F330014

General Info

Members Datasets Scaffolds Average Seq Length
218 146 201 117

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10431182|Ga0207680_104311822
Length 112
Sequence VTSKDAVEKGALAAGGLAAILASACCLGPLLLVTLGLGGAWIGNLTKLEPYRPFFLTAALVAMFFAWRRIYRPAAVCKAIPQVRRTYKIVFWIVAALVLIALGFPYVLPWFY

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
3 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
6 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
7 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
8 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
9 2885266251 Ralstonia sp. SET104 Isolate Nodule
10 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
11 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
12 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
13 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
58 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
98 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
136 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
146 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.83
Metatranscriptomes 1.38
Isolates 7.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.55
Nodule 3.67
Rhizoplane 0.46
Rhizosphere 80.28
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5874910 2162886012 Bacteria 1109
2 JGI24741J21665_1004995 3300001915 Bacteria 2841
3 rootH1_10127924 3300003316 Bacteria 1584
4 rootH2_10107875 3300003320 Bacteria 1667
5 rootL2_10132783 3300003322 Bacteria 3331
6 rootH1_10042758 3300003323 Bacteria 3732
7 Ga0055538_1000002 3300003751 Bacteria 999437
8 Ga0055539_1000002 3300003752 Bacteria 999437
9 Ga0055533_1000004 3300003756 Bacteria 999437
10 Ga0055532_1000035 3300003758 Bacteria 209386
11 Ga0055525_1000002 3300003759 Bacteria 999437
12 Ga0055527_1000021 3300003760 Bacteria 209386
13 Ga0055535_1000012 3300003761 Bacteria 330206
14 Ga0055529_1000047 3300003763 Bacteria 209386
15 Ga0055529_1000060 3300003763 Bacteria 191230
16 Ga0055541_1000002 3300003841 Bacteria 896405
17 Ga0070658_10049609 3300005327 Bacteria 3401
18 Ga0070658_10346843 3300005327 Bacteria 1270
19 Ga0070680_100013968 3300005336 Bacteria 6268
20 Ga0070680_100660743 3300005336 Unclassified 898
21 Ga0070660_100005659 3300005339 Bacteria 8662
22 Ga0070691_10056836 3300005341 Bacteria 1876
23 Ga0070691_10158921 3300005341 Bacteria 1164
24 Ga0070661_100121556 3300005344 Bacteria 1956
25 Ga0070661_100537867 3300005344 Bacteria 939
26 Ga0070692_10055038 3300005345 Bacteria 2079
27 Ga0070692_10060851 3300005345 Bacteria 1989
28 Ga0070659_100684595 3300005366 Bacteria 886
29 Ga0070663_100041763 3300005455 Bacteria 3220
30 Ga0070663_100228780 3300005455 Bacteria 1463
31 Ga0070681_10022242 3300005458 Bacteria 6365
32 Ga0070706_100155949 3300005467 Bacteria 2131
33 Ga0070707_100124883 3300005468 Bacteria 2500
34 Ga0070707_100793235 3300005468 Bacteria 911
35 Ga0070698_100055813 3300005471 Bacteria 4003
36 Ga0070698_100073093 3300005471 Bacteria 3436
