F329310
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 217 | 130 | 216 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300059646|Ga0587078_040674|Ga0587078_040674_84_644 |
| Length | 186 |
| Sequence | MVRRLSPGGEPRREEVLIAMALNAYLRLAGNTQGDIKGSVTQKGREDSIMVIAVSHEIVSPRDPASGLPTGKRMHKPFVITKELDKSSPLLYNVLVNNENLKTWELQFWTPQIKAVSGAGTEVQHYTVKLTNANVASIHFRMLNNKNPDLMKYAEFEEIAFTYQKIEWTWTQGGITADDDWESPRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002864 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300002865 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300002866 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_15 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003159 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003284 | Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_16 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 50 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 51 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 52 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 53 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 54 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 55 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 56 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 57 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 58 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 59 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 60 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 61 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 62 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 63 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 64 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 65 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 66 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 67 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 68 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 70 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 75 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 94 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 95 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 96 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 97 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 98 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 99 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 100 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 101 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 26.27 |
| Metatranscriptomes | 73.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.92 |
| Nodule | 0 |
| Rhizoplane | 1.84 |
| Rhizosphere | 94.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006764J43180_105799 | 3300002864 | Bacteria | 642 |
| 2 | Ga0006761J43178_104888 | 3300002865 | Bacteria | 657 |
| 3 | Ga0006772J43183_104069 | 3300002866 | Bacteria | 654 |
| 4 | Ga0006763J43179_107613 | 3300002870 | Bacteria | 641 |
| 5 | Ga0006762J43184_105649 | 3300002872 | Bacteria | 644 |
| 6 | Ga0006771J45828_101918 | 3300003159 | Bacteria | 679 |
| 7 | Ga0006765J45826_105193 | 3300003161 | Bacteria | 644 |
| 8 | Ga0006778J45830_1083738 | 3300003162 | Bacteria | 641 |
| 9 | Ga0006773J48901_12652 | 3300003284 | Bacteria | 648 |
| 10 | Ga0006758J48902_1007587 | 3300003300 | Bacteria | 645 |
| 11 | Ga0006770J48903_1004251 | 3300003305 | Bacteria | 652 |
| 12 | Ga0007417J51691_1009428 | 3300003544 | Bacteria | 649 |
| 13 | Ga0007417J51691_1069280 | 3300003544 | Unclassified | 552 |
| 14 | Ga0007410J51695_1007763 | 3300003574 | Bacteria | 648 |
| 15 | Ga0007409J51694_1010044 | 3300003575 | Bacteria | 684 |
| 16 | Ga0007409J51694_1041598 | 3300003575 | Bacteria | 608 |
| 17 | Ga0007416J51690_1007219 | 3300003577 | Bacteria | 693 |
| 18 | Ga0007411J51799_108570 | 3300003611 | Bacteria | 648 |
| 19 | Ga0007415J51800_105604 | 3300003613 | Bacteria | 648 |
| 20 | Ga0032354_1011742 | 3300003693 | Bacteria | 648 |
| 21 | Ga0006766_112619 | 3300003717 | Bacteria | 637 |
| 22 | Ga0058859_11716220 | 3300004798 | Bacteria | 858 |
