F328862

General Info

Members Datasets Scaffolds Average Seq Length
217 150 434 152

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_11124819|Ga0207640_111248191
Length 169
Sequence MQQDGIDWSCYLAVSNIIMQKILAGLLLLLCASFFVSAQDAQPKAKLNHIALYVVNLKESTSFYKEVVGLDTIPEPFHDGKHTWFGVGPKSHLHLIEGAKEKMPHDKNSHLCFTVPSVDAFITILKKYKTEYESWAGEKYSVTTRVDGVKQIYFKDPDGYWVEINDARE

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
120 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
121 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
139 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
140 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
141 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
142 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
143 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 0
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 17.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_11124819 3300025981 Bacteria 696
2 JGI24749J21850_1050951 3300002076 Unclassified 618
3 Ga0065707_10131634 3300005295 Bacteria 1910
4 Ga0070658_10367176 3300005327 Bacteria 1233
5 Ga0070658_10418775 3300005327 Bacteria 1152
6 Ga0070683_100209159 3300005329 Bacteria 1853
7 Ga0070690_100257353 3300005330 Unclassified 1237
8 Ga0070670_100047889 3300005331 Unclassified 3679
9 Ga0070677_10290942 3300005333 Bacteria 826
10 Ga0068869_100234652 3300005334 Unclassified 1459
11 Ga0070666_10082887 3300005335 Bacteria 2193
12 Ga0070680_100004897 3300005336 Bacteria 10085
13 Ga0070680_100150964 3300005336 Bacteria 1950
14 Ga0070660_100040502 3300005339 Bacteria 3546
15 Ga0070660_100153169 3300005339 Bacteria 1854
16 Ga0070689_100010563 3300005340 Bacteria 6582
17 Ga0070661_101707059 3300005344 Bacteria 533
18 Ga0070668_100178245 3300005347 Unclassified 1734
19 Ga0070669_100017256 3300005353 Bacteria 5149
20 Ga0070669_100112076 3300005353 Bacteria 2071
21 Ga0070669_100256606 3300005353 Bacteria 1394
22 Ga0070675_100051052 3300005354 Bacteria 3398
23 Ga0070675_100166004 3300005354 Unclassified 1901
24 Ga0070671_100343929 3300005355 Bacteria 1273
25 Ga0070674_100508242 3300005356 Bacteria 1005
26 Ga0070673_101100349 3300005364 Bacteria 742
27 Ga0070688_100010845 3300005365 Bacteria 5041
28 Ga0070688_100612126 3300005365 Bacteria 835
29 Ga0070659_100192366 3300005366 Bacteria 1677
30 Ga0070667_100494420 3300005367 Unclassified 1121
31 Ga0070667_101276724 3300005367 Bacteria 688
32 Ga0070700_100010016 3300005441 Bacteria 5219
33 Ga0070700_100741027 3300005441 Bacteria 785
34 Ga0070694_101026383 3300005444 Bacteria 685
35 Ga0070663_100035851 3300005455 Bacteria 3444
36 Ga0070663_100686769 3300005455 Unclassified 869
37 Ga0070681_10069975 3300005458 Bacteria 3475
38 Ga0070681_10466958 3300005458 Bacteria 1174
39 Ga0068867_100059095 3300005459 Unclassified 2842
40 Ga0070698_100026437 3300005471 Bacteria 6041
41 Ga0070698_100051504 3300005471 Bacteria 4193