37 Ga0070698_100080375 3300005471 Bacteria 3255
38 Ga0070699_100932718 3300005518 Bacteria 795
39 Ga0070679_100009327 3300005530 Bacteria 9278
40 Ga0070697_100001375 3300005536 Bacteria 18441
41 Ga0068853_100016387 3300005539 Bacteria 6098
42 Ga0068853_100080158 3300005539 Bacteria 2856
43 Ga0068853_100084194 3300005539 Bacteria 2786
44 Ga0068853_100370703 3300005539 Bacteria 1335
45 Ga0068855_100098563 3300005563 Bacteria 3366
46 Ga0068857_100109413 3300005577 Bacteria 2483
47 Ga0068854_100352839 3300005578 Unclassified 1204
48 Ga0068852_100269336 3300005616 Bacteria 1638
49 Ga0075433_10161669 3300006852 Bacteria 1993
50 Ga0075436_100125920 3300006914 Bacteria 1795
51 Ga0075436_100330536 3300006914 Unclassified 1096
52 Ga0099823_1001200 3300006944 Bacteria 20678
53 Ga0075435_100435204 3300007076 Bacteria 1130
54 Ga0099794_10001431 3300007265 Bacteria 8337
55 Ga0099794_10001903 3300007265 Bacteria 7487
56 Ga0099794_10048456 3300007265 Bacteria 2039
57 Ga0099794_10188460 3300007265 Bacteria 1054
58 Ga0099794_10539570 3300007265 Bacteria 616
59 Ga0099795_10029838 3300007788 Archaea 1867
60 Ga0105240_10459265 3300009093 Bacteria 1423
61 Ga0105240_10700110 3300009093 Bacteria 1106
62 Ga0105238_10754956 3300009551 Bacteria 987
63 Ga0105249_10301965 3300009553 Unclassified 1606
64 Ga0105148_100241 3300009978 Bacteria 7585
65 Ga0105148_102033 3300009978 Unclassified 1425
66 Ga0105035_111702 3300009988 Unclassified 780
67 Ga0105239_10260094 3300010375 Plasmid 1950
68 Ga0157373_10003280 3300013100 Bacteria 12225
69 Ga0157373_11261574 3300013100 Bacteria 558
70 Ga0157371_10036538 3300013102 Bacteria 3517
71 Ga0157371_10147105 3300013102 Bacteria 1679
72 Ga0157370_10033505 3300013104 Bacteria 5008
73 Ga0157370_10239333 3300013104 Bacteria 1679
74 Ga0157369_10240366 3300013105 Bacteria 1892
75 Ga0157372_10075943 3300013307 Bacteria 3793
76 Ga0157372_10159415 3300013307 Bacteria 2607
77 Ga0157372_10273850 3300013307 Bacteria 1962
78 Ga0157515_138206 3300013875 Unclassified 798
79 Ga0206356_10053802 3300020070 Unclassified 591
80 Ga0206353_10847110 3300020082 Unclassified 1178
81 Ga0154015_1479188 3300020610 Bacteria 1277
82 Ga0209784_100002 3300025224 Bacteria 1753105
83 Ga0209566_100003 3300025225 Bacteria 1753105
84 Ga0209674_100004 3300025226 Bacteria 1753105
85 Ga0209672_100060 3300025228 Bacteria 209438
86 Ga0209147_100073 3300025229 Bacteria 209438
87 Ga0209563_100006 3300025230 Bacteria 1753105
88 Ga0209437_108009 3300025233 Bacteria 1699
89 Ga0209258_100103 3300025242 Bacteria 209438
90 Ga0209677_100003 3300025253 Bacteria 1753105
91 Ga0209148_1001724 3300025254 Bacteria 9577
92 Ga0209455_1000026 3300025272 Bacteria 653778
93 Ga0209455_1000099 3300025272 Bacteria 209438
94 Ga0207680_10431182 3300025903 Unclassified 934
95 Ga0207705_10022416 3300025909 Bacteria 4502
96 Ga0207705_10035704 3300025909 Bacteria 3556
97 Ga0207705_10642879 3300025909 Bacteria 825
98 Ga0207684_10140442 3300025910 Unclassified 2076