| 23 | Ga0058859_11725723 | 3300004798 | Bacteria | 596 |
| 24 | Ga0058860_12086511 | 3300004801 | Bacteria | 1108 |
| 25 | Ga0058860_12110496 | 3300004801 | Bacteria | 651 |
| 26 | Ga0070683_101938357 | 3300005329 | Bacteria | 566 |
| 27 | Ga0070694_100129358 | 3300005444 | Bacteria | 1822 |
| 28 | Ga0070706_100096057 | 3300005467 | Bacteria | 2751 |
| 29 | Ga0070707_100303940 | 3300005468 | Bacteria | 1550 |
| 30 | Ga0070698_100024424 | 3300005471 | Bacteria | 6307 |
| 31 | Ga0070699_100522095 | 3300005518 | Bacteria | 1080 |
| 32 | Ga0070697_100562174 | 3300005536 | Bacteria | 1001 |
| 33 | Ga0070695_100252983 | 3300005545 | Bacteria | 1283 |
| 34 | Ga0070704_100138676 | 3300005549 | Bacteria | 1896 |
| 35 | Ga0068861_100779816 | 3300005719 | Bacteria | 895 |
| 36 | Ga0075365_10299748 | 3300006038 | Bacteria | 1131 |
| 37 | Ga0075431_100152224 | 3300006847 | Bacteria | 2382 |
| 38 | Ga0075433_10442114 | 3300006852 | Bacteria | 1146 |
| 39 | Ga0075433_11541948 | 3300006852 | Unclassified | 574 |
| 40 | Ga0075429_100297838 | 3300006880 | Bacteria | 1412 |
| 41 | Ga0075429_101296067 | 3300006880 | Unclassified | 635 |
| 42 | Ga0111539_10558957 | 3300009094 | Bacteria | 1333 |
| 43 | Ga0111539_12611417 | 3300009094 | Bacteria | 586 |
| 44 | Ga0105247_11477965 | 3300009101 | Bacteria | 553 |
| 45 | Ga0114129_11097277 | 3300009147 | Bacteria | 997 |
| 46 | Ga0105243_10003558 | 3300009148 | Bacteria | 12579 |
| 47 | Ga0105242_10083088 | 3300009176 | Bacteria | 2681 |
| 48 | Ga0105249_10329050 | 3300009553 | Bacteria | 1541 |
| 49 | Ga0157379_11297785 | 3300014968 | Bacteria | 703 |
| 50 | Ga0207684_10101869 | 3300025910 | Bacteria | 2455 |
| 51 | Ga0207646_10192039 | 3300025922 | Bacteria | 1844 |
| 52 | Ga0207709_10522093 | 3300025935 | Bacteria | 930 |
| 53 | Ga0207712_10462527 | 3300025961 | Bacteria | 1078 |
| 54 | Ga0207668_10051701 | 3300025972 | Bacteria | 2839 |
| 55 | Ga0207675_100863879 | 3300026118 | Bacteria | 920 |
| 56 | Ga0247548_102313 | 3300031814 | Bacteria | 820 |
| 57 | Ga0326468_10022438 | 3300031889 | Unclassified | 768 |
| 58 | Ga0373956_0401440 | 3300035119 | Unclassified | 654 |
| 59 | Ga0373935_1015431 | 3300035692 | Unclassified | 616 |
| 60 | Ga0373927_0021944 | 3300035695 | Bacteria | 4184 |
| 61 | Ga0265778_002275 | 3300036457 | Bacteria | 1838 |
| 62 | Ga0373925_0057106 | 3300037068 | Bacteria | 2925 |
| 63 | Ga0439465_0146495 | 3300041413 | Bacteria | 841 |
| 64 | Ga0451799_31434 | 3300041454 | Bacteria | 573 |
| 65 | Ga0451805_067618 | 3300041461 | Bacteria | 833 |
| 66 | Ga0452271_13770 | 3300041916 | Bacteria | 687 |
| 67 | Ga0439431_0035449 | 3300041997 | Bacteria | 1254 |
| 68 | Ga0439431_0052461 | 3300041997 | Bacteria | 1060 |
| 69 | Ga0439445_0085162 | 3300042004 | Bacteria | 886 |
| 70 | Ga0439449_0027031 | 3300042007 | Bacteria | 2142 |
| 71 | Ga0439434_0225934 | 3300042435 | Bacteria | 636 |
| 72 | Ga0439434_0243218 | 3300042435 | Bacteria | 614 |
| 73 | Ga0439459_0097276 | 3300042438 | Bacteria | 716 |
| 74 | Ga0496102_1514141 | 3300048905 | Unclassified | 589 |
| 75 | Ga0496110_0129508 | 3300048913 | Bacteria | 2278 |
| 76 | Ga0496121_0650731 | 3300048924 | Bacteria | 642 |
| 77 | Ga0501306_035739 | 3300049127 | Bacteria | 755 |
| 78 | Ga0501306_039446 | 3300049127 | Bacteria | 728 |
| 79 | Ga0501306_054192 | 3300049127 | Bacteria | 649 |
| 80 | Ga0501306_077814 | 3300049127 | Bacteria | 568 |
| 81 | Ga0501309_010593 | 3300049129 | Bacteria | 1190 |
| 82 | Ga0501309_036640 | 3300049129 | Bacteria | 739 |
| 83 | Ga0501309_041325 | 3300049129 | Bacteria | 705 |
| 84 | Ga0501309_043319 | 3300049129 | Unclassified | 692 |
| 85 | Ga0501309_064672 | 3300049129 | Bacteria | 593 |
| 86 | Ga0501310_029268 | 3300049130 | Bacteria | 725 |
| 87 | Ga0501310_042895 | 3300049130 | Bacteria | 635 |
| 88 | Ga0501304_006366 | 3300049160 | Bacteria | 951 |
| 89 | Ga0501305_056648 | 3300049161 | Bacteria | 668 |
| 90 | Ga0501305_059677 | 3300049161 | Bacteria | 654 |
| 91 | Ga0501305_059893 | 3300049161 | Bacteria | 653 |
| 92 | Ga0501305_061954 | 3300049161 | Bacteria | 645 |
| 93 | Ga0501305_064318 | 3300049161 | Bacteria | 636 |