42 Ga0070698_100410843 3300005471 Bacteria 1287
43 Ga0070679_100026094 3300005530 Bacteria 5736
44 Ga0070679_100511681 3300005530 Bacteria 1144
45 Ga0068853_100570972 3300005539 Bacteria 1073
46 Ga0070672_100113063 3300005543 Unclassified 2216
47 Ga0070672_100176817 3300005543 Bacteria 1777
48 Ga0070696_100156347 3300005546 Bacteria 1677
49 Ga0070693_101220314 3300005547 Bacteria 578
50 Ga0068855_100006503 3300005563 Bacteria 14208
51 Ga0068855_100012658 3300005563 Bacteria 10181
52 Ga0068857_100143373 3300005577 Unclassified 2160
53 Ga0068857_102088752 3300005577 Bacteria 556
54 Ga0068854_100123742 3300005578 Unclassified 1967
55 Ga0068856_100005092 3300005614 Bacteria 12994
56 Ga0070702_100239021 3300005615 Bacteria 1225
57 Ga0068852_100604718 3300005616 Bacteria 1101
58 Ga0068859_100040625 3300005617 Bacteria 4669
59 Ga0068859_100526487 3300005617 Bacteria 1277
60 Ga0068861_100007640 3300005719 Bacteria 7420
61 Ga0068861_100645064 3300005719 Bacteria 977
62 Ga0068870_10018237 3300005840 Unclassified 3385
63 Ga0068863_100004394 3300005841 Bacteria 13902
64 Ga0068863_100016897 3300005841 Bacteria 6998
65 Ga0068860_101673060 3300005843 Bacteria 658
66 Ga0075432_10013148 3300006058 Bacteria 2812
67 Ga0068871_100344503 3300006358 Unclassified 1317
68 Ga0075428_100136335 3300006844 Bacteria 2669
69 Ga0075428_101452909 3300006844 Unclassified 719
70 Ga0075430_100189778 3300006846 Bacteria 1708
71 Ga0075431_100300111 3300006847 Bacteria 1623
72 Ga0075429_100184980 3300006880 Bacteria 1825
73 Ga0097620_100040616 3300006931 Bacteria 4669
74 Ga0097620_100526446 3300006931 Bacteria 1277
75 Ga0111539_10112261 3300009094 Bacteria 3197
76 Ga0114129_10029870 3300009147 Bacteria 7719
77 Ga0114129_12371577 3300009147 Unclassified 636
78 Ga0105242_10017813 3300009176 Bacteria 5542
79 Ga0105242_10380174 3300009176 Bacteria 1312
80 Ga0105249_10009787 3300009553 Bacteria 8398
81 Ga0105249_10039370 3300009553 Bacteria 4292
82 Ga0157373_10035365 3300013100 Bacteria 3586
83 Ga0157371_10001280 3300013102 Bacteria 26535
84 Ga0157371_10017543 3300013102 Bacteria 5316
85 Ga0157371_10018774 3300013102 Bacteria 5109
86 Ga0157371_10108136 3300013102 Bacteria 1973
87 Ga0157371_10253704 3300013102 Bacteria 1267
88 Ga0157371_11517975 3300013102 Unclassified 523
89 Ga0157370_10246026 3300013104 Bacteria 1654
90 Ga0157370_10420152 3300013104 Bacteria 1230
91 Ga0157370_10505759 3300013104 Bacteria 1109
92 Ga0157369_10162078 3300013105 Bacteria 2360
93 Ga0157369_10164390 3300013105 Bacteria 2341
94 Ga0157378_11516477 3300013297 Bacteria 715
95 Ga0163162_11620010 3300013306 Bacteria 738
96 Ga0163162_11843785 3300013306 Bacteria 692
97 Ga0157372_10121651 3300013307 Bacteria 2999
98 Ga0157372_10172152 3300013307 Bacteria 2505
99 Ga0157372_10202604 3300013307 Bacteria 2299
100 Ga0157372_10345528 3300013307 Bacteria 1733
101 Ga0157372_10571319 3300013307 Bacteria 1318
102 Ga0157372_10712843 3300013307 Bacteria 1167