99 Ga0207707_10003651 3300025912 Bacteria 13649
100 Ga0207695_10042907 3300025913 Bacteria 4825
101 Ga0207695_10213985 3300025913 Bacteria 1837
102 Ga0207660_10004549 3300025917 Bacteria 9046
103 Ga0207657_10015393 3300025919 Bacteria 7410
104 Ga0207657_10032910 3300025919 Bacteria 4678
105 Ga0207649_10010740 3300025920 Bacteria 5035
106 Ga0207649_10471273 3300025920 Bacteria 951
107 Ga0207652_10003160 3300025921 Bacteria 13722
108 Ga0207646_10078663 3300025922 Bacteria 2948
109 Ga0207646_10131012 3300025922 Unclassified 2257
110 Ga0207646_10654758 3300025922 Bacteria 941
111 Ga0207690_10005133 3300025932 Bacteria 7730
112 Ga0207690_10425573 3300025932 Bacteria 1063
113 Ga0207667_10025068 3300025949 Bacteria 6537
114 Ga0207667_10223246 3300025949 Bacteria 1930
115 Ga0207712_10621531 3300025961 Bacteria 936
116 Ga0207640_10135240 3300025981 Bacteria 1788
117 Ga0207639_10008094 3300026041 Bacteria 7187
118 Ga0207639_10076236 3300026041 Bacteria 2639
119 Ga0207639_10280129 3300026041 Bacteria 1466
120 Ga0207678_10012997 3300026067 Bacteria 7306
121 Ga0207678_10191315 3300026067 Bacteria 1749
122 Ga0207674_10027676 3300026116 Bacteria 5992
123 Ga0209389_1000719 3300027296 Bacteria 20687
124 Ga0209371_1003640 3300027312 Bacteria 7328
125 Ga0209588_1001530 3300027671 Bacteria 6098
126 Ga0209588_1003802 3300027671 Unclassified 4209
127 Ga0209588_1018902 3300027671 Bacteria 2147
128 Ga0209588_1098966 3300027671 Unclassified 939
129 Ga0268256_1003337 3300030500 Bacteria 7328
130 Ga0265332_10000279 3300031238 Bacteria 40299
131 Ga0265332_10124326 3300031238 Bacteria 1083
132 Ga0307408_100012663 3300031548 Bacteria 5593
133 Ga0307408_100033452 3300031548 Bacteria 3592
134 Ga0307408_100547885 3300031548 Bacteria 1020
135 Ga0307405_10032990 3300031731 Bacteria 3067
136 Ga0307406_10015245 3300031901 Bacteria 4443
137 Ga0307412_10026841 3300031911 Bacteria 3585
138 Ga0307416_100079073 3300032002 Bacteria 2770
139 Ga0307411_10077457 3300032005 Bacteria 2276
140 Ga0373941_0052372 3300035115 Unclassified 1302
141 Ga0439466_0014231 3300041411 Bacteria 2900
142 Ga0439460_0109961 3300042461 Bacteria 893
143 Ga0451577_0013966 3300042876 Bacteria 7497
144 Ga0451577_0042449 3300042876 Bacteria 4079
145 Ga0451577_0087475 3300042876 Bacteria 2780
146 Ga0451577_0332038 3300042876 Unclassified 1379
147 Ga0451577_0408888 3300042876 Bacteria 1232
148 Ga0451577_0415394 3300042876 Bacteria 1221
149 Ga0451577_1340228 3300042876 Bacteria 636
150 Ga0451577_1573705 3300042876 Bacteria 580
151 Ga0451577_1613698 3300042876 Bacteria 572
152 Ga0453683_0000669 3300044673 Bacteria 36646
153 Ga0453683_0098121 3300044673 Bacteria 1839
154 Ga0453684_0021059 3300044712 Bacteria 9772
155 Ga0453684_0029971 3300044712 Bacteria 7703
156 Ga0453684_0173250 3300044712 Bacteria 2541
157 Ga0453684_0607796 3300044712 Bacteria 1198
158 Ga0453684_2199670 3300044712 Bacteria 551
159 Ga0451576_0004343 3300045051 Bacteria 18500
160 Ga0451576_0276292 3300045051 Bacteria 1756
