F329310

General Info

Members Datasets Scaffolds Average Seq Length
217 130 216 164

Family's Representative Sequence

Representative Sequence 3300059646|Ga0587078_040674|Ga0587078_040674_84_644
Length 186
Sequence MVRRLSPGGEPRREEVLIAMALNAYLRLAGNTQGDIKGSVTQKGREDSIMVIAVSHEIVSPRDPASGLPTGKRMHKPFVITKELDKSSPLLYNVLVNNENLKTWELQFWTPQIKAVSGAGTEVQHYTVKLTNANVASIHFRMLNNKNPDLMKYAEFEEIAFTYQKIEWTWTQGGITADDDWESPRS

Samples

Sample ID Description Type Environment
1 3300002864 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300002866 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_15 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003159 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003284 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_16 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
51 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
57 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
58 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
59 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
60 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
61 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
64 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
75 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 26.27
Metatranscriptomes 73.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 1.84
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006764J43180_105799 3300002864 Bacteria 642
2 Ga0006761J43178_104888 3300002865 Bacteria 657
3 Ga0006772J43183_104069 3300002866 Bacteria 654
4 Ga0006763J43179_107613 3300002870 Bacteria 641
5 Ga0006762J43184_105649 3300002872 Bacteria 644
6 Ga0006771J45828_101918 3300003159 Bacteria 679
7 Ga0006765J45826_105193 3300003161 Bacteria 644
8 Ga0006778J45830_1083738 3300003162 Bacteria 641
9 Ga0006773J48901_12652 3300003284 Bacteria 648
10 Ga0006758J48902_1007587 3300003300 Bacteria 645
11 Ga0006770J48903_1004251 3300003305 Bacteria 652
12 Ga0007417J51691_1009428 3300003544 Bacteria 649
13 Ga0007417J51691_1069280 3300003544 Unclassified 552
14 Ga0007410J51695_1007763 3300003574 Bacteria 648
15 Ga0007409J51694_1010044 3300003575 Bacteria 684
16 Ga0007409J51694_1041598 3300003575 Bacteria 608
17 Ga0007416J51690_1007219 3300003577 Bacteria 693
18 Ga0007411J51799_108570 3300003611 Bacteria 648
19 Ga0007415J51800_105604 3300003613 Bacteria 648
20 Ga0032354_1011742 3300003693 Bacteria 648
21 Ga0006766_112619 3300003717 Bacteria 637
22 Ga0058859_11716220 3300004798 Bacteria 858
23 Ga0058859_11725723 3300004798 Bacteria 596
24 Ga0058860_12086511 3300004801 Bacteria 1108
25 Ga0058860_12110496 3300004801 Bacteria 651
26 Ga0070683_101938357 3300005329 Bacteria 566
27 Ga0070694_100129358 3300005444 Bacteria 1822
28 Ga0070706_100096057 3300005467 Bacteria 2751
29 Ga0070707_100303940 3300005468 Bacteria 1550
30 Ga0070698_100024424 3300005471 Bacteria 6307
31 Ga0070699_100522095 3300005518 Bacteria 1080
32 Ga0070697_100562174 3300005536 Bacteria 1001
33 Ga0070695_100252983 3300005545 Bacteria 1283
34 Ga0070704_100138676 3300005549 Bacteria 1896
35 Ga0068861_100779816 3300005719 Bacteria 895
36 Ga0075365_10299748 3300006038 Bacteria 1131
37 Ga0075431_100152224 3300006847 Bacteria 2382
38 Ga0075433_10442114 3300006852 Bacteria 1146
