteria 1195
44 Ga0206349_1178666 3300020075 Bacteria 532
45 Ga0206352_11278405 3300020078 Bacteria 672
46 Ga0206350_10643353 3300020080 Bacteria 553
47 Ga0206354_10474280 3300020081 Bacteria 681
48 Ga0206354_10986252 3300020081 Bacteria 1119
49 Ga0213873_10006215 3300021358 Bacteria 2340
50 Ga0213872_10009926 3300021361 Bacteria 4547
51 Ga0213871_10002791 3300021441 Bacteria 3269
52 Ga0224712_10016600 3300022467 Bacteria 2423
53 Ga0224712_10210823 3300022467 Bacteria 886
54 Ga0224712_10234159 3300022467 Bacteria 844
55 Ga0207692_11094339 3300025898 Bacteria 528
56 Ga0207710_10127981 3300025900 Bacteria 1218
57 Ga0207645_10170582 3300025907 Bacteria 1426
58 Ga0207707_10941451 3300025912 Bacteria 712
59 Ga0207671_10643889 3300025914 Bacteria 844
60 Ga0207652_10738861 3300025921 Bacteria 876
61 Ga0207664_10223861 3300025929 Bacteria 1633
62 Ga0207667_10154278 3300025949 Bacteria 2363
63 Ga0207703_10554855 3300026035 Bacteria 1083
64 Ga0207678_10461446 3300026067 Bacteria 1105
65 Ga0207678_10601850 3300026067 Bacteria 964
66 Ga0207678_11197677 3300026067 Bacteria 672
67 Ga0207676_10929819 3300026095 Bacteria 854
68 Ga0268266_10003698 3300028379 Bacteria 15081
69 Ga0268266_10052515 3300028379 Bacteria 3500
70 Ga0268266_10904312 3300028379 Bacteria 854
71 Ga0265760_10188796 3300031090 Bacteria 691
72 Ga0265332_10043042 3300031238 Bacteria 1951
73 Ga0265325_10003872 3300031241 Bacteria 9604
74 Ga0265339_10003333 3300031249 Bacteria 11244
75 Ga0265331_10005570 3300031250 Bacteria 7583
76 Ga0265313_10000050 3300031595 Bacteria 111425
77 Ga0265314_10000306 3300031711 Bacteria 70032
78 Ga0265342_10011241 3300031712 Bacteria 6141
79 Ga0316574_0320886 3300035398 Bacteria 983
80 Ga0373935_0551832 3300035692 Bacteria 840
81 Ga0373927_0294133 3300035695 Bacteria 1069
82 Ga0373927_0515751 3300035695 Bacteria 790
83 Ga0373927_0765175 3300035695 Bacteria 638
84 Ga0373947_0385554 3300035725 Bacteria 944
85 Ga0436364_0936692 3300037853 Bacteria 935
86 Ga0436364_1350057 3300037853 Bacteria 1814
87 Ga0436364_1510878 3300037853 Bacteria 574
88 Ga0436364_1514024 3300037853 Bacteria 619
89 Ga0395901_1175703 3300038443 Bacteria 734
90 Ga0436365_0126587 3300039437 Bacteria 2208
91 Ga0436365_1201834 3300039437 Bacteria 1830
92 Ga0436360_0209023 3300039438 Bacteria 715
93 Ga0436360_0561605 3300039438 Bacteria 14597
94 Ga0436360_0727039 3300039438 Bacteria 795
95 Ga0436361_0261091 3300039447 Bacteria 588
96 Ga0436361_0729891 3300039447 Bacteria 747
97 Ga0436361_1205299 3300039447 Bacteria 6283
98 Ga0436363_0978968 3300039450 Bacteria 680
99 Ga0436363_1043338 3300039450 Bacteria 1904
100 Ga0436363_1081965 3300039450 Bacteria 565
101 Ga0436363_1641341 3300039450 Bacteria 721
102 Ga0436362_0094217 3300039453 Bacteria 9983
103 Ga0436362_0214653 3300039453 Bacteria 541
104 Ga0436362_0542023 3300039453 Bacteria 581
105 Ga0451839_1504934 3300041496 Bacteria 715
106 Ga0439434_0084855 3300042435 Bacteria 1008
107 Ga0451577_0001597 3300042876 Bacteria 29525