103 Ga0157372_11269129 3300013307 Unclassified 850
104 Ga0157375_11059653 3300013308 Bacteria 948
105 Ga0163163_10825275 3300014325 Unclassified 991
106 Ga0157380_10221278 3300014326 Bacteria 1694
107 Ga0157380_10269083 3300014326 Bacteria 1552
108 Ga0157377_10331030 3300014745 Unclassified 1015
109 Ga0157376_11259202 3300014969 Bacteria 769
110 Ga0207688_10397496 3300025901 Bacteria 854
111 Ga0207680_10178362 3300025903 Bacteria 1435
112 Ga0207643_10039004 3300025908 Unclassified 2671
113 Ga0207705_10104649 3300025909 Bacteria 2085
114 Ga0207707_10087139 3300025912 Bacteria 2728
115 Ga0207707_10250373 3300025912 Bacteria 1539
116 Ga0207660_10002218 3300025917 Bacteria 12857
117 Ga0207660_10087231 3300025917 Bacteria 2305
118 Ga0207657_10039921 3300025919 Bacteria 4164
119 Ga0207657_10051571 3300025919 Bacteria 3576
120 Ga0207652_10000999 3300025921 Bacteria 26089
121 Ga0207652_10185722 3300025921 Bacteria 1869
122 Ga0207652_10447682 3300025921 Bacteria 1164
123 Ga0207681_10014230 3300025923 Bacteria 4938
124 Ga0207681_10179782 3300025923 Bacteria 1610
125 Ga0207650_10248985 3300025925 Bacteria 1438
126 Ga0207659_10014071 3300025926 Bacteria 5151
127 Ga0207659_10121553 3300025926 Unclassified 2002
128 Ga0207706_10029658 3300025933 Bacteria 4883
129 Ga0207686_10015258 3300025934 Unclassified 4292
130 Ga0207691_10065539 3300025940 Bacteria 3287
131 Ga0207691_11232981 3300025940 Unclassified 619
132 Ga0207689_10110361 3300025942 Unclassified 2261
133 Ga0207661_10198432 3300025944 Bacteria 1763
134 Ga0207661_10427366 3300025944 Bacteria 1204
135 Ga0207679_10582400 3300025945 Unclassified 1007
136 Ga0207667_10000492 3300025949 Bacteria 52207
137 Ga0207667_10761162 3300025949 Bacteria 967
138 Ga0207651_10691476 3300025960 Bacteria 898
139 Ga0207668_10041458 3300025972 Unclassified 3112
140 Ga0207640_10222361 3300025981 Unclassified 1446
141 Ga0207658_10684435 3300025986 Bacteria 926
142 Ga0207639_10109170 3300026041 Bacteria 2251
143 Ga0207678_10004101 3300026067 Bacteria 13100
144 Ga0207708_10018571 3300026075 Bacteria 5237
145 Ga0207708_10297837 3300026075 Bacteria 1311
146 Ga0207708_10351364 3300026075 Unclassified 1209
147 Ga0207702_10247297 3300026078 Bacteria 1673
148 Ga0207641_10000380 3300026088 Bacteria 52801
149 Ga0207641_10002478 3300026088 Bacteria 17055
150 Ga0207648_10371081 3300026089 Bacteria 1292
151 Ga0207648_10470563 3300026089 Unclassified 1147
152 Ga0207676_10003475 3300026095 Bacteria 11146
153 Ga0207676_10693098 3300026095 Bacteria 986
154 Ga0207674_10316761 3300026116 Bacteria 1509
155 Ga0207675_100003678 3300026118 Bacteria 14949
156 Ga0207675_100018113 3300026118 Bacteria 6566
157 Ga0207675_100904851 3300026118 Bacteria 899
158 Ga0207683_10037167 3300026121 Bacteria 4240
159 Ga0207683_10260837 3300026121 Bacteria 1582
160 Ga0207698_12041967 3300026142 Bacteria 587
161 Ga0209995_1035145 3300027471 Bacteria 842
162 Ga0207428_10351240 3300027907 Unclassified 1085