| 94 | Ga0501305_069624 | 3300049161 | Bacteria | 617 |
| 95 | Ga0501305_076562 | 3300049161 | Bacteria | 595 |
| 96 | Ga0501305_080789 | 3300049161 | Bacteria | 584 |
| 97 | Ga0501305_087353 | 3300049161 | Bacteria | 567 |
| 98 | Ga0501307_035694 | 3300049162 | Bacteria | 706 |
| 99 | Ga0501307_042243 | 3300049162 | Bacteria | 665 |
| 100 | Ga0501307_067132 | 3300049162 | Bacteria | 566 |
| 101 | Ga0501290_083459 | 3300049513 | Bacteria | 548 |
| 102 | Ga0501311_043546 | 3300049527 | Bacteria | 687 |
| 103 | Ga0501311_044335 | 3300049527 | Bacteria | 682 |
| 104 | Ga0501312_025733 | 3300049528 | Bacteria | 898 |
| 105 | Ga0501312_072489 | 3300049528 | Bacteria | 613 |
| 106 | Ga0501312_090957 | 3300049528 | Bacteria | 563 |
| 107 | Ga0501313_035966 | 3300049529 | Bacteria | 654 |
| 108 | Ga0501314_018781 | 3300049530 | Bacteria | 706 |
| 109 | Ga0501314_023410 | 3300049530 | Bacteria | 655 |
| 110 | Ga0501315_034689 | 3300049531 | Bacteria | 742 |
| 111 | Ga0501315_042538 | 3300049531 | Unclassified | 692 |
| 112 | Ga0501316_037714 | 3300049532 | Bacteria | 665 |
| 113 | Ga0501317_052407 | 3300049533 | Bacteria | 651 |
| 114 | Ga0501317_067085 | 3300049533 | Bacteria | 599 |
| 115 | Ga0501318_046729 | 3300049534 | Bacteria | 633 |
| 116 | Ga0501318_061924 | 3300049534 | Bacteria | 576 |
| 117 | Ga0501320_035363 | 3300049536 | Bacteria | 637 |
| 118 | Ga0501320_041695 | 3300049536 | Bacteria | 603 |
| 119 | Ga0501320_050401 | 3300049536 | Bacteria | 566 |
| 120 | Ga0501320_059480 | 3300049536 | Bacteria | 535 |
| 121 | Ga0501321_034895 | 3300049537 | Bacteria | 687 |
| 122 | Ga0501321_064664 | 3300049537 | Bacteria | 559 |
| 123 | Ga0501322_010422 | 3300049538 | Bacteria | 715 |
| 124 | Ga0501322_014058 | 3300049538 | Bacteria | 651 |
| 125 | Ga0501322_024152 | 3300049538 | Bacteria | 548 |
| 126 | Ga0501323_056885 | 3300049539 | Bacteria | 604 |
| 127 | Ga0501323_060980 | 3300049539 | Bacteria | 589 |
| 128 | Ga0501324_021741 | 3300049540 | Bacteria | 660 |
| 129 | Ga0501325_017317 | 3300049541 | Bacteria | 728 |
| 130 | Ga0501325_031410 | 3300049541 | Bacteria | 610 |
| 131 | Ga0501325_040305 | 3300049541 | Bacteria | 566 |
| 132 | Ga0501327_10389 | 3300049543 | Bacteria | 613 |
| 133 | Ga0501327_15726 | 3300049543 | Bacteria | 537 |
| 134 | Ga0501333_011966 | 3300049549 | Bacteria | 631 |
| 135 | Ga0501333_012503 | 3300049549 | Bacteria | 621 |
| 136 | Ga0501335_025405 | 3300049551 | Bacteria | 649 |
| 137 | Ga0501340_012955 | 3300049556 | Bacteria | 638 |
| 138 | Ga0501046_0000005 | 3300049580 | Bacteria | 394121 |
| 139 | Ga0501259_092657 | 3300049688 | Bacteria | 681 |
| 140 | nmdc:mga0yw44_265676_c1 | 3300050492 | Bacteria | 1144 |
| 141 | nmdc:mga05p37_1502770_c1 | 3300050507 | Unclassified | 670 |
| 142 | nmdc:mga09592_527593_c1 | 3300050508 | Bacteria | 1015 |
| 143 | nmdc:mga06r32_408833_c1 | 3300050510 | Bacteria | 1339 |
| 144 | nmdc:mga08y16_1560994_c1 | 3300050511 | Bacteria | 619 |
| 145 | nmdc:mga0a205_1177827_c1 | 3300050515 | Unclassified | 614 |
| 146 | Ga0587084_048786 | 3300059477 | Bacteria | 743 |
| 147 | Ga0587084_060849 | 3300059477 | Bacteria | 692 |
| 148 | Ga0587084_069979 | 3300059477 | Bacteria | 660 |
| 149 | Ga0587084_071858 | 3300059477 | Bacteria | 655 |
| 150 | Ga0587084_079480 | 3300059477 | Bacteria | 633 |
| 151 | Ga0587093_015318 | 3300059478 | Bacteria | 967 |
| 152 | Ga0587077_093442 | 3300059493 | Bacteria | 711 |
| 153 | Ga0587077_127572 | 3300059493 | Bacteria | 642 |
| 154 | Ga0587077_141787 | 3300059493 | Bacteria | 620 |
| 155 | Ga0587077_179229 | 3300059493 | Bacteria | 573 |
| 156 | Ga0587080_082404 | 3300059503 | Bacteria | 662 |
| 157 | Ga0587080_096673 | 3300059503 | Bacteria | 627 |
| 158 | Ga0587082_094827 | 3300059504 | Bacteria | 642 |
| 159 | Ga0587083_0179340 | 3300059505 | Bacteria | 592 |
| 160 | Ga0587085_039068 | 3300059506 | Bacteria | 818 |
| 161 | Ga0587085_054707 | 3300059506 | Bacteria | 738 |
| 162 | Ga0587085_145712 | 3300059506 | Bacteria | 542 |
| 163 | Ga0587086_050466 | 3300059507 | Bacteria | 669 |
| 164 | Ga0587086_052240 | 3300059507 | Bacteria | 661 |