108 Ga0451577_0016290 3300042876 Bacteria 6887
109 Ga0451577_0110369 3300042876 Bacteria 2460
110 Ga0466966_0596199 3300044684 Bacteria 665
111 Ga0453684_0000194 3300044712 Bacteria 265783
112 Ga0453684_0004724 3300044712 Bacteria 28171
113 Ga0453684_0020910 3300044712 Bacteria 9821
114 Ga0453684_0034156 3300044712 Bacteria 7068
115 Ga0453684_0236326 3300044712 Bacteria 2106
116 Ga0466971_0470720 3300044719 Bacteria 618
117 Ga0466967_0984315 3300045976 Bacteria 840
118 Ga0495592_0156265 3300046454 Bacteria 1573
119 Ga0495628_0247980 3300046516 Bacteria 1330
120 Ga0495628_0357093 3300046516 Bacteria 1073
121 Ga0495676_0732608 3300047321 Bacteria 639
122 Ga0495602_0077087 3300048088 Bacteria 2822
123 Ga0496101_0296483 3300048904 Bacteria 1266
124 Ga0496102_1272918 3300048905 Bacteria 655
125 Ga0496103_0526903 3300048906 Bacteria 755
126 Ga0496103_0899720 3300048906 Bacteria 555
127 Ga0496104_0141767 3300048907 Bacteria 2309
128 Ga0496104_0530787 3300048907 Bacteria 1088
129 Ga0496104_1103606 3300048907 Bacteria 697
130 Ga0496105_1093483 3300048908 Bacteria 592
131 Ga0496107_0741949 3300048910 Bacteria 721
132 Ga0496109_0438003 3300048912 Bacteria 1235
133 Ga0496109_1710615 3300048912 Bacteria 563
134 Ga0496115_0033683 3300048918 Bacteria 4046
135 Ga0496115_0483921 3300048918 Bacteria 996
136 Ga0501031_0545103 3300049568 Bacteria 747
137 Ga0501032_0626465 3300049569 Bacteria 684
138 Ga0501033_0022621 3300049570 Bacteria 4742
139 Ga0501034_0003949 3300049571 Bacteria 16663
140 Ga0501034_0009257 3300049571 Bacteria 10322
141 Ga0501034_0134296 3300049571 Bacteria 2456
142 Ga0501034_0141519 3300049571 Bacteria 2385
143 Ga0501034_0203447 3300049571 Bacteria 1937
144 Ga0501034_0297856 3300049571 Bacteria 1550
145 Ga0501034_1251448 3300049571 Unclassified 620
146 Ga0501036_0346772 3300049572 Bacteria 1240
147 Ga0501036_0595845 3300049572 Bacteria 917
148 Ga0501037_0339381 3300049573 Bacteria 1038
149 Ga0501037_0478456 3300049573 Bacteria 847
150 Ga0501038_1102056 3300049574 Bacteria 580
151 Ga0501040_0267075 3300049576 Unclassified 1221
152 Ga0501041_0383612 3300049577 Bacteria 889
153 Ga0501042_0143979 3300049578 Unclassified 1719
154 Ga0501042_0943327 3300049578 Bacteria 629
155 Ga0501042_1147647 3300049578 Bacteria 566
156 Ga0501043_0591024 3300049579 Bacteria 821
157 Ga0501046_0002539 3300049580 Bacteria 17062
158 Ga0501046_0003325 3300049580 Bacteria 14782
159 Ga0501047_0036320 3300049581 Bacteria 4762
160 Ga0501047_0045377 3300049581 Bacteria 4250
161 Ga0501047_0735141 3300049581 Bacteria 803
162 Ga0501048_0055124 3300049582 Bacteria 2823
163 Ga0501048_0122543 3300049582 Bacteria 1837
164 Ga0501048_0392725 3300049582 Bacteria 991
165 Ga0501048_1119225 3300049582 Bacteria 566
166 Ga0501068_0169902 3300049584 Unclassified 1376
167 Ga0501070_0006209 3300049586 Bacteria 10181
168 Ga0501070_0036924 3300049586 Bacteria 4080
169 Ga0501070_0593093 3300049586 Bacteria 884
170 Ga0501070_0900458 3300049586 Bacteria 690
171 Ga0501071_0428138 3300049587 Bacteria 1012