163 Ga0207428_10382658 3300027907 Bacteria 1032
164 Ga0268265_10464209 3300028380 Unclassified 1185
165 Ga0307515_10000001 3300028794 Bacteria 4259510
166 Ga0265327_10000013 3300031251 Bacteria 519549
167 Ga0307513_10187194 3300031456 Bacteria 1926
168 Ga0307516_10785791 3300031730 Bacteria 613
169 Ga0307407_10797605 3300031903 Bacteria 718
170 Ga0373952_0044197 3300035092 Unclassified 1040
171 Ga0373945_0067000 3300035116 Bacteria 1351
172 Ga0395899_0040082 3300037312 Bacteria 3503
173 Ga0395900_0159201 3300037418 Bacteria 2304
174 Ga0395900_0806873 3300037418 Bacteria 866
175 Ga0395898_0021245 3300037466 Bacteria 6583
176 Ga0395905_0006880 3300037471 Bacteria 11367
177 Ga0395901_0094864 3300038443 Bacteria 3126
178 Ga0395901_1317949 3300038443 Bacteria 683
179 Ga0451839_0105956 3300041496 Bacteria 752
180 Ga0451839_0134291 3300041496 Unclassified 615
181 Ga0451847_0687838 3300041503 Unclassified 676
182 Ga0451853_1646540 3300041512 Bacteria 747
183 Ga0439443_064438 3300042003 Bacteria 661
184 Ga0450923_015256 3300042125 Bacteria 1435
185 Ga0450918_014771 3300042531 Bacteria 1357
186 Ga0453683_0489644 3300044673 Bacteria 797
187 Ga0453684_0035565 3300044712 Bacteria 6881
188 Ga0453684_0046565 3300044712 Bacteria 5766
189 Ga0466959_0633136 3300045049 Bacteria 718
190 Ga0495672_0012919 3300047320 Bacteria 5790
191 Ga0501031_0532013 3300049568 Bacteria 757
192 Ga0501032_0031772 3300049569 Bacteria 3619
193 Ga0501034_0005113 3300049571 Bacteria 14399
194 Ga0501036_0123556 3300049572 Unclassified 2186
195 Ga0501037_0011057 3300049573 Bacteria 6640
196 Ga0501038_0014395 3300049574 Bacteria 7207
197 Ga0501039_0055603 3300049575 Bacteria 3066
198 Ga0501043_0008834 3300049579 Bacteria 7929
199 Ga0501046_0208722 3300049580 Bacteria 1451
200 Ga0501047_0055673 3300049581 Bacteria 3824
201 Ga0501048_0581963 3300049582 Bacteria 803
202 Ga0501070_0119102 3300049586 Bacteria 2182
203 Ga0501217_091089 3300049661 Bacteria 856
204 Ga0501227_181951 3300049665 Bacteria 591
205 Ga0501240_005103 3300049673 Bacteria 1557
206 Ga0501246_008648 3300049676 Bacteria 906
207 Ga0501250_058911 3300049680 Bacteria 608
208 Ga0501266_008435 3300049763 Bacteria 1297
209 Ga0501035_0003428 3300049822 Bacteria 15168
210 Ga0501044_0075328 3300049823 Bacteria 3426
211 Ga0501044_1409350 3300049823 Bacteria 562
212 nmdc:mga05p37_234719_c1 3300050507 Bacteria 2208
213 nmdc:mga09592_28066_c1 3300050508 Bacteria 4674
214 nmdc:mga09592_602023_c1 3300050508 Unclassified 941
215 nmdc:mga06r32_438115_c1 3300050510 Bacteria 1287
216 nmdc:mga08y16_261112_c1 3300050511 Unclassified 1789
217 Ga0500628_182221 3300053129 Unclassified 600
218 Ga0207640_11124819
219 JGI24749J21850_1050951
220 Ga0065707_10131634
221 Ga0070658_10367176
222 Ga0070658_10418775
223 Ga0070683_100209159
224 Ga0070690_100257353
225 Ga0070670_100047889
226 Ga0070677_10290942
227 Ga0068869_100234652
228 Ga0070666_10082887
229 Ga0070680_100004897
230 Ga0070680_100150964