39 Ga0075433_11541948 3300006852 Unclassified 574
40 Ga0075429_100297838 3300006880 Bacteria 1412
41 Ga0075429_101296067 3300006880 Unclassified 635
42 Ga0111539_10558957 3300009094 Bacteria 1333
43 Ga0111539_12611417 3300009094 Bacteria 586
44 Ga0105247_11477965 3300009101 Bacteria 553
45 Ga0114129_11097277 3300009147 Bacteria 997
46 Ga0105243_10003558 3300009148 Bacteria 12579
47 Ga0105242_10083088 3300009176 Bacteria 2681
48 Ga0105249_10329050 3300009553 Bacteria 1541
49 Ga0157379_11297785 3300014968 Bacteria 703
50 Ga0207684_10101869 3300025910 Bacteria 2455
51 Ga0207646_10192039 3300025922 Bacteria 1844
52 Ga0207709_10522093 3300025935 Bacteria 930
53 Ga0207712_10462527 3300025961 Bacteria 1078
54 Ga0207668_10051701 3300025972 Bacteria 2839
55 Ga0207675_100863879 3300026118 Bacteria 920
56 Ga0247548_102313 3300031814 Bacteria 820
57 Ga0326468_10022438 3300031889 Unclassified 768
58 Ga0373956_0401440 3300035119 Unclassified 654
59 Ga0373935_1015431 3300035692 Unclassified 616
60 Ga0373927_0021944 3300035695 Bacteria 4184
61 Ga0265778_002275 3300036457 Bacteria 1838
62 Ga0373925_0057106 3300037068 Bacteria 2925
63 Ga0439465_0146495 3300041413 Bacteria 841
64 Ga0451799_31434 3300041454 Bacteria 573
65 Ga0451805_067618 3300041461 Bacteria 833
66 Ga0452271_13770 3300041916 Bacteria 687
67 Ga0439431_0035449 3300041997 Bacteria 1254
68 Ga0439431_0052461 3300041997 Bacteria 1060
69 Ga0439445_0085162 3300042004 Bacteria 886
70 Ga0439449_0027031 3300042007 Bacteria 2142
71 Ga0439434_0225934 3300042435 Bacteria 636
72 Ga0439434_0243218 3300042435 Bacteria 614
73 Ga0439459_0097276 3300042438 Bacteria 716
74 Ga0496102_1514141 3300048905 Unclassified 589
75 Ga0496110_0129508 3300048913 Bacteria 2278
76 Ga0496121_0650731 3300048924 Bacteria 642
77 Ga0501306_035739 3300049127 Bacteria 755
78 Ga0501306_039446 3300049127 Bacteria 728
79 Ga0501306_054192 3300049127 Bacteria 649
80 Ga0501306_077814 3300049127 Bacteria 568
81 Ga0501309_010593 3300049129 Bacteria 1190
82 Ga0501309_036640 3300049129 Bacteria 739
83 Ga0501309_041325 3300049129 Bacteria 705
84 Ga0501309_043319 3300049129 Unclassified 692
85 Ga0501309_064672 3300049129 Bacteria 593
86 Ga0501310_029268 3300049130 Bacteria 725
87 Ga0501310_042895 3300049130 Bacteria 635
88 Ga0501304_006366 3300049160 Bacteria 951
89 Ga0501305_056648 3300049161 Bacteria 668
90 Ga0501305_059677 3300049161 Bacteria 654
91 Ga0501305_059893 3300049161 Bacteria 653
92 Ga0501305_061954 3300049161 Bacteria 645
93 Ga0501305_064318 3300049161 Bacteria 636
94 Ga0501305_069624 3300049161 Bacteria 617
95 Ga0501305_076562 3300049161 Bacteria 595
96 Ga0501305_080789 3300049161 Bacteria 584
97 Ga0501305_087353 3300049161 Bacteria 567
98 Ga0501307_035694 3300049162 Bacteria 706
99 Ga0501307_042243 3300049162 Bacteria 665
100 Ga0501307_067132 3300049162 Bacteria 566
101 Ga0501290_083459 3300049513 Bacteria 548
102 Ga0501311_043546 3300049527 Bacteria 687
103 Ga0501311_044335 3300049527 Bacteria 682
104 Ga0501312_025733 3300049528 Bacteria 898
105 Ga0501312_072489 3300049528 Bacteria 613
106 Ga0501312_090957 3300049528 Bacteria 563
107 Ga0501313_035966 3300049529 Bacteria 654
108 Ga0501314_018781 3300049530 Bacteria 706
109 Ga0501314_023410 3300049530 Bacteria 655
110 Ga0501315_034689 3300049531 Bacteria 742