161 Ga0495648_0035687 3300046524 Bacteria 3220
162 Ga0495597_0005954 3300046542 Bacteria 6362
163 Ga0495678_211277 3300049459 Bacteria 593
164 Ga0501031_0005751 3300049568 Bacteria 8078
165 Ga0501032_0009559 3300049569 Bacteria 7029
166 Ga0501034_0000215 3300049571 Bacteria 110067
167 Ga0501034_0000353 3300049571 Bacteria 79342
168 Ga0501034_0006861 3300049571 Bacteria 12179
169 Ga0501034_0009598 3300049571 Bacteria 10124
170 Ga0501036_0023675 3300049572 Bacteria 5174
171 Ga0501036_0078768 3300049572 Bacteria 2787
172 Ga0501036_0431837 3300049572 Bacteria 1098
173 Ga0501037_0001190 3300049573 Bacteria 19229
174 Ga0501038_0000071 3300049574 Bacteria 83962
175 Ga0501039_0019330 3300049575 Bacteria 5222
176 Ga0501041_0226056 3300049577 Bacteria 1175
177 Ga0501042_0824473 3300049578 Bacteria 675
178 Ga0501043_0020634 3300049579 Bacteria 5169
179 Ga0501046_0076496 3300049580 Bacteria 2593
180 Ga0501047_0003412 3300049581 Bacteria 15040
181 Ga0501047_1034740 3300049581 Unclassified 634
182 Ga0501071_0358372 3300049587 Bacteria 1110
183 Ga0501075_0108171 3300049591 Bacteria 2114
184 Ga0501223_001021 3300049663 Bacteria 6614
185 Ga0501224_000128 3300049664 Bacteria 8268
186 Ga0501079_0165587 3300049741 Bacteria 1724
187 Ga0501266_007085 3300049763 Bacteria 1400
188 Ga0501282_000087 3300049778 Bacteria 10802
189 Ga0501282_003231 3300049778 Bacteria 1758
190 Ga0501035_0019850 3300049822 Bacteria 6173
191 Ga0501035_0027223 3300049822 Bacteria 5225
192 Ga0501035_0043812 3300049822 Bacteria 4032
193 Ga0501044_0000194 3300049823 Bacteria 76727
194 Ga0501044_0148550 3300049823 Bacteria 2327
195 Ga0501045_0021054 3300049824 Bacteria 4662
196 Ga0501226_000252 3300049853 Bacteria 8190
197 Ga0501226_000736 3300049853 Bacteria 4435
198 nmdc:mga08x19_98086_c1 3300050514 Unclassified 1941
199 Ga0500583_0347187 3300053092 Bacteria 720
200 Ga0501084_0404819 3300054114 Bacteria 1153
201 Ga0530510_0749216 3300061734 Bacteria 745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0415394 Ga0451577_0415394_360_710 109
2 3300042876 Ga0451577_1340228 Ga0451577_1340228_74_433 109
3 3300025903 Ga0207680_10431182 Ga0207680_104311822 111
4 iso_pu_bacteria 2554235132 2554814953 112
5 iso_pu_bacteria 2596583598 2597031218 112
6 iso_pu_bacteria 2596583598 2597032642 112
7 iso_pu_bacteria 2643221579 2643906138 112
8 iso_pu_bacteria 2808606379 2808943185 112
9 iso_pu_bacteria 2823421272 2823426362 112
10 iso_pu_bacteria 2842324504 2842330798 112
11 iso_pu_bacteria 2842324504 2842331888 112
12 iso_pu_bacteria 2842348783 2842353734 112
13 iso_pu_bacteria 2842348783 2842354234 112
14 iso_pu_bacteria 2885266251 2885269243 112
15 iso_pu_bacteria 2901300506 2901305037 112
16 iso_pu_bacteria 2904615490 2904616923 112
17 iso_pu_bacteria 2945961074 2945966181 112
18 iso_pu_bacteria 2961064222 2961067299 112
19 iso_pu_bacteria 8003400568 8003402112 112
20 iso_pu_bacteria 8054285046 8054287509 112
21 2162886012 MBSR1b_contig_5874910 MBSR1b_0271.00003680 116