| 165 | Ga0587089_049861 | 3300059509 | Bacteria | 669 |
| 166 | Ga0587090_080212 | 3300059510 | Bacteria | 652 |
| 167 | Ga0587091_116441 | 3300059511 | Bacteria | 644 |
| 168 | Ga0587092_056562 | 3300059512 | Bacteria | 724 |
| 169 | Ga0587092_062236 | 3300059512 | Bacteria | 701 |
| 170 | Ga0587094_055272 | 3300059513 | Bacteria | 682 |
| 171 | Ga0587094_058755 | 3300059513 | Bacteria | 668 |
| 172 | Ga0587125_042286 | 3300059607 | Bacteria | 619 |
| 173 | Ga0587101_045168 | 3300059623 | Bacteria | 740 |
| 174 | Ga0587101_055742 | 3300059623 | Bacteria | 693 |
| 175 | Ga0587101_062256 | 3300059623 | Bacteria | 669 |
| 176 | Ga0587101_068510 | 3300059623 | Bacteria | 649 |
| 177 | Ga0587101_069522 | 3300059623 | Bacteria | 646 |
| 178 | Ga0587101_071995 | 3300059623 | Bacteria | 639 |
| 179 | Ga0587101_120386 | 3300059623 | Bacteria | 542 |
| 180 | Ga0587109_052479 | 3300059624 | Bacteria | 839 |
| 181 | Ga0587109_095102 | 3300059624 | Bacteria | 677 |
| 182 | Ga0587109_108120 | 3300059624 | Bacteria | 647 |
| 183 | Ga0587109_141707 | 3300059624 | Bacteria | 587 |
| 184 | Ga0587117_095054 | 3300059627 | Bacteria | 561 |
| 185 | Ga0587127_017414 | 3300059629 | Bacteria | 615 |
| 186 | Ga0587062_012677 | 3300059639 | Bacteria | 1085 |
| 187 | Ga0587062_039799 | 3300059639 | Bacteria | 758 |
| 188 | Ga0587062_050000 | 3300059639 | Bacteria | 705 |
| 189 | Ga0587068_044129 | 3300059641 | Bacteria | 815 |
| 190 | Ga0587068_089365 | 3300059641 | Bacteria | 633 |
| 191 | Ga0587069_076426 | 3300059642 | Bacteria | 646 |
| 192 | Ga0587072_101896 | 3300059643 | Bacteria | 645 |
| 193 | Ga0587072_102283 | 3300059643 | Bacteria | 644 |
| 194 | Ga0587076_104247 | 3300059645 | Bacteria | 637 |
| 195 | Ga0587076_143713 | 3300059645 | Bacteria | 573 |
| 196 | Ga0587078_025151 | 3300059646 | Bacteria | 775 |
| 197 | Ga0587078_039893 | 3300059646 | Bacteria | 660 |
| 198 | Ga0587078_040674 | 3300059646 | Bacteria | 656 |
| 199 | Ga0587078_041284 | 3300059646 | Bacteria | 652 |
| 200 | Ga0587079_115099 | 3300059647 | Bacteria | 658 |
| 201 | Ga0587102_025250 | 3300059649 | Bacteria | 696 |
| 202 | Ga0587102_030259 | 3300059649 | Bacteria | 658 |
| 203 | Ga0587102_045724 | 3300059649 | Bacteria | 577 |
| 204 | Ga0587108_016556 | 3300059653 | Bacteria | 672 |
| 205 | Ga0587124_014418 | 3300059660 | Bacteria | 752 |
| 206 | Ga0587124_021743 | 3300059660 | Bacteria | 660 |
| 207 | Ga0587111_0069476 | 3300060346 | Bacteria | 819 |
| 208 | Ga0587111_0100275 | 3300060346 | Bacteria | 720 |
| 209 | Ga0587111_0107742 | 3300060346 | Bacteria | 702 |
| 210 | Ga0587111_0151291 | 3300060346 | Bacteria | 623 |
| 211 | Ga0587111_0157595 | 3300060346 | Bacteria | 615 |
| 212 | Ga0587111_0165569 | 3300060346 | Bacteria | 604 |
| 213 | Ga0587111_0198053 | 3300060346 | Bacteria | 568 |
| 214 | Ga0587111_0199523 | 3300060346 | Bacteria | 566 |
| 215 | Ga0587111_0204329 | 3300060346 | Bacteria | 562 |
| 216 | Ga0501082_0401571 | 3300060353 | Bacteria | 1196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031889 | Ga0326468_10022438 | Ga0326468_100224382 | 122 |
| 2 | 3300049536 | Ga0501320_041695 | Ga0501320_041695_129_560 | 142 |
| 3 | 3300049538 | Ga0501322_010422 | Ga0501322_010422_200_628 | 142 |
| 4 | 3300049549 | Ga0501333_012503 | Ga0501333_012503_136_564 | 142 |
| 5 | 3300049534 | Ga0501318_061924 | Ga0501318_061924_38_469 | 143 |
| 6 | 3300060346 | Ga0587111_0100275 | Ga0587111_0100275_152_589 | 145 |
| 7 | 3300049161 | Ga0501305_076562 | Ga0501305_076562_60_515 | 150 |
| 8 | 3300048905 | Ga0496102_1514141 | Ga0496102_1514141_90_545 | 151 |
| 9 | 3300048913 | Ga0496110_0129508 | Ga0496110_0129508_403_858 | 151 |
| 10 | 3300006852 | Ga0075433_10442114 | Ga0075433_104421141 | 157 |
| 11 | 3300041454 | Ga0451799_31434 | Ga0451799_31434_12_491 | 159 |
| 12 | 3300049513 | Ga0501290_083459 | Ga0501290_083459_12_491 | 159 |
| 13 | 3300059513 | Ga0587094_055272 | Ga0587094_055272_25_528 | 159 |
| 14 | 3300059623 | Ga0587101_062256 | Ga0587101_062256_143_646 | 159 |
| 15 | 3300059649 | Ga0587102_030259 | Ga0587102_030259_131_634 | 159 |