231 Ga0070660_100040502
232 Ga0070660_100153169
233 Ga0070689_100010563
234 Ga0070661_101707059
235 Ga0070668_100178245
236 Ga0070669_100017256
237 Ga0070669_100112076
238 Ga0070669_100256606
239 Ga0070675_100051052
240 Ga0070675_100166004
241 Ga0070671_100343929
242 Ga0070674_100508242
243 Ga0070673_101100349
244 Ga0070688_100010845
245 Ga0070688_100612126
246 Ga0070659_100192366
247 Ga0070667_100494420
248 Ga0070667_101276724
249 Ga0070700_100010016
250 Ga0070700_100741027
251 Ga0070694_101026383
252 Ga0070663_100035851
253 Ga0070663_100686769
254 Ga0070681_10069975
255 Ga0070681_10466958
256 Ga0068867_100059095
257 Ga0070698_100026437
258 Ga0070698_100051504
259 Ga0070698_100410843
260 Ga0070679_100026094
261 Ga0070679_100511681
262 Ga0068853_100570972
263 Ga0070672_100113063
264 Ga0070672_100176817
265 Ga0070696_100156347
266 Ga0070693_101220314
267 Ga0068855_100006503
268 Ga0068855_100012658
269 Ga0068857_100143373
270 Ga0068857_102088752
271 Ga0068854_100123742
272 Ga0068856_100005092
273 Ga0070702_100239021
274 Ga0068852_100604718
275 Ga0068859_100040625
276 Ga0068859_100526487
277 Ga0068861_100007640
278 Ga0068861_100645064
279 Ga0068870_10018237
280 Ga0068863_100004394
281 Ga0068863_100016897
282 Ga0068860_101673060
283 Ga0075432_10013148
284 Ga0068871_100344503
285 Ga0075428_100136335
286 Ga0075428_101452909
287 Ga0075430_100189778
288 Ga0075431_100300111
289 Ga0075429_100184980
290 Ga0097620_100040616
291 Ga0097620_100526446
292 Ga0111539_10112261
293 Ga0114129_10029870
294 Ga0114129_12371577
295 Ga0105242_10017813
296 Ga0105242_10380174
297 Ga0105249_10009787
298 Ga0105249_10039370
299 Ga0157373_10035365
300 Ga0157371_10001280
301 Ga0157371_10017543
302 Ga0157371_10018774
303 Ga0157371_10108136
304 Ga0157371_10253704
305 Ga0157371_11517975
306 Ga0157370_10246026
307 Ga0157370_10420152
308 Ga0157370_10505759
309 Ga0157369_10162078
310 Ga0157369_10164390
311 Ga0157378_11516477
312 Ga0163162_11620010
313 Ga0163162_11843785
314 Ga0157372_10121651
315 Ga0157372_10172152
316 Ga0157372_10202604
317 Ga0157372_10345528
318 Ga0157372_10571319
319 Ga0157372_10712843
320 Ga0157372_11269129
321 Ga0157375_11059653
322 Ga0163163_10825275
323 Ga0157380_10221278
324 Ga0157380_10269083
325 Ga0157377_10331030
326 Ga0157376_11259202
327 Ga0207688_10397496
328 Ga0207680_10178362
329 Ga0207643_10039004
330 Ga0207705_10104649
331 Ga0207707_10087139
332 Ga0207707_10250373
333 Ga0207660_10002218
334 Ga0207660_10087231
335 Ga0207657_10039921
336 Ga0207657_10051571
337 Ga0207652_10000999
338 Ga0207652_10185722
339 Ga0207652_10447682
340 Ga0207681_10014230
341 Ga0207681_10179782
342 Ga0207650_10248985
343 Ga0207659_10014071
344 Ga0207659_10121553
345 Ga0207706_10029658
346 Ga0207686_10015258
347 Ga0207691_10065539
348 Ga0207691_11232981
349 Ga0207689_10110361
350 Ga0207661_10198432
351 Ga0207661_10427366
352 Ga0207679_10582400
353 Ga0207667_10000492
354 Ga0207667_10761162