22 3300001915 JGI24741J21665_1004995 JGI24741J21665_10049953 116
23 3300003316 rootH1_10127924 rootH1_101279243 116
24 3300003320 rootH2_10107875 rootH2_101078753 116
25 3300003322 rootL2_10132783 rootL2_101327832 116
26 3300003323 rootH1_10042758 rootH1_100427586 116
27 3300003751 Ga0055538_1000002 Ga0055538_1000002348 116
28 3300003752 Ga0055539_1000002 Ga0055539_1000002348 116
29 3300003756 Ga0055533_1000004 Ga0055533_1000004348 116
30 3300003758 Ga0055532_1000035 Ga0055532_100003589 116
31 3300003759 Ga0055525_1000002 Ga0055525_1000002348 116
32 3300003760 Ga0055527_1000021 Ga0055527_100002189 116
33 3300003761 Ga0055535_1000012 Ga0055535_100001286 116
34 3300003763 Ga0055529_1000047 Ga0055529_100004789 116
35 3300003763 Ga0055529_1000060 Ga0055529_100006056 116
36 3300003841 Ga0055541_1000002 Ga0055541_1000002495 116
37 3300005327 Ga0070658_10049609 Ga0070658_100496095 116
38 3300005327 Ga0070658_10346843 Ga0070658_103468433 116
39 3300005336 Ga0070680_100013968 Ga0070680_1000139688 116
40 3300005336 Ga0070680_100660743 Ga0070680_1006607432 116
41 3300005339 Ga0070660_100005659 Ga0070660_1000056595 116
42 3300005341 Ga0070691_10056836 Ga0070691_100568362 116
43 3300005341 Ga0070691_10158921 Ga0070691_101589212 116
44 3300005344 Ga0070661_100121556 Ga0070661_1001215563 116
45 3300005344 Ga0070661_100537867 Ga0070661_1005378672 116
46 3300005345 Ga0070692_10055038 Ga0070692_100550383 116
47 3300005345 Ga0070692_10060851 Ga0070692_100608515 116
48 3300005366 Ga0070659_100684595 Ga0070659_1006845952 116
49 3300005455 Ga0070663_100041763 Ga0070663_1000417635 116
50 3300005455 Ga0070663_100228780 Ga0070663_1002287803 116
51 3300005458 Ga0070681_10022242 Ga0070681_100222426 116
52 3300005467 Ga0070706_100155949 Ga0070706_1001559494 116
53 3300005468 Ga0070707_100124883 Ga0070707_1001248835 116
54 3300005468 Ga0070707_100793235 Ga0070707_1007932352 116
55 3300005471 Ga0070698_100055813 Ga0070698_1000558134 116
56 3300005471 Ga0070698_100073093 Ga0070698_1000730936 116
57 3300005471 Ga0070698_100080375 Ga0070698_1000803753 116
58 3300005518 Ga0070699_100932718 Ga0070699_1009327181 116
59 3300005530 Ga0070679_100009327 Ga0070679_1000093278 116
60 3300005536 Ga0070697_100001375 Ga0070697_1000013758 116
61 3300005539 Ga0068853_100016387 Ga0068853_1000163875 116
62 3300005539 Ga0068853_100080158 Ga0068853_1000801583 116
63 3300005539 Ga0068853_100084194 Ga0068853_1000841942 116
64 3300005539 Ga0068853_100370703 Ga0068853_1003707032 116
65 3300005563 Ga0068855_100098563 Ga0068855_1000985633 116
66 3300005577 Ga0068857_100109413 Ga0068857_1001094134 116
67 3300005578 Ga0068854_100352839 Ga0068854_1003528392 116
68 3300005616 Ga0068852_100269336 Ga0068852_1002693363 116
69 3300006852 Ga0075433_10161669 Ga0075433_101616693 116
70 3300006914 Ga0075436_100125920 Ga0075436_1001259203 116
71 3300006914 Ga0075436_100330536 Ga0075436_1003305362 116
72 3300006944 Ga0099823_1001200 Ga0099823_100120017 116
73 3300007076 Ga0075435_100435204 Ga0075435_1004352042 116