| 16 | 3300005329 | Ga0070683_101938357 | Ga0070683_1019383571 | 161 |
| 17 | 3300005444 | Ga0070694_100129358 | Ga0070694_1001293581 | 161 |
| 18 | 3300005471 | Ga0070698_100024424 | Ga0070698_1000244248 | 161 |
| 19 | 3300005518 | Ga0070699_100522095 | Ga0070699_1005220951 | 161 |
| 20 | 3300005536 | Ga0070697_100562174 | Ga0070697_1005621741 | 161 |
| 21 | 3300005545 | Ga0070695_100252983 | Ga0070695_1002529831 | 161 |
| 22 | 3300005549 | Ga0070704_100138676 | Ga0070704_1001386763 | 161 |
| 23 | 3300005719 | Ga0068861_100779816 | Ga0068861_1007798162 | 161 |
| 24 | 3300006880 | Ga0075429_101296067 | Ga0075429_1012960671 | 161 |
| 25 | 3300009101 | Ga0105247_11477965 | Ga0105247_114779651 | 161 |
| 26 | 3300009147 | Ga0114129_11097277 | Ga0114129_110972772 | 161 |
| 27 | 3300009148 | Ga0105243_10003558 | Ga0105243_100035583 | 161 |
| 28 | 3300009176 | Ga0105242_10083088 | Ga0105242_100830883 | 161 |
| 29 | 3300009553 | Ga0105249_10329050 | Ga0105249_103290502 | 161 |
| 30 | 3300014968 | Ga0157379_11297785 | Ga0157379_112977852 | 161 |
| 31 | 3300025935 | Ga0207709_10522093 | Ga0207709_105220931 | 161 |
| 32 | 3300025961 | Ga0207712_10462527 | Ga0207712_104625271 | 161 |
| 33 | 3300026118 | Ga0207675_100863879 | Ga0207675_1008638791 | 161 |
| 34 | 3300035119 | Ga0373956_0401440 | Ga0373956_0401440_15_500 | 161 |
| 35 | 3300035692 | Ga0373935_1015431 | Ga0373935_1015431_95_580 | 161 |
| 36 | 3300035695 | Ga0373927_0021944 | Ga0373927_0021944_1578_2063 | 161 |
| 37 | 3300037068 | Ga0373925_0057106 | Ga0373925_0057106_1052_1537 | 161 |
| 38 | 3300041413 | Ga0439465_0146495 | Ga0439465_0146495_13_498 | 161 |
| 39 | 3300041997 | Ga0439431_0035449 | Ga0439431_0035449_393_878 | 161 |
| 40 | 3300042007 | Ga0439449_0027031 | Ga0439449_0027031_78_563 | 161 |
| 41 | 3300049161 | Ga0501305_061954 | Ga0501305_061954_59_544 | 161 |
| 42 | 3300049530 | Ga0501314_018781 | Ga0501314_018781_71_568 | 161 |
| 43 | 3300049533 | Ga0501317_052407 | Ga0501317_052407_36_521 | 161 |
| 44 | 3300049540 | Ga0501324_021741 | Ga0501324_021741_150_635 | 161 |
| 45 | 3300049549 | Ga0501333_011966 | Ga0501333_011966_37_522 | 161 |
| 46 | 3300050507 | nmdc:mga05p37_1502770_c1 | nmdc:mga05p37_1502770_c1_16_501 | 161 |
| 47 | 3300059623 | Ga0587101_069522 | Ga0587101_069522_46_531 | 161 |
| 48 | 3300060346 | Ga0587111_0107742 | Ga0587111_0107742_174_659 | 161 |
| 49 | 3300003544 | Ga0007417J51691_1069280 | Ga0007417J51691_10692801 | 162 |
| 50 | 3300004798 | Ga0058859_11716220 | Ga0058859_117162201 | 162 |
| 51 | 3300004798 | Ga0058859_11725723 | Ga0058859_117257231 | 162 |
| 52 | 3300004801 | Ga0058860_12086511 | Ga0058860_120865111 | 162 |
| 53 | 3300005467 | Ga0070706_100096057 | Ga0070706_1000960573 | 162 |
| 54 | 3300005468 | Ga0070707_100303940 | Ga0070707_1003039401 | 162 |
| 55 | 3300009094 | Ga0111539_12611417 | Ga0111539_126114171 | 162 |
| 56 | 3300025910 | Ga0207684_10101869 | Ga0207684_101018692 | 162 |
| 57 | 3300025922 | Ga0207646_10192039 | Ga0207646_101920392 | 162 |
| 58 | 3300031814 | Ga0247548_102313 | Ga0247548_1023131 | 162 |
| 59 | 3300036457 | Ga0265778_002275 | Ga0265778_002275_803_1291 | 162 |
| 60 | 3300041461 | Ga0451805_067618 | Ga0451805_067618_194_682 | 162 |
| 61 | 3300041997 | Ga0439431_0052461 | Ga0439431_0052461_239_727 | 162 |
| 62 | 3300042007 | Ga0439449_0027031 | Ga0439449_0027031_681_1169 | 162 |
| 63 | 3300042435 | Ga0439434_0243218 | Ga0439434_0243218_35_523 | 162 |
| 64 | 3300048924 | Ga0496121_0650731 | Ga0496121_0650731_86_574 | 162 |
| 65 | 3300049127 | Ga0501306_035739 | Ga0501306_035739_213_701 | 162 |
| 66 | 3300049127 | Ga0501306_054192 | Ga0501306_054192_146_634 | 162 |
| 67 | 3300049127 | Ga0501306_077814 | Ga0501306_077814_55_546 | 162 |
| 68 | 3300049129 | Ga0501309_041325 | Ga0501309_041325_72_560 | 162 |
| 69 | 3300049130 | Ga0501310_029268 | Ga0501310_029268_151_639 | 162 |
| 70 | 3300049130 | Ga0501310_042895 | Ga0501310_042895_55_546 | 162 |
| 71 | 3300049161 | Ga0501305_059677 | Ga0501305_059677_140_628 | 162 |
| 72 | 3300049161 | Ga0501305_059893 | Ga0501305_059893_144_632 | 162 |