355 Ga0207651_10691476
356 Ga0207668_10041458
357 Ga0207640_10222361
358 Ga0207658_10684435
359 Ga0207639_10109170
360 Ga0207678_10004101
361 Ga0207708_10018571
362 Ga0207708_10297837
363 Ga0207708_10351364
364 Ga0207702_10247297
365 Ga0207641_10000380
366 Ga0207641_10002478
367 Ga0207648_10371081
368 Ga0207648_10470563
369 Ga0207676_10003475
370 Ga0207676_10693098
371 Ga0207674_10316761
372 Ga0207675_100003678
373 Ga0207675_100018113
374 Ga0207675_100904851
375 Ga0207683_10037167
376 Ga0207683_10260837
377 Ga0207698_12041967
378 Ga0209995_1035145
379 Ga0207428_10351240
380 Ga0207428_10382658
381 Ga0268265_10464209
382 Ga0307515_10000001
383 Ga0265327_10000013
384 Ga0307513_10187194
385 Ga0307516_10785791
386 Ga0307407_10797605
387 Ga0373952_0044197
388 Ga0373945_0067000
389 Ga0395899_0040082
390 Ga0395900_0159201
391 Ga0395900_0806873
392 Ga0395898_0021245
393 Ga0395905_0006880
394 Ga0395901_0094864
395 Ga0395901_1317949
396 Ga0451839_0105956
397 Ga0451839_0134291
398 Ga0451847_0687838
399 Ga0451853_1646540
400 Ga0439443_064438
401 Ga0450923_015256
402 Ga0450918_014771
403 Ga0453683_0489644
404 Ga0453684_0035565
405 Ga0453684_0046565
406 Ga0466959_0633136
407 Ga0495672_0012919
408 Ga0501031_0532013
409 Ga0501032_0031772
410 Ga0501034_0005113
411 Ga0501036_0123556
412 Ga0501037_0011057
413 Ga0501038_0014395
414 Ga0501039_0055603
415 Ga0501043_0008834
416 Ga0501046_0208722
417 Ga0501047_0055673
418 Ga0501048_0581963
419 Ga0501070_0119102
420 Ga0501217_091089
421 Ga0501227_181951
422 Ga0501240_005103
423 Ga0501246_008648
424 Ga0501250_058911
425 Ga0501266_008435
426 Ga0501035_0003428
427 Ga0501044_0075328
428 Ga0501044_1409350
429 nmdc:mga05p37_234719_c1
430 nmdc:mga09592_28066_c1
431 nmdc:mga09592_602023_c1
432 nmdc:mga06r32_438115_c1
433 nmdc:mga08y16_261112_c1
434 Ga0500628_182221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

46

164

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a52-assembly1.cif.gz_A oxidase chap-h1 0.8296 26 149
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8257 26 149
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8247 26 149
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.8243 26 146
2p7m-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.8221 26 146
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8625 91 148 3.30.720.110
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8421 25 80 3.30.720.120
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8148 25 80 3.30.720.120
5wewB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8103 26 149 3.10.180.10
1xqaB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.809 28 146 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4V3E023-F1-model_v4 deleted 0.9931 32 151
AF-A0A317IUC4-F1-model_v4 Glyoxalase 0.99 28 151
AF-A0A1Q3K3C2-F1-model_v4 Glyoxalase 0.9865 19 150
AF-A0A4V3E023-F1-model_v4 deleted 0.9849 32 151
AF-A0A317IUC4-F1-model_v4 Glyoxalase 0.9821 28 151

Map