74 3300007265 Ga0099794_10001431 Ga0099794_100014319 116
75 3300007265 Ga0099794_10001903 Ga0099794_100019035 116
76 3300007265 Ga0099794_10048456 Ga0099794_100484564 116
77 3300007265 Ga0099794_10188460 Ga0099794_101884602 116
78 3300007265 Ga0099794_10539570 Ga0099794_105395702 116
79 3300007788 Ga0099795_10029838 Ga0099795_100298383 116
80 3300009093 Ga0105240_10459265 Ga0105240_104592652 116
81 3300009093 Ga0105240_10700110 Ga0105240_107001101 116
82 3300009551 Ga0105238_10754956 Ga0105238_107549562 116
83 3300009553 Ga0105249_10301965 Ga0105249_103019652 116
84 3300009978 Ga0105148_100241 Ga0105148_1002412 116
85 3300009978 Ga0105148_102033 Ga0105148_1020333 116
86 3300009988 Ga0105035_111702 Ga0105035_1117022 116
87 3300010375 Ga0105239_10260094 Ga0105239_102600945 116
88 3300013100 Ga0157373_10003280 Ga0157373_100032808 116
89 3300013100 Ga0157373_11261574 Ga0157373_112615741 116
90 3300013102 Ga0157371_10036538 Ga0157371_100365383 116
91 3300013102 Ga0157371_10147105 Ga0157371_101471052 116
92 3300013104 Ga0157370_10033505 Ga0157370_100335055 116
93 3300013104 Ga0157370_10239333 Ga0157370_102393332 116
94 3300013105 Ga0157369_10240366 Ga0157369_102403663 116
95 3300013307 Ga0157372_10075943 Ga0157372_100759433 116
96 3300013307 Ga0157372_10159415 Ga0157372_101594153 116
97 3300013307 Ga0157372_10273850 Ga0157372_102738503 116
98 3300013875 Ga0157515_138206 Ga0157515_1382062 116
99 3300020070 Ga0206356_10053802 Ga0206356_100538021 116
100 3300020082 Ga0206353_10847110 Ga0206353_108471102 116
101 3300020610 Ga0154015_1479188 Ga0154015_14791883 116
102 3300025224 Ga0209784_100002 Ga0209784_100002578 116
103 3300025225 Ga0209566_100003 Ga0209566_100003578 116
104 3300025226 Ga0209674_100004 Ga0209674_100004578 116
105 3300025228 Ga0209672_100060 Ga0209672_10006085 116
106 3300025229 Ga0209147_100073 Ga0209147_10007385 116
107 3300025230 Ga0209563_100006 Ga0209563_100006578 116
108 3300025233 Ga0209437_108009 Ga0209437_1080093 116
109 3300025242 Ga0209258_100103 Ga0209258_10010385 116
110 3300025253 Ga0209677_100003 Ga0209677_100003578 116
111 3300025254 Ga0209148_1001724 Ga0209148_10017246 116
112 3300025272 Ga0209455_1000026 Ga0209455_100002655 116
113 3300025272 Ga0209455_1000099 Ga0209455_100009985 116
114 3300025909 Ga0207705_10022416 Ga0207705_100224163 116
115 3300025909 Ga0207705_10035704 Ga0207705_100357046 116
116 3300025909 Ga0207705_10642879 Ga0207705_106428792 116
117 3300025910 Ga0207684_10140442 Ga0207684_101404423 116
118 3300025912 Ga0207707_10003651 Ga0207707_100036518 116
119 3300025913 Ga0207695_10042907 Ga0207695_100429072 116
120 3300025913 Ga0207695_10213985 Ga0207695_102139853 116
121 3300025917 Ga0207660_10004549 Ga0207660_100045494 116
122 3300025919 Ga0207657_10015393 Ga0207657_100153936 116
123 3300025919 Ga0207657_10032910 Ga0207657_100329107 116
124 3300025920 Ga0207649_10010740 Ga0207649_100107407 116
125 3300025920 Ga0207649_10471273 Ga0207649_104712732 116