| 73 | 3300049161 | Ga0501305_069624 | Ga0501305_069624_53_544 | 162 |
| 74 | 3300049161 | Ga0501305_087353 | Ga0501305_087353_34_525 | 162 |
| 75 | 3300049162 | Ga0501307_035694 | Ga0501307_035694_146_634 | 162 |
| 76 | 3300049162 | Ga0501307_067132 | Ga0501307_067132_53_544 | 162 |
| 77 | 3300049528 | Ga0501312_025733 | Ga0501312_025733_55_543 | 162 |
| 78 | 3300049528 | Ga0501312_072489 | Ga0501312_072489_105_593 | 162 |
| 79 | 3300049529 | Ga0501313_035966 | Ga0501313_035966_21_509 | 162 |
| 80 | 3300049533 | Ga0501317_067085 | Ga0501317_067085_80_568 | 162 |
| 81 | 3300049534 | Ga0501318_046729 | Ga0501318_046729_130_618 | 162 |
| 82 | 3300049536 | Ga0501320_059480 | Ga0501320_059480_24_512 | 162 |
| 83 | 3300049537 | Ga0501321_064664 | Ga0501321_064664_53_544 | 162 |
| 84 | 3300049543 | Ga0501327_15726 | Ga0501327_15726_39_527 | 162 |
| 85 | 3300049580 | Ga0501046_0000005 | Ga0501046_0000005_75458_75946 | 162 |
| 86 | 3300049688 | Ga0501259_092657 | Ga0501259_092657_151_642 | 162 |
| 87 | 3300050511 | nmdc:mga08y16_1560994_c1 | nmdc:mga08y16_1560994_c1_78_566 | 162 |
| 88 | 3300059477 | Ga0587084_060849 | Ga0587084_060849_58_546 | 162 |
| 89 | 3300059477 | Ga0587084_079480 | Ga0587084_079480_130_618 | 162 |
| 90 | 3300059493 | Ga0587077_093442 | Ga0587077_093442_79_567 | 162 |
| 91 | 3300059493 | Ga0587077_127572 | Ga0587077_127572_20_508 | 162 |
| 92 | 3300059493 | Ga0587077_141787 | Ga0587077_141787_113_601 | 162 |
| 93 | 3300059503 | Ga0587080_096673 | Ga0587080_096673_19_507 | 162 |
| 94 | 3300059506 | Ga0587085_054707 | Ga0587085_054707_106_594 | 162 |
| 95 | 3300059511 | Ga0587091_116441 | Ga0587091_116441_20_508 | 162 |
| 96 | 3300059512 | Ga0587092_062236 | Ga0587092_062236_63_557 | 162 |
| 97 | 3300059607 | Ga0587125_042286 | Ga0587125_042286_11_499 | 162 |
| 98 | 3300059623 | Ga0587101_068510 | Ga0587101_068510_145_633 | 162 |
| 99 | 3300059623 | Ga0587101_120386 | Ga0587101_120386_42_530 | 162 |
| 100 | 3300059624 | Ga0587109_108120 | Ga0587109_108120_15_503 | 162 |
| 101 | 3300059639 | Ga0587062_012677 | Ga0587062_012677_145_633 | 162 |
| 102 | 3300059641 | Ga0587068_089365 | Ga0587068_089365_19_507 | 162 |
| 103 | 3300059645 | Ga0587076_104247 | Ga0587076_104247_137_625 | 162 |
| 104 | 3300059646 | Ga0587078_041284 | Ga0587078_041284_19_507 | 162 |
| 105 | 3300059649 | Ga0587102_045724 | Ga0587102_045724_68_556 | 162 |
| 106 | 3300059660 | Ga0587124_014418 | Ga0587124_014418_120_608 | 162 |
| 107 | 3300060346 | Ga0587111_0204329 | Ga0587111_0204329_52_540 | 162 |
| 108 | 3300060353 | Ga0501082_0401571 | Ga0501082_0401571_689_1180 | 162 |
| 109 | 3300049543 | Ga0501327_10389 | Ga0501327_10389_28_534 | 164 |
| 110 | 3300050515 | nmdc:mga0a205_1177827_c1 | nmdc:mga0a205_1177827_c1_75_569 | 164 |
| 111 | 3300049129 | Ga0501309_036640 | Ga0501309_036640_64_573 | 165 |
| 112 | 3300049541 | Ga0501325_017317 | Ga0501325_017317_152_661 | 165 |
| 113 | 3300006852 | Ga0075433_11541948 | Ga0075433_115419481 | 166 |
| 114 | 3300049161 | Ga0501305_056648 | Ga0501305_056648_143_643 | 166 |
| 115 | 3300049536 | Ga0501320_035363 | Ga0501320_035363_20_520 | 166 |
| 116 | 3300049541 | Ga0501325_031410 | Ga0501325_031410_92_592 | 166 |
| 117 | 3300049556 | Ga0501340_012955 | Ga0501340_012955_17_517 | 166 |
| 118 | 3300059506 | Ga0587085_039068 | Ga0587085_039068_137_637 | 166 |
| 119 | 3300002864 | Ga0006764J43180_105799 | Ga0006764J43180_1057991 | 167 |
| 120 | 3300002865 | Ga0006761J43178_104888 | Ga0006761J43178_1048881 | 167 |
| 121 | 3300002866 | Ga0006772J43183_104069 | Ga0006772J43183_1040691 | 167 |
| 122 | 3300002870 | Ga0006763J43179_107613 | Ga0006763J43179_1076131 | 167 |
| 123 | 3300002872 | Ga0006762J43184_105649 | Ga0006762J43184_1056491 | 167 |
| 124 | 3300003159 | Ga0006771J45828_101918 | Ga0006771J45828_1019181 | 167 |
| 125 | 3300003161 | Ga0006765J45826_105193 | Ga0006765J45826_1051931 | 167 |
| 126 | 3300003162 | Ga0006778J45830_1083738 | Ga0006778J45830_10837381 | 167 |
| 127 | 3300003284 | Ga0006773J48901_12652 | Ga0006773J48901_126521 | 167 |
| 128 | 3300003300 | Ga0006758J48902_1007587 | Ga0006758J48902_10075871 | 167 |