111 Ga0501315_042538 3300049531 Unclassified 692
112 Ga0501316_037714 3300049532 Bacteria 665
113 Ga0501317_052407 3300049533 Bacteria 651
114 Ga0501317_067085 3300049533 Bacteria 599
115 Ga0501318_046729 3300049534 Bacteria 633
116 Ga0501318_061924 3300049534 Bacteria 576
117 Ga0501320_035363 3300049536 Bacteria 637
118 Ga0501320_041695 3300049536 Bacteria 603
119 Ga0501320_050401 3300049536 Bacteria 566
120 Ga0501320_059480 3300049536 Bacteria 535
121 Ga0501321_034895 3300049537 Bacteria 687
122 Ga0501321_064664 3300049537 Bacteria 559
123 Ga0501322_010422 3300049538 Bacteria 715
124 Ga0501322_014058 3300049538 Bacteria 651
125 Ga0501322_024152 3300049538 Bacteria 548
126 Ga0501323_056885 3300049539 Bacteria 604
127 Ga0501323_060980 3300049539 Bacteria 589
128 Ga0501324_021741 3300049540 Bacteria 660
129 Ga0501325_017317 3300049541 Bacteria 728
130 Ga0501325_031410 3300049541 Bacteria 610
131 Ga0501325_040305 3300049541 Bacteria 566
132 Ga0501327_10389 3300049543 Bacteria 613
133 Ga0501327_15726 3300049543 Bacteria 537
134 Ga0501333_011966 3300049549 Bacteria 631
135 Ga0501333_012503 3300049549 Bacteria 621
136 Ga0501335_025405 3300049551 Bacteria 649
137 Ga0501340_012955 3300049556 Bacteria 638
138 Ga0501046_0000005 3300049580 Bacteria 394121
139 Ga0501259_092657 3300049688 Bacteria 681
140 nmdc:mga0yw44_265676_c1 3300050492 Bacteria 1144
141 nmdc:mga05p37_1502770_c1 3300050507 Unclassified 670
142 nmdc:mga09592_527593_c1 3300050508 Bacteria 1015
143 nmdc:mga06r32_408833_c1 3300050510 Bacteria 1339
144 nmdc:mga08y16_1560994_c1 3300050511 Bacteria 619
145 nmdc:mga0a205_1177827_c1 3300050515 Unclassified 614
146 Ga0587084_048786 3300059477 Bacteria 743
147 Ga0587084_060849 3300059477 Bacteria 692
148 Ga0587084_069979 3300059477 Bacteria 660
149 Ga0587084_071858 3300059477 Bacteria 655
150 Ga0587084_079480 3300059477 Bacteria 633
151 Ga0587093_015318 3300059478 Bacteria 967
152 Ga0587077_093442 3300059493 Bacteria 711
153 Ga0587077_127572 3300059493 Bacteria 642
154 Ga0587077_141787 3300059493 Bacteria 620
155 Ga0587077_179229 3300059493 Bacteria 573
156 Ga0587080_082404 3300059503 Bacteria 662
157 Ga0587080_096673 3300059503 Bacteria 627
158 Ga0587082_094827 3300059504 Bacteria 642
159 Ga0587083_0179340 3300059505 Bacteria 592
160 Ga0587085_039068 3300059506 Bacteria 818
161 Ga0587085_054707 3300059506 Bacteria 738
162 Ga0587085_145712 3300059506 Bacteria 542
163 Ga0587086_050466 3300059507 Bacteria 669
164 Ga0587086_052240 3300059507 Bacteria 661
165 Ga0587089_049861 3300059509 Bacteria 669
166 Ga0587090_080212 3300059510 Bacteria 652
167 Ga0587091_116441 3300059511 Bacteria 644
168 Ga0587092_056562 3300059512 Bacteria 724
169 Ga0587092_062236 3300059512 Bacteria 701
170 Ga0587094_055272 3300059513 Bacteria 682
171 Ga0587094_058755 3300059513 Bacteria 668
172 Ga0587125_042286 3300059607 Bacteria 619
173 Ga0587101_045168 3300059623 Bacteria 740
174 Ga0587101_055742 3300059623 Bacteria 693
175 Ga0587101_062256 3300059623 Bacteria 669
176 Ga0587101_068510 3300059623 Bacteria 649
177 Ga0587101_069522 3300059623 Bacteria 646
178 Ga0587101_071995 3300059623 Bacteria 639
179 Ga0587101_120386 3300059623 Bacteria 542
180 Ga0587109_052479 3300059624 Bacteria 839
181 Ga0587109_095102 3300059624 Bacteria 677
182 Ga0587109_108120 3300059624 Bacteria 647
183 Ga0587109_141707 3300059624 Bacteria 587
184 Ga0587117_095054 3300059627 Bacteria 561
185 Ga0587127_017414 3300059629 Bacteria 615
186 Ga0587062_012677 3300059639 Bacteria 1085
187 Ga0587062_039799 3300059639 Bacteria 758
188 Ga0587062_050000 3300059639 Bacteria 705
189 Ga0587068_044129 3300059641 Bacteria 815
190 Ga0587068_089365 3300059641 Bacteria 633
191 Ga0587069_076426 3300059642 Bacteria 646
192 Ga0587072_101896 3300059643 Bacteria 645
193 Ga0587072_102283 3300059643 Bacteria 644
194 Ga0587076_104247 3300059645 Bacteria 637
195 Ga0587076_143713 3300059645 Bacteria 573
196 Ga0587078_025151 3300059646 Bacteria 775
197 Ga0587078_039893 3300059646 Bacteria 660
198 Ga0587078_040674 3300059646 Bacteria 656
199 Ga0587078_041284 3300059646 Bacteria 652
200 Ga0587079_115099 3300059647 Bacteria 658
201 Ga0587102_025250 3300059649 Bacteria 696
202 Ga0587102_030259 3300059649 Bacteria 658
203 Ga0587102_045724 3300059649 Bacteria 577
204 Ga0587108_016556 3300059653 Bacteria 672
205 Ga0587124_014418 3300059660 Bacteria 752
206 Ga0587124_021743 3300059660 Bacteria 660
207 Ga0587111_0069476 3300060346 Bacteria 819
208 Ga0587111_0100275 3300060346 Bacteria 720
209 Ga0587111_0107742 3300060346 Bacteria 702
210 Ga0587111_0151291 3300060346 Bacteria 623
211 Ga0587111_0157595 3300060346 Bacteria 615
212 Ga0587111_0165569 3300060346 Bacteria 604
213 Ga0587111_0198053 3300060346 Bacteria 568
214 Ga0587111_0199523 3300060346 Bacteria 566
215 Ga0587111_0204329 3300060346 Bacteria 562
216 Ga0501082_0401571 3300060353 Bacteria 1196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031889 Ga0326468_10022438 Ga0326468_100224382 122
2 3300049536 Ga0501320_041695 Ga0501320_041695_129_560 142
3 3300049538 Ga0501322_010422 Ga0501322_010422_200_628 142
4 3300049549 Ga0501333_012503 Ga0501333_012503_136_564 142
5 3300049534 Ga0501318_061924 Ga0501318_061924_38_469 143
6 3300060346 Ga0587111_0100275 Ga0587111_0100275_152_589 145
7 3300049161 Ga0501305_076562 Ga0501305_076562_60_515 150
8 3300048905 Ga0496102_1514141 Ga0496102_1514141_90_545 151
9 3300048913 Ga0496110_0129508 Ga0496110_0129508_403_858 151
10 3300006852 Ga0075433_10442114 Ga0075433_104421141 157
11 3300041454 Ga0451799_31434 Ga0451799_31434_12_491 159
12 3300049513 Ga0501290_083459 Ga0501290_083459_12_491 159
13 3300059513 Ga0587094_055272 Ga0587094_055272_25_528 159
14 3300059623 Ga0587101_062256 Ga0587101_062256_143_646 159
15 3300059649 Ga0587102_030259 Ga0587102_030259_131_634 159
16 3300005329 Ga0070683_101938357 Ga0070683_1019383571 161
17 3300005444 Ga0070694_100129358 Ga0070694_1001293581 161
18 3300005471 Ga0070698_100024424 Ga0070698_1000244248 161
19 3300005518 Ga0070699_100522095 Ga0070699_1005220951 161
20 3300005536 Ga0070697_100562174 Ga0070697_1005621741 161
21 3300005545 Ga0070695_100252983 Ga0070695_1002529831 161
22 3300005549 Ga0070704_100138676 Ga0070704_1001386763 161
23 3300005719 Ga0068861_100779816 Ga0068861_1007798162 161
24 3300006880 Ga0075429_101296067 Ga0075429_1012960671 161
25 3300009101 Ga0105247_11477965 Ga0105247_114779651 161
26 3300009147 Ga0114129_11097277 Ga0114129_110972772 161
27 3300009148 Ga0105243_10003558 Ga0105243_100035583 161
28 3300009176 Ga0105242_10083088 Ga0105242_100830883 161
29 3300009553 Ga0105249_10329050 Ga0105249_103290502 161
30 3300014968 Ga0157379_11297785 Ga0157379_112977852 161
31 3300025935 Ga0207709_10522093 Ga0207709_105220931 161
32 3300025961 Ga0207712_10462527 Ga0207712_104625271 161
33 3300026118 Ga0207675_100863879 Ga0207675_1008638791 161
34 3300035119 Ga0373956_0401440 Ga0373956_0401440_15_500 161
35 3300035692 Ga0373935_1015431 Ga0373935_1015431_95_580 161
36 3300035695 Ga0373927_0021944 Ga0373927_0021944_1578_2063 161
37 3300037068 Ga0373925_0057106 Ga0373925_0057106_1052_1537 161
38 3300041413 Ga0439465_0146495 Ga0439465_0146495_13_498 161
39 3300041997 Ga0439431_0035449 Ga0439431_0035449_393_878 161
40 3300042007 Ga0439449_0027031 Ga0439449_0027031_78_563 161
41 3300049161 Ga0501305_061954 Ga0501305_061954_59_544 161
42 3300049530 Ga0501314_018781 Ga0501314_018781_71_568 161
43 3300049533 Ga0501317_052407 Ga0501317_052407_36_521 161
44 3300049540 Ga0501324_021741 Ga0501324_021741_150_635 161
45 3300049549 Ga0501333_011966 Ga0501333_011966_37_522 161
46 3300050507 nmdc:mga05p37_1502770_c1 nmdc:mga05p37_1502770_c1_16_501 161
47 3300059623 Ga0587101_069522 Ga0587101_069522_46_531 161
48 3300060346 Ga0587111_0107742 Ga0587111_0107742_174_659 161
49 3300003544 Ga0007417J51691_1069280 Ga0007417J51691_10692801 162
50 3300004798 Ga0058859_11716220 Ga0058859_117162201 162
51 3300004798 Ga0058859_11725723 Ga0058859_117257231 162
52 3300004801 Ga0058860_12086511 Ga0058860_120865111 162
53 3300005467 Ga0070706_100096057 Ga0070706_1000960573 162
54 3300005468 Ga0070707_100303940 Ga0070707_1003039401 162
55 3300009094 Ga0111539_12611417 Ga0111539_126114171 162
56 3300025910 Ga0207684_10101869 Ga0207684_101018692 162
57 3300025922 Ga0207646_10192039 Ga0207646_101920392 162
58 3300031814 Ga0247548_102313 Ga0247548_1023131 162
59 3300036457 Ga0265778_002275 Ga0265778_002275_803_1291 162
60 3300041461 Ga0451805_067618 Ga0451805_067618_194_682 162
61 3300041997 Ga0439431_0052461 Ga0439431_0052461_239_727 162
62 3300042007 Ga0439449_0027031 Ga0439449_0027031_681_1169 162
63 3300042435 Ga0439434_0243218 Ga0439434_0243218_35_523 162
64 3300048924 Ga0496121_0650731 Ga0496121_0650731_86_574 162
65 3300049127 Ga0501306_035739 Ga0501306_035739_213_701 162
66 3300049127 Ga0501306_054192 Ga0501306_054192_146_634 162
67 3300049127 Ga0501306_077814 Ga0501306_077814_55_546 162
68 3300049129 Ga0501309_041325 Ga0501309_041325_72_560 162
69 3300049130 Ga0501310_029268 Ga0501310_029268_151_639 162
70 3300049130 Ga0501310_042895 Ga0501310_042895_55_546 162
71 3300049161 Ga0501305_059677 Ga0501305_059677_140_628 162
72 3300049161 Ga0501305_059893 Ga0501305_059893_144_632 162
73 3300049161 Ga0501305_069624 Ga0501305_069624_53_544 162
74 3300049161 Ga0501305_087353 Ga0501305_087353_34_525 162
75 3300049162 Ga0501307_035694 Ga0501307_035694_146_634 162
76 3300049162 Ga0501307_067132 Ga0501307_067132_53_544 162
77 3300049528 Ga0501312_025733 Ga0501312_025733_55_543 162
78 3300049528 Ga0501312_072489 Ga0501312_072489_105_593 162
79 3300049529 Ga0501313_035966 Ga0501313_035966_21_509 162
80 3300049533 Ga0501317_067085 Ga0501317_067085_80_568 162
81 3300049534 Ga0501318_046729 Ga0501318_046729_130_618 162
82 3300049536 Ga0501320_059480 Ga0501320_059480_24_512 162
83 3300049537 Ga0501321_064664 Ga0501321_064664_53_544 162