126 3300025921 Ga0207652_10003160 Ga0207652_100031605 116
127 3300025922 Ga0207646_10078663 Ga0207646_100786635 116
128 3300025922 Ga0207646_10131012 Ga0207646_101310122 116
129 3300025922 Ga0207646_10654758 Ga0207646_106547582 116
130 3300025932 Ga0207690_10005133 Ga0207690_100051336 116
131 3300025932 Ga0207690_10425573 Ga0207690_104255733 116
132 3300025949 Ga0207667_10025068 Ga0207667_100250688 116
133 3300025949 Ga0207667_10223246 Ga0207667_102232464 116
134 3300025961 Ga0207712_10621531 Ga0207712_106215312 116
135 3300025981 Ga0207640_10135240 Ga0207640_101352402 116
136 3300026041 Ga0207639_10008094 Ga0207639_100080946 116
137 3300026041 Ga0207639_10076236 Ga0207639_100762362 116
138 3300026041 Ga0207639_10280129 Ga0207639_102801292 116
139 3300026067 Ga0207678_10012997 Ga0207678_100129976 116
140 3300026067 Ga0207678_10191315 Ga0207678_101913153 116
141 3300026116 Ga0207674_10027676 Ga0207674_100276766 116
142 3300027296 Ga0209389_1000719 Ga0209389_100071913 116
143 3300027312 Ga0209371_1003640 Ga0209371_10036409 116
144 3300027671 Ga0209588_1001530 Ga0209588_10015304 116
145 3300027671 Ga0209588_1003802 Ga0209588_10038022 116
146 3300027671 Ga0209588_1018902 Ga0209588_10189024 116
147 3300027671 Ga0209588_1098966 Ga0209588_10989661 116
148 3300030500 Ga0268256_1003337 Ga0268256_10033372 116
149 3300031238 Ga0265332_10000279 Ga0265332_100002798 116
150 3300031238 Ga0265332_10124326 Ga0265332_101243262 116
151 3300031548 Ga0307408_100012663 Ga0307408_1000126638 116
152 3300031548 Ga0307408_100033452 Ga0307408_1000334524 116
153 3300031548 Ga0307408_100547885 Ga0307408_1005478852 116
154 3300031731 Ga0307405_10032990 Ga0307405_100329905 116
155 3300031901 Ga0307406_10015245 Ga0307406_100152457 116
156 3300031911 Ga0307412_10026841 Ga0307412_100268412 116
157 3300032002 Ga0307416_100079073 Ga0307416_1000790734 116
158 3300032005 Ga0307411_10077457 Ga0307411_100774574 116
159 3300035115 Ga0373941_0052372 Ga0373941_0052372_376_780 116
160 3300041411 Ga0439466_0014231 Ga0439466_0014231_1797_2150 116
161 3300042461 Ga0439460_0109961 Ga0439460_0109961_470_820 116
162 3300042876 Ga0451577_0013966 Ga0451577_0013966_1608_1958 116
163 3300042876 Ga0451577_0042449 Ga0451577_0042449_3651_4034 116
164 3300042876 Ga0451577_0087475 Ga0451577_0087475_1538_1900 116
165 3300042876 Ga0451577_0332038 Ga0451577_0332038_58_408 116
166 3300042876 Ga0451577_0408888 Ga0451577_0408888_15_365 116
167 3300042876 Ga0451577_1573705 Ga0451577_1573705_11_367 116
168 3300042876 Ga0451577_1613698 Ga0451577_1613698_189_539 116
169 3300044673 Ga0453683_0000669 Ga0453683_0000669_24047_24397 116
170 3300044673 Ga0453683_0098121 Ga0453683_0098121_145_528 116
171 3300044712 Ga0453684_0021059 Ga0453684_0021059_130_480 116
172 3300044712 Ga0453684_0029971 Ga0453684_0029971_2983_3366 116
173 3300044712 Ga0453684_0173250 Ga0453684_0173250_1090_1476 116
174 3300044712 Ga0453684_0607796 Ga0453684_0607796_20_370 116
175 3300044712 Ga0453684_2199670 Ga0453684_2199670_45_395 116