| 129 | 3300003305 | Ga0006770J48903_1004251 | Ga0006770J48903_10042512 | 167 |
| 130 | 3300003544 | Ga0007417J51691_1009428 | Ga0007417J51691_10094281 | 167 |
| 131 | 3300003574 | Ga0007410J51695_1007763 | Ga0007410J51695_10077631 | 167 |
| 132 | 3300003575 | Ga0007409J51694_1010044 | Ga0007409J51694_10100441 | 167 |
| 133 | 3300003575 | Ga0007409J51694_1041598 | Ga0007409J51694_10415981 | 167 |
| 134 | 3300003577 | Ga0007416J51690_1007219 | Ga0007416J51690_10072191 | 167 |
| 135 | 3300003611 | Ga0007411J51799_108570 | Ga0007411J51799_1085701 | 167 |
| 136 | 3300003613 | Ga0007415J51800_105604 | Ga0007415J51800_1056041 | 167 |
| 137 | 3300003693 | Ga0032354_1011742 | Ga0032354_10117421 | 167 |
| 138 | 3300003717 | Ga0006766_112619 | Ga0006766_1126191 | 167 |
| 139 | 3300004801 | Ga0058860_12110496 | Ga0058860_121104961 | 167 |
| 140 | 3300006038 | Ga0075365_10299748 | Ga0075365_102997482 | 167 |
| 141 | 3300006847 | Ga0075431_100152224 | Ga0075431_1001522242 | 167 |
| 142 | 3300006880 | Ga0075429_100297838 | Ga0075429_1002978382 | 167 |
| 143 | 3300009094 | Ga0111539_10558957 | Ga0111539_105589572 | 167 |
| 144 | 3300025972 | Ga0207668_10051701 | Ga0207668_100517012 | 167 |
| 145 | 3300041916 | Ga0452271_13770 | Ga0452271_13770_63_566 | 167 |
| 146 | 3300042004 | Ga0439445_0085162 | Ga0439445_0085162_274_777 | 167 |
| 147 | 3300042435 | Ga0439434_0225934 | Ga0439434_0225934_111_614 | 167 |
| 148 | 3300042438 | Ga0439459_0097276 | Ga0439459_0097276_163_666 | 167 |
| 149 | 3300049127 | Ga0501306_039446 | Ga0501306_039446_158_661 | 167 |
| 150 | 3300049129 | Ga0501309_010593 | Ga0501309_010593_125_628 | 167 |
| 151 | 3300049129 | Ga0501309_043319 | Ga0501309_043319_148_651 | 167 |
| 152 | 3300049129 | Ga0501309_064672 | Ga0501309_064672_27_530 | 167 |
| 153 | 3300049160 | Ga0501304_006366 | Ga0501304_006366_129_632 | 167 |
| 154 | 3300049161 | Ga0501305_064318 | Ga0501305_064318_26_529 | 167 |
| 155 | 3300049161 | Ga0501305_080789 | Ga0501305_080789_12_515 | 167 |
| 156 | 3300049162 | Ga0501307_042243 | Ga0501307_042243_146_652 | 167 |
| 157 | 3300049527 | Ga0501311_043546 | Ga0501311_043546_33_536 | 167 |
| 158 | 3300049527 | Ga0501311_044335 | Ga0501311_044335_148_651 | 167 |
| 159 | 3300049528 | Ga0501312_090957 | Ga0501312_090957_27_530 | 167 |
| 160 | 3300049530 | Ga0501314_023410 | Ga0501314_023410_119_622 | 167 |
| 161 | 3300049531 | Ga0501315_034689 | Ga0501315_034689_86_589 | 167 |
| 162 | 3300049531 | Ga0501315_042538 | Ga0501315_042538_38_541 | 167 |
| 163 | 3300049532 | Ga0501316_037714 | Ga0501316_037714_14_517 | 167 |
| 164 | 3300049536 | Ga0501320_050401 | Ga0501320_050401_43_546 | 167 |
| 165 | 3300049537 | Ga0501321_034895 | Ga0501321_034895_140_643 | 167 |
| 166 | 3300049538 | Ga0501322_014058 | Ga0501322_014058_119_622 | 167 |
| 167 | 3300049538 | Ga0501322_024152 | Ga0501322_024152_27_530 | 167 |
| 168 | 3300049539 | Ga0501323_056885 | Ga0501323_056885_48_551 | 167 |
| 169 | 3300049539 | Ga0501323_060980 | Ga0501323_060980_23_526 | 167 |
| 170 | 3300049541 | Ga0501325_040305 | Ga0501325_040305_46_549 | 167 |
| 171 | 3300049551 | Ga0501335_025405 | Ga0501335_025405_28_531 | 167 |
| 172 | 3300050492 | nmdc:mga0yw44_265676_c1 | nmdc:mga0yw44_265676_c1_123_626 | 167 |
| 173 | 3300050508 | nmdc:mga09592_527593_c1 | nmdc:mga09592_527593_c1_125_631 | 167 |
| 174 | 3300050510 | nmdc:mga06r32_408833_c1 | nmdc:mga06r32_408833_c1_157_663 | 167 |
| 175 | 3300059477 | Ga0587084_048786 | Ga0587084_048786_94_597 | 167 |
| 176 | 3300059477 | Ga0587084_069979 | Ga0587084_069979_15_518 | 167 |
| 177 | 3300059477 | Ga0587084_071858 | Ga0587084_071858_141_644 | 167 |
| 178 | 3300059478 | Ga0587093_015318 | Ga0587093_015318_352_855 | 167 |
| 179 | 3300059493 | Ga0587077_179229 | Ga0587077_179229_22_525 | 167 |
| 180 | 3300059503 | Ga0587080_082404 | Ga0587080_082404_13_516 | 167 |
| 181 | 3300059504 | Ga0587082_094827 | Ga0587082_094827_125_628 | 167 |
| 182 | 3300059505 | Ga0587083_0179340 | Ga0587083_0179340_14_517 | 167 |
| 183 | 3300059506 | Ga0587085_145712 | Ga0587085_145712_28_531 | 167 |