84 3300049543 Ga0501327_15726 Ga0501327_15726_39_527 162
85 3300049580 Ga0501046_0000005 Ga0501046_0000005_75458_75946 162
86 3300049688 Ga0501259_092657 Ga0501259_092657_151_642 162
87 3300050511 nmdc:mga08y16_1560994_c1 nmdc:mga08y16_1560994_c1_78_566 162
88 3300059477 Ga0587084_060849 Ga0587084_060849_58_546 162
89 3300059477 Ga0587084_079480 Ga0587084_079480_130_618 162
90 3300059493 Ga0587077_093442 Ga0587077_093442_79_567 162
91 3300059493 Ga0587077_127572 Ga0587077_127572_20_508 162
92 3300059493 Ga0587077_141787 Ga0587077_141787_113_601 162
93 3300059503 Ga0587080_096673 Ga0587080_096673_19_507 162
94 3300059506 Ga0587085_054707 Ga0587085_054707_106_594 162
95 3300059511 Ga0587091_116441 Ga0587091_116441_20_508 162
96 3300059512 Ga0587092_062236 Ga0587092_062236_63_557 162
97 3300059607 Ga0587125_042286 Ga0587125_042286_11_499 162
98 3300059623 Ga0587101_068510 Ga0587101_068510_145_633 162
99 3300059623 Ga0587101_120386 Ga0587101_120386_42_530 162
100 3300059624 Ga0587109_108120 Ga0587109_108120_15_503 162
101 3300059639 Ga0587062_012677 Ga0587062_012677_145_633 162
102 3300059641 Ga0587068_089365 Ga0587068_089365_19_507 162
103 3300059645 Ga0587076_104247 Ga0587076_104247_137_625 162
104 3300059646 Ga0587078_041284 Ga0587078_041284_19_507 162
105 3300059649 Ga0587102_045724 Ga0587102_045724_68_556 162
106 3300059660 Ga0587124_014418 Ga0587124_014418_120_608 162
107 3300060346 Ga0587111_0204329 Ga0587111_0204329_52_540 162
108 3300060353 Ga0501082_0401571 Ga0501082_0401571_689_1180 162
109 3300049543 Ga0501327_10389 Ga0501327_10389_28_534 164
110 3300050515 nmdc:mga0a205_1177827_c1 nmdc:mga0a205_1177827_c1_75_569 164
111 3300049129 Ga0501309_036640 Ga0501309_036640_64_573 165
112 3300049541 Ga0501325_017317 Ga0501325_017317_152_661 165
113 3300006852 Ga0075433_11541948 Ga0075433_115419481 166
114 3300049161 Ga0501305_056648 Ga0501305_056648_143_643 166
115 3300049536 Ga0501320_035363 Ga0501320_035363_20_520 166
116 3300049541 Ga0501325_031410 Ga0501325_031410_92_592 166
117 3300049556 Ga0501340_012955 Ga0501340_012955_17_517 166
118 3300059506 Ga0587085_039068 Ga0587085_039068_137_637 166
119 3300002864 Ga0006764J43180_105799 Ga0006764J43180_1057991 167
120 3300002865 Ga0006761J43178_104888 Ga0006761J43178_1048881 167
121 3300002866 Ga0006772J43183_104069 Ga0006772J43183_1040691 167
122 3300002870 Ga0006763J43179_107613 Ga0006763J43179_1076131 167
123 3300002872 Ga0006762J43184_105649 Ga0006762J43184_1056491 167
124 3300003159 Ga0006771J45828_101918 Ga0006771J45828_1019181 167
125 3300003161 Ga0006765J45826_105193 Ga0006765J45826_1051931 167
126 3300003162 Ga0006778J45830_1083738 Ga0006778J45830_10837381 167
127 3300003284 Ga0006773J48901_12652 Ga0006773J48901_126521 167
128 3300003300 Ga0006758J48902_1007587 Ga0006758J48902_10075871 167
129 3300003305 Ga0006770J48903_1004251 Ga0006770J48903_10042512 167
130 3300003544 Ga0007417J51691_1009428 Ga0007417J51691_10094281 167
131 3300003574 Ga0007410J51695_1007763 Ga0007410J51695_10077631 167
132 3300003575 Ga0007409J51694_1010044 Ga0007409J51694_10100441 167
133 3300003575 Ga0007409J51694_1041598 Ga0007409J51694_10415981 167
134 3300003577 Ga0007416J51690_1007219 Ga0007416J51690_10072191 167
135 3300003611 Ga0007411J51799_108570 Ga0007411J51799_1085701 167
136 3300003613 Ga0007415J51800_105604 Ga0007415J51800_1056041 167
137 3300003693 Ga0032354_1011742 Ga0032354_10117421 167
138 3300003717 Ga0006766_112619 Ga0006766_1126191 167
139 3300004801 Ga0058860_12110496 Ga0058860_121104961 167
140 3300006038 Ga0075365_10299748 Ga0075365_102997482 167
141 3300006847 Ga0075431_100152224 Ga0075431_1001522242 167
142 3300006880 Ga0075429_100297838 Ga0075429_1002978382 167
143 3300009094 Ga0111539_10558957 Ga0111539_105589572 167
144 3300025972 Ga0207668_10051701 Ga0207668_100517012 167
145 3300041916 Ga0452271_13770 Ga0452271_13770_63_566 167
146 3300042004 Ga0439445_0085162 Ga0439445_0085162_274_777 167
147 3300042435 Ga0439434_0225934 Ga0439434_0225934_111_614 167
148 3300042438 Ga0439459_0097276 Ga0439459_0097276_163_666 167
149 3300049127 Ga0501306_039446 Ga0501306_039446_158_661 167
150 3300049129 Ga0501309_010593 Ga0501309_010593_125_628 167
151 3300049129 Ga0501309_043319 Ga0501309_043319_148_651 167
152 3300049129 Ga0501309_064672 Ga0501309_064672_27_530 167
153 3300049160 Ga0501304_006366 Ga0501304_006366_129_632 167
154 3300049161 Ga0501305_064318 Ga0501305_064318_26_529 167
155 3300049161 Ga0501305_080789 Ga0501305_080789_12_515 167
156 3300049162 Ga0501307_042243 Ga0501307_042243_146_652 167
157 3300049527 Ga0501311_043546 Ga0501311_043546_33_536 167
158 3300049527 Ga0501311_044335 Ga0501311_044335_148_651 167
159 3300049528 Ga0501312_090957 Ga0501312_090957_27_530 167
160 3300049530 Ga0501314_023410 Ga0501314_023410_119_622 167
161 3300049531 Ga0501315_034689 Ga0501315_034689_86_589 167
162 3300049531 Ga0501315_042538 Ga0501315_042538_38_541 167
163 3300049532 Ga0501316_037714 Ga0501316_037714_14_517 167
164 3300049536 Ga0501320_050401 Ga0501320_050401_43_546 167
165 3300049537 Ga0501321_034895 Ga0501321_034895_140_643 167
166 3300049538 Ga0501322_014058 Ga0501322_014058_119_622 167
167 3300049538 Ga0501322_024152 Ga0501322_024152_27_530 167
168 3300049539 Ga0501323_056885 Ga0501323_056885_48_551 167
169 3300049539 Ga0501323_060980 Ga0501323_060980_23_526 167
170 3300049541 Ga0501325_040305 Ga0501325_040305_46_549 167
171 3300049551 Ga0501335_025405 Ga0501335_025405_28_531 167
172 3300050492 nmdc:mga0yw44_265676_c1 nmdc:mga0yw44_265676_c1_123_626 167
173 3300050508 nmdc:mga09592_527593_c1 nmdc:mga09592_527593_c1_125_631 167
174 3300050510 nmdc:mga06r32_408833_c1 nmdc:mga06r32_408833_c1_157_663 167
175 3300059477 Ga0587084_048786 Ga0587084_048786_94_597 167
176 3300059477 Ga0587084_069979 Ga0587084_069979_15_518 167
177 3300059477 Ga0587084_071858 Ga0587084_071858_141_644 167
178 3300059478 Ga0587093_015318 Ga0587093_015318_352_855 167
179 3300059493 Ga0587077_179229 Ga0587077_179229_22_525 167
180 3300059503 Ga0587080_082404 Ga0587080_082404_13_516 167
181 3300059504 Ga0587082_094827 Ga0587082_094827_125_628 167
182 3300059505 Ga0587083_0179340 Ga0587083_0179340_14_517 167
183 3300059506 Ga0587085_145712 Ga0587085_145712_28_531 167
184 3300059507 Ga0587086_050466 Ga0587086_050466_20_523 167
185 3300059507 Ga0587086_052240 Ga0587086_052240_144_647 167
186 3300059509 Ga0587089_049861 Ga0587089_049861_20_523 167
187 3300059510 Ga0587090_080212 Ga0587090_080212_21_527 167
188 3300059512 Ga0587092_056562 Ga0587092_056562_82_585 167
189 3300059513 Ga0587094_058755 Ga0587094_058755_19_522 167
190 3300059623 Ga0587101_045168 Ga0587101_045168_72_575 167
191 3300059623 Ga0587101_055742 Ga0587101_055742_130_633 167
192 3300059623 Ga0587101_071995 Ga0587101_071995_124_627 167
193 3300059624 Ga0587109_052479 Ga0587109_052479_140_643 167
194 3300059624 Ga0587109_095102 Ga0587109_095102_10_513 167
195 3300059624 Ga0587109_141707 Ga0587109_141707_71_574 167
196 3300059627 Ga0587117_095054 Ga0587117_095054_46_549 167
197 3300059629 Ga0587127_017414 Ga0587127_017414_100_603 167
198 3300059639 Ga0587062_039799 Ga0587062_039799_117_620 167
199 3300059639 Ga0587062_050000 Ga0587062_050000_148_651 167
200 3300059641 Ga0587068_044129 Ga0587068_044129_181_684 167
201 3300059642 Ga0587069_076426 Ga0587069_076426_12_515 167
202 3300059643 Ga0587072_101896 Ga0587072_101896_127_630 167
203 3300059643 Ga0587072_102283 Ga0587072_102283_113_616 167
204 3300059645 Ga0587076_143713 Ga0587076_143713_20_523 167
205 3300059646 Ga0587078_025151 Ga0587078_025151_130_633 167
206 3300059646 Ga0587078_039893 Ga0587078_039893_15_518 167
207 3300059646 Ga0587078_040674 Ga0587078_040674_84_644 167
208 3300059647 Ga0587079_115099 Ga0587079_115099_11_571 167
209 3300059649 Ga0587102_025250 Ga0587102_025250_144_647 167
210 3300059653 Ga0587108_016556 Ga0587108_016556_135_638 167
211 3300059660 Ga0587124_021743 Ga0587124_021743_28_531 167
212 3300060346 Ga0587111_0069476 Ga0587111_0069476_138_641 167
213 3300060346 Ga0587111_0151291 Ga0587111_0151291_71_574 167
214 3300060346 Ga0587111_0157595 Ga0587111_0157595_19_522 167
215 3300060346 Ga0587111_0165569 Ga0587111_0165569_10_513 167
216 3300060346 Ga0587111_0198053 Ga0587111_0198053_53_556 167
217 3300060346 Ga0587111_0199523 Ga0587111_0199523_14_517 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05638

T6SS_HCP

Type VI secretion system effector, Hcp

25

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hkh-assembly4.cif.gz_E structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.943 2 164
4hkh-assembly3.cif.gz_D structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9394 3 162
4hkh-assembly2.cif.gz_B structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9366 3 162
4hkh-assembly4.cif.gz_E structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9363 2 164
4hkh-assembly6.cif.gz_G structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.9344 3 162
ID Description Score Start End Superfamily
4hkhG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9344 3 162 2.30.110.20
4hkhG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9218 3 162 2.30.110.20
6a2vB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8636 2 162 2.30.110.20
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8616 3 165 2.30.110.20
6a2vB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8584 2 162 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A4U1J104-F1-model_v4 Hcp family type VI secretion system effector 0.9602 1 165
AF-A0A017T387-F1-model_v4 Hcp protein 0.9593 104 167
AF-A0A0H3HZ38-F1-model_v4 Hcp protein 0.9588 56 167
AF-A0A1I7HM62-F1-model_v4 Type VI secretion system secreted protein Hcp 0.9576 1 165
AF-A0A7C3LG11-F1-model_v4 Hcp family type VI secretion system effector 0.9547 2 164

Feature Viewer

pLDDT pTM Quality
90 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map