172 Ga0501071_0569221 3300049587 Bacteria 871
173 Ga0501071_0685494 3300049587 Bacteria 789
174 Ga0501071_0981472 3300049587 Unclassified 652
175 Ga0501072_0633357 3300049588 Bacteria 842
176 Ga0501073_0307375 3300049589 Bacteria 1094
177 Ga0501073_0723048 3300049589 Unclassified 687
178 Ga0501074_1006650 3300049590 Bacteria 586
179 Ga0501075_0329655 3300049591 Bacteria 1163
180 Ga0501075_0539004 3300049591 Bacteria 891
181 Ga0501076_0113853 3300049592 Bacteria 2188
182 Ga0501076_0211370 3300049592 Bacteria 1585
183 Ga0501076_0638200 3300049592 Bacteria 879
184 Ga0501076_0671825 3300049592 Bacteria 855
185 Ga0501076_0945931 3300049592 Bacteria 710
186 Ga0501076_1019631 3300049592 Bacteria 682
187 Ga0501080_0183483 3300049742 Bacteria 1925
188 Ga0501080_0562772 3300049742 Bacteria 1015
189 Ga0501081_0937017 3300049743 Bacteria 653
190 Ga0501081_1109895 3300049743 Bacteria 599
191 Ga0501035_0126791 3300049822 Bacteria 2228
192 Ga0501035_0614012 3300049822 Bacteria 885
193 Ga0501035_0877906 3300049822 Bacteria 712
194 Ga0501044_0159294 3300049823 Bacteria 2235
195 Ga0501044_0170220 3300049823 Bacteria 2150
196 Ga0501044_0620180 3300049823 Bacteria 973
197 nmdc:mga03n38_357101_c1 3300050490 Bacteria 796
198 nmdc:mga03n38_455615_c1 3300050490 Bacteria 712
199 nmdc:mga09592_237175_c1 3300050508 Bacteria 1580
200 nmdc:mga06r32_489771_c1 3300050510 Bacteria 1207
201 nmdc:mga08y16_308989_c1 3300050511 Bacteria 1628
202 nmdc:mga08y16_769887_c1 3300050511 Bacteria 957
203 nmdc:mga0a205_1013451_c1 3300050515 Bacteria 677
204 Ga0495601_0018745 3300053077 Bacteria 4213
205 Ga0495619_0018602 3300053085 Bacteria 4409
206 Ga0495619_0514870 3300053085 Bacteria 822
207 Ga0500593_220820 3300053117 Bacteria 666
208 Ga0501084_0035133 3300054114 Bacteria 4190
209 Ga0501084_0172812 3300054114 Bacteria 1824
210 Ga0501084_1237397 3300054114 Bacteria 626
211 Ga0501082_0598185 3300060353 Bacteria 965
212 Ga0501082_1210244 3300060353 Unclassified 660
213 Ga0501082_1462353 3300060353 Bacteria 597
214 Ga0530510_0432433 3300061734 Bacteria 994
215 2688065825 2687453257 Bacteria 6784659
216 2688394924 2687453341 Bacteria 6534136
217 2889421827 2889415604 Bacteria 8048700
218 2920113197 2920107658 Bacteria 10042636
219 Ga0207686_10433713
220 Ga0070690_100152003
221 Ga0070682_100802182
222 Ga0068868_101368206
223 Ga0070674_100170523
224 Ga0070688_100098311
225 Ga0070688_100988431
226 Ga0070714_100311438
227 Ga0070678_100398627
228 Ga0070698_100572055
229 Ga0070699_100296549
230 Ga0070686_100379552
231 Ga0070665_100000611
232 Ga0070665_100034049
233 Ga0068855_100193583
234 Ga0068859_101795147
235 Ga0068864_100976587
236 Ga0068858_100566602
237 Ga0068860_101449493
238 Ga0068862_101196593
239 Ga0075363_100450310
240 Ga0075428_100005581
241 Ga0075428_100069827
242 Ga0075428_101127345
243 Ga0075431_100498709
244 Ga0075429_100292036
245 Ga0097620_101794964
246 Ga0111539_10510453
247 Ga0111539_10600933
248 Ga0105247_10194323
249 Ga0105242_10859846
250 Ga0105248_10351945
251 Ga0105237_10997514
252 Ga0105249_10110152
253 Ga0105239_10725366
254 Ga0105239_10915389
255 Ga0105239_11643311
256 Ga0105246_10300449
257 Ga0163163_10633062
258 Ga0184599_102391
259 Ga0197907_10720577
260 Ga0197907_11189346
261 Ga0206356_11778953
262 Ga0206349_1178666
263 Ga0206352_11278405
264 Ga0206350_10643353
265 Ga0206354_10474280
266 Ga0206354_10986252
267 Ga0213873_10006215
268 Ga0213872_10009926
269 Ga0213871_10002791
270 Ga0224712_10016600
271 Ga0224712_10210823
272 Ga0224712_10234159
273 Ga0207692_11094339
274 Ga0207710_10127981
275 Ga0207645_10170582
276 Ga0207707_10941451
277 Ga0207671_10643889
278 Ga0207652_10738861
279 Ga0207664_10223861
280 Ga0207667_10154278
281 Ga0207703_10554855
282 Ga0207678_10461446
283 Ga0207678_10601850
284 Ga0207678_11197677
285 Ga0207676_10929819
286 Ga0268266_10003698
287 Ga0268266_10052515
288 Ga0268266_10904312
289 Ga0265760_10188796
290 Ga0265332_10043042
291 Ga0265325_10003872
292 Ga0265339_10003333
293 Ga0265331_10005570
294 Ga0265313_10000050
295 Ga0265314_10000306
296 Ga0265342_10011241
297 Ga0316574_0320886
298 Ga0373935_0551832
299 Ga0373927_0294133
300 Ga0373927_0515751
301 Ga0373927_0765175
302 Ga0373947_0385554
303 Ga0436364_0936692
304 Ga0436364_1350057
305 Ga0436364_1510878
306 Ga0436364_1514024
307 Ga0395901_1175703
308 Ga0436365_0126587
309 Ga0436365_1201834
310 Ga0436360_0209023
311 Ga0436360_0561605
312 Ga0436360_0727039
313 Ga0436361_0261091
314 Ga0436361_0729891
315 Ga0436361_1205299
316 Ga0436363_0978968
317 Ga0436363_1043338
318 Ga0436363_1081965
319 Ga0436363_1641341
320 Ga0436362_0094217
321 Ga0436362_0214653
322 Ga0436362_0542023
323 Ga0451839_1504934
324 Ga0439434_0084855
325 Ga0451577_0001597
326 Ga0451577_0016290
327 Ga0451577_0110369
328 Ga0466966_0596199
329 Ga0453684_0000194
330 Ga0453684_0004724
331 Ga0453684_0020910
332 Ga0453684_0034156
333 Ga0453684_0236326
334 Ga0466971_0470720
335 Ga0466967_0984315
336 Ga0495592_0156265
337 Ga0495628_0247980
338 Ga0495628_0357093
339 Ga0495676_0732608
340 Ga0495602_0077087
341 Ga0496101_0296483
342 Ga0496102_1272918
343 Ga0496103_0526903
344 Ga0496103_0899720
345 Ga0496104_0141767
346 Ga0496104_0530787
347 Ga0496104_1103606
348 Ga0496105_1093483
349 Ga0496107_0741949
350 Ga0496109_0438003
351 Ga0496109_1710615
352 Ga0496115_0033683
353 Ga0496115_0483921
354 Ga0501031_0545103
355 Ga0501032_0626465
356 Ga0501033_0022621
357 Ga0501034_0003949
358 Ga0501034_0009257
359 Ga0501034_0134296
360 Ga0501034_0141519
361 Ga0501034_0203447
362 Ga0501034_0297856
363 Ga0501034_1251448
364 Ga0501036_0346772
365 Ga0501036_0595845
366 Ga0501037_0339381
367 Ga0501037_0478456
368 Ga0501038_1102056
369 Ga0501040_0267075
370 Ga0501041_0383612
371 Ga0501042_0143979
372 Ga0501042_0943327
373 Ga0501042_1147647
374 Ga0501043_0591024
375 Ga0501046_0002539
376 Ga0501046_0003325
377 Ga0501047_0036320
378 Ga0501047_0045377
379 Ga0501047_0735141
380 Ga0501048_0055124
381 Ga0501048_0122543
382 Ga0501048_0392725
383 Ga0501048_1119225
384 Ga0501068_0169902
385 Ga0501070_0006209
386 Ga0501070_0036924
387 Ga0501070_0593093
388 Ga0501070_0900458
389 Ga0501071_0428138
390 Ga0501071_0569221
391 Ga0501071_0685494
392 Ga0501071_0981472
393 Ga0501072_0633357
394 Ga0501073_0307375
395 Ga0501073_0723048
396 Ga0501074_1006650
397 Ga0501075_0329655
398 Ga0501075_0539004
399 Ga0501076_0113853
400 Ga0501076_0211370
401 Ga0501076_0638200
402 Ga0501076_0671825
403 Ga0501076_0945931
404 Ga0501076_1019631
405 Ga0501080_0183483
406 Ga0501080_0562772
407 Ga0501081_0937017
408 Ga0501081_1109895
409 Ga0501035_0126791
410 Ga0501035_0614012
411 Ga0501035_0877906
412 Ga0501044_0159294
413 Ga0501044_0170220
414 Ga0501044_0620180
415 nmdc:mga03n38_357101_c1
416 nmdc:mga03n38_455615_c1
417 nmdc:mga09592_237175_c1
418 nmdc:mga06r32_489771_c1
419 nmdc:mga08y16_308989_c1
420 nmdc:mga08y16_769887_c1
421 nmdc:mga0a205_1013451_c1
422 Ga0495601_0018745
423 Ga0495619_0018602
424 Ga0495619_0514870
425 Ga0500593_220820
426 Ga0501084_0035133
427 Ga0501084_0172812
428 Ga0501084_1237397
429 Ga0501082_0598185
430 Ga0501082_1210244
431 Ga0501082_1462353
432 Ga0530510_0432433
433 2688065825
434 2688394924
435 2889421827
436 2920113197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

21

85

0.98

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

97

167

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvo-assembly1.cif.gz_E cutibacterium acnes 30s ribosomal subunit with sarecycline bound, head domain only in the local refined map 0.9756 9 71
8cwo-assembly1.cif.gz_E cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.966 72 160
5u4j-assembly1.cif.gz_e structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9618 9 144
6spf-assembly1.cif.gz_e pseudomonas aeruginosa 70s ribosome from an aminoglycoside resistant clinical isolate 0.9594 11 150
7unu-assembly1.cif.gz_e pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9579 11 154
ID Description Score Start End Superfamily
af_C0PEC4_230_319_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9876 79 160 3.30.230.10
af_Q54CA5_1734_1797_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9702 11 71 3.30.160.20
af_P54045_5_110_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9643 8 71 3.30.160.20
af_Q10234_225_286_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9637 11 71 3.30.160.20
1vs5E02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.962 79 158 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A2E8GXJ9-F1-model_v4 Small ribosomal subunit protein uS5 0.9757 4 149 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1G3L8F5-F1-model_v4 Small ribosomal subunit protein uS5 0.9678 7 160 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A449BA09-F1-model_v4 Small ribosomal subunit protein uS5 0.967 4 160 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A800N398-F1-model_v4 Small ribosomal subunit protein uS5 0.9664 10 161 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A449B851-F1-model_v4 deleted 0.9654 4 160

Map