176 3300045051 Ga0451576_0004343 Ga0451576_0004343_2347_2697 116
177 3300045051 Ga0451576_0276292 Ga0451576_0276292_716_1066 116
178 3300046524 Ga0495648_0035687 Ga0495648_0035687_2762_3112 116
179 3300046542 Ga0495597_0005954 Ga0495597_0005954_1562_1912 116
180 3300049459 Ga0495678_211277 Ga0495678_211277_31_381 116
181 3300049568 Ga0501031_0005751 Ga0501031_0005751_4259_4609 116
182 3300049569 Ga0501032_0009559 Ga0501032_0009559_4267_4617 116
183 3300049571 Ga0501034_0000215 Ga0501034_0000215_56317_56667 116
184 3300049571 Ga0501034_0000353 Ga0501034_0000353_75058_75462 116
185 3300049571 Ga0501034_0006861 Ga0501034_0006861_11206_11556 116
186 3300049571 Ga0501034_0009598 Ga0501034_0009598_5517_5867 116
187 3300049572 Ga0501036_0023675 Ga0501036_0023675_4265_4615 116
188 3300049572 Ga0501036_0078768 Ga0501036_0078768_318_683 116
189 3300049572 Ga0501036_0431837 Ga0501036_0431837_304_654 116
190 3300049573 Ga0501037_0001190 Ga0501037_0001190_14702_15052 116
191 3300049574 Ga0501038_0000071 Ga0501038_0000071_4349_4699 116
192 3300049575 Ga0501039_0019330 Ga0501039_0019330_4313_4663 116
193 3300049577 Ga0501041_0226056 Ga0501041_0226056_596_961 116
194 3300049578 Ga0501042_0824473 Ga0501042_0824473_115_480 116
195 3300049579 Ga0501043_0020634 Ga0501043_0020634_4260_4610 116
196 3300049580 Ga0501046_0076496 Ga0501046_0076496_468_818 116
197 3300049581 Ga0501047_0003412 Ga0501047_0003412_10222_10572 116
198 3300049581 Ga0501047_1034740 Ga0501047_1034740_101_505 116
199 3300049587 Ga0501071_0358372 Ga0501071_0358372_197_562 116
200 3300049591 Ga0501075_0108171 Ga0501075_0108171_969_1319 116
201 3300049663 Ga0501223_001021 Ga0501223_001021_837_1187 116
202 3300049664 Ga0501224_000128 Ga0501224_000128_1414_1764 116
203 3300049741 Ga0501079_0165587 Ga0501079_0165587_799_1149 116
204 3300049763 Ga0501266_007085 Ga0501266_007085_165_515 116
205 3300049778 Ga0501282_000087 Ga0501282_000087_6735_7085 116
206 3300049778 Ga0501282_003231 Ga0501282_003231_639_989 116
207 3300049822 Ga0501035_0019850 Ga0501035_0019850_3475_3840 116
208 3300049822 Ga0501035_0027223 Ga0501035_0027223_4316_4666 116
209 3300049822 Ga0501035_0043812 Ga0501035_0043812_432_782 116
210 3300049823 Ga0501044_0000194 Ga0501044_0000194_4321_4671 116
211 3300049823 Ga0501044_0148550 Ga0501044_0148550_1822_2226 116
212 3300049824 Ga0501045_0021054 Ga0501045_0021054_4140_4490 116
213 3300049853 Ga0501226_000252 Ga0501226_000252_1068_1418 116
214 3300049853 Ga0501226_000736 Ga0501226_000736_3328_3678 116
215 3300050514 nmdc:mga08x19_98086_c1 nmdc:mga08x19_98086_c1_610_981 116
216 3300053092 Ga0500583_0347187 Ga0500583_0347187_126_491 116
217 3300054114 Ga0501084_0404819 Ga0501084_0404819_86_451 116
218 3300061734 Ga0530510_0749216 Ga0530510_0749216_220_570 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02411

MerT

MerT mercuric transport protein

2

112

0.97

Feature Viewer

pLDDT pTM Quality
59.14 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map