| 184 | 3300059507 | Ga0587086_050466 | Ga0587086_050466_20_523 | 167 |
| 185 | 3300059507 | Ga0587086_052240 | Ga0587086_052240_144_647 | 167 |
| 186 | 3300059509 | Ga0587089_049861 | Ga0587089_049861_20_523 | 167 |
| 187 | 3300059510 | Ga0587090_080212 | Ga0587090_080212_21_527 | 167 |
| 188 | 3300059512 | Ga0587092_056562 | Ga0587092_056562_82_585 | 167 |
| 189 | 3300059513 | Ga0587094_058755 | Ga0587094_058755_19_522 | 167 |
| 190 | 3300059623 | Ga0587101_045168 | Ga0587101_045168_72_575 | 167 |
| 191 | 3300059623 | Ga0587101_055742 | Ga0587101_055742_130_633 | 167 |
| 192 | 3300059623 | Ga0587101_071995 | Ga0587101_071995_124_627 | 167 |
| 193 | 3300059624 | Ga0587109_052479 | Ga0587109_052479_140_643 | 167 |
| 194 | 3300059624 | Ga0587109_095102 | Ga0587109_095102_10_513 | 167 |
| 195 | 3300059624 | Ga0587109_141707 | Ga0587109_141707_71_574 | 167 |
| 196 | 3300059627 | Ga0587117_095054 | Ga0587117_095054_46_549 | 167 |
| 197 | 3300059629 | Ga0587127_017414 | Ga0587127_017414_100_603 | 167 |
| 198 | 3300059639 | Ga0587062_039799 | Ga0587062_039799_117_620 | 167 |
| 199 | 3300059639 | Ga0587062_050000 | Ga0587062_050000_148_651 | 167 |
| 200 | 3300059641 | Ga0587068_044129 | Ga0587068_044129_181_684 | 167 |
| 201 | 3300059642 | Ga0587069_076426 | Ga0587069_076426_12_515 | 167 |
| 202 | 3300059643 | Ga0587072_101896 | Ga0587072_101896_127_630 | 167 |
| 203 | 3300059643 | Ga0587072_102283 | Ga0587072_102283_113_616 | 167 |
| 204 | 3300059645 | Ga0587076_143713 | Ga0587076_143713_20_523 | 167 |
| 205 | 3300059646 | Ga0587078_025151 | Ga0587078_025151_130_633 | 167 |
| 206 | 3300059646 | Ga0587078_039893 | Ga0587078_039893_15_518 | 167 |
| 207 | 3300059646 | Ga0587078_040674 | Ga0587078_040674_84_644 | 167 |
| 208 | 3300059647 | Ga0587079_115099 | Ga0587079_115099_11_571 | 167 |
| 209 | 3300059649 | Ga0587102_025250 | Ga0587102_025250_144_647 | 167 |
| 210 | 3300059653 | Ga0587108_016556 | Ga0587108_016556_135_638 | 167 |
| 211 | 3300059660 | Ga0587124_021743 | Ga0587124_021743_28_531 | 167 |
| 212 | 3300060346 | Ga0587111_0069476 | Ga0587111_0069476_138_641 | 167 |
| 213 | 3300060346 | Ga0587111_0151291 | Ga0587111_0151291_71_574 | 167 |
| 214 | 3300060346 | Ga0587111_0157595 | Ga0587111_0157595_19_522 | 167 |
| 215 | 3300060346 | Ga0587111_0165569 | Ga0587111_0165569_10_513 | 167 |
| 216 | 3300060346 | Ga0587111_0198053 | Ga0587111_0198053_53_556 | 167 |
| 217 | 3300060346 | Ga0587111_0199523 | Ga0587111_0199523_14_517 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hkh-assembly4.cif.gz_E | structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w | 0.943 | 2 | 164 |
| 4hkh-assembly3.cif.gz_D | structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w | 0.9394 | 3 | 162 |
| 4hkh-assembly2.cif.gz_B | structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w | 0.9366 | 3 | 162 |
| 4hkh-assembly4.cif.gz_E | structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w | 0.9363 | 2 | 164 |
| 4hkh-assembly6.cif.gz_G | structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w | 0.9344 | 3 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hkhG00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9344 | 3 | 162 | 2.30.110.20 |
| 4hkhG00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9218 | 3 | 162 | 2.30.110.20 |
| 6a2vB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.8636 | 2 | 162 | 2.30.110.20 |
| 5xeuF00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.8616 | 3 | 165 | 2.30.110.20 |
| 6a2vB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.8584 | 2 | 162 | 2.30.110.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U1J104-F1-model_v4 | Hcp family type VI secretion system effector | 0.9602 | 1 | 165 |
|
| AF-A0A017T387-F1-model_v4 | Hcp protein | 0.9593 | 104 | 167 |
|
| AF-A0A0H3HZ38-F1-model_v4 | Hcp protein | 0.9588 | 56 | 167 |
|
| AF-A0A1I7HM62-F1-model_v4 | Type VI secretion system secreted protein Hcp | 0.9576 | 1 | 165 |
|
| AF-A0A7C3LG11-F1-model_v4 | Hcp family type VI secretion system effector | 0.9547 | 2 | 164 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar