F328593

General Info

Members Datasets Scaffolds Average Seq Length
217 91 434 496

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10011802|Ga0081538_100118022
Length 573
Sequence MESRDDVKKIRIGAMEQLGAIPKVLKELQELVPLLSVAYSTDGRTFGYESPLSMSIPVGSYVTLTAQGGNEYLGQVVTKEVSVRQGAEIGLELDPSLSALLPEGISFSSSHTYPLQRRYAHGSGVILGKLENDRYVPTTNEDGFQSADLAPAGESLVAAYLAAEGRAKLDVGRALYTEGRVHVPLKAEGFDRHTFLCGQSGSGKTFALGVILERLLLETELKVVILDPNSDFVRLDRVRTRDEVNRTRSSVLSPECYENLLAHYRRVASKLRILRPAPYAENRSKLLRIRFSDLERHEQGLVLGLDPLRDREEFNAYWRAIEGLARDRYSLSEVKEVVVRQFSEDARRLGLRIENLGVADWSLWCESDEPSLVDVLEEDWRCLIVDSGTLASPAEQSIVAMAVLGHLWRHRNERHPVLIVADEAHNICPQEPADSLEAAATSHAVKIAGEGRKFGLYLLVATQRPSKIHANVLSQCDNLALMKMNSVSDLAHISQILSQAPATFLDQSSHFAQGECLLAGKMVRNPTFVAFEGRFSEEGGTDVPSSWASRDENRMLQRPDGGHESPAHGGGSP

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
27 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
28 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
31 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
33 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
36 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
37 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
38 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
39 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
40 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
41 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
42 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
43 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
44 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
45 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
46 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
47 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
48 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
49 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
52 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
66 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
67 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
68 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
69 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
70 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
71 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
72 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
73 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
74 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
84 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
87 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
88 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 6.91
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10011802 3300005981 Bacteria 7051
2 LJQas_1001688 3300000549 Bacteria 3244
3 JGI25406J46586_10010843 3300003203 Bacteria 4020
4 Ga0070683_100065872 3300005329 Bacteria 3374
5 Ga0070674_100016245 3300005356 Bacteria 4664
6 Ga0070694_100037073 3300005444 Bacteria 3233
7 Ga0070679_100163886 3300005530 Bacteria 2197
8 Ga0070696_100032261 3300005546 Bacteria 3593
9 Ga0070702_100068309 3300005615 Bacteria 2091
10 Ga0081455_10030279 3300005937 Bacteria 4919
11 Ga0081455_10040667 3300005937 Bacteria 4097
12 Ga0081455_10135927 3300005937 Bacteria 1916
13 Ga0081538_10000324 3300005981 Bacteria 54756
14 Ga0081538_10000412 3300005981 Bacteria 48367
15 Ga0081538_10000461 3300005981 Bacteria 45573
16 Ga0081538_10000616 3300005981 Bacteria 39495
17 Ga0081538_10001046 3300005981 Bacteria 29493
18 Ga0081538_10004252 3300005981 Bacteria 13280
19 Ga0081538_10008251 3300005981 Bacteria 8874
20 Ga0081538_10027286 3300005981 Bacteria 3964
21 Ga0081538_10030606 3300005981 Bacteria 3649
22 Ga0081538_10062135 3300005981 Bacteria 2132
23 Ga0081540_1000955 3300005983 Bacteria 26064
24 Ga0081539_10001468 3300005985 Bacteria 39989
25 Ga0081539_10001832 3300005985 Bacteria 33546
26 Ga0075430_100003403 3300006846 Bacteria 13292
27 Ga0075430_100114742 3300006846 Bacteria 2244
28 Ga0075431_100008954 3300006847 Bacteria 10033
29 Ga0075429_100006833 3300006880 Bacteria 9900
30 Ga0075429_100025770 3300006880 Bacteria 5106
31 Ga0114129_10005355 3300009147 Bacteria 18110
32 Ga0105239_10255133 3300010375 Unclassified 1970
33 Ga0163162_10286639 3300013306 Bacteria 1779
34 Ga0157375_10088612 3300013308 Bacteria 3150
35 Ga0163163_10018707 3300014325 Bacteria 6492
36 Ga0207680_10022359 3300025903 Bacteria 3437
37 Ga0207661_10046025 3300025944 Bacteria 3458
38 Ga0207708_10106754 3300026075 Bacteria 2171
39 Ga0207702_10184756 3300026078 Bacteria 1922
40 Ga0207648_10044920 3300026089 Bacteria 3876
41 Ga0307513_10000353 3300031456 Bacteria 67041
42 Ga0316576_10062852 3300031727 Bacteria 2724
43 Ga0316578_10088354 3300031728 Bacteria 1849
44 Ga0307410_10036801 3300031852 Bacteria 3191
45 Ga0307411_10052303 3300032005 Bacteria 2670
46 Ga0316593_10005104 3300032168 Bacteria 3433
47 Ga0316584_0038561 3300036712 Bacteria 3554
48 Ga0395899_0080556 3300037312 Bacteria 2370
49 Ga0395898_0046846 3300037466 Bacteria 4246
50 Ga0316581_0003781 3300037588 Unclassified 3803
51 Ga0395901_0033615 3300038443 Bacteria 5295
52 Ga0466960_0028025 3300044901 Bacteria 2575
53 Ga0495650_0000079 3300046471 Bacteria 244549
54 Ga0496100_0008789 3300048903 Bacteria 5649
55 Ga0496102_0008007 3300048905 Bacteria 9033
56 Ga0496102_0015712 3300048905 Bacteria 6595
57 Ga0496103_0036219 3300048906 Bacteria 3021
58 Ga0496104_0040910 3300048907 Bacteria 4346
59 Ga0496107_0132182 3300048910 Bacteria 1843
60 Ga0496109_0048100 3300048912 Bacteria 3880
61 Ga0496109_0061228 3300048912 Bacteria 3440
62 Ga0496110_0110558 3300048913 Bacteria 2469
63 Ga0496110_0271048 3300048913 Bacteria 1545
64 Ga0496111_0072391 3300048914 Bacteria 2509
65 Ga0496112_0031584 3300048915 Bacteria 5138
66 Ga0496112_0052197 3300048915 Bacteria 4012
67 Ga0496114_0011908 3300048917 Bacteria 6960
68 Ga0496114_0023703 3300048917 Bacteria 5009
69 Ga0501031_0000328 3300049568 Bacteria 27375
70 Ga0501031_0000432 3300049568 Bacteria 24102
71 Ga0501031_0003533 3300049568 Bacteria 10031
72 Ga0501031_0038706 3300049568 Bacteria 3112
73 Ga0501031_0042312 3300049568 Bacteria 2974
74 Ga0501032_0007654 3300049569 Bacteria 7876
75 Ga0501032_0041088 3300049569 Bacteria 3142
76 Ga0501033_0037077 3300049570 Bacteria 3650
77 Ga0501033_0045899 3300049570 Bacteria 3250
78 Ga0501033_0122041 3300049570 Bacteria 1890
79 Ga0501034_0055680 3300049571 Bacteria 3979
80 Ga0501036_0001998 3300049572 Bacteria 15845
81 Ga0501036_0021194 3300049572 Bacteria 5459
82 Ga0501036_0062410 3300049572 Bacteria 3156
83 Ga0501037_0000348 3300049573 Bacteria 38976
84 Ga0501037_0027218 3300049573 Bacteria 4223
85 Ga0501037_0080369 3300049573 Bacteria 2366
86 Ga0501038_0000268 3300049574 Bacteria 44025
87 Ga0501038_0014134 3300049574 Bacteria 7273
88 Ga0501038_0088188 3300049574 Bacteria 2604
89 Ga0501038_0122941 3300049574 Bacteria 2138
90 Ga0501039_0000100 3300049575 Bacteria 60151
91 Ga0501039_0004731 3300049575 Bacteria 10306
92 Ga0501039_0007135 3300049575 Bacteria 8513
93 Ga0501039_0008962 3300049575 Bacteria 7624
94 Ga0501039_0029285 3300049575 Bacteria 4240
95 Ga0501039_0032484 3300049575 Bacteria 4024
96 Ga0501039_0096991 3300049575 Bacteria 2299
97 Ga0501040_0000151 3300049576 Bacteria 38289
98 Ga0501040_0003731 3300049576 Bacteria 9874
99 Ga0501040_0008700 3300049576 Bacteria 6592
100 Ga0501040_0026397 3300049576 Bacteria 3906
101 Ga0501040_0028937 3300049576 Bacteria 3736
102 Ga0501040_0030372 3300049576 Bacteria 3650
103 Ga0501040_0040219 3300049576 Bacteria 3181
104 Ga0501041_0004021 3300049577 Bacteria 8491
105 Ga0501041_0004556 3300049577 Bacteria 8041
106 Ga0501041_0006442 3300049577 Bacteria 6871
107 Ga0501041_0010585 3300049577 Bacteria 5436
108 Ga0501041_0034616 3300049577 Bacteria 3058
109 Ga0501041_0040399 3300049577 Bacteria 2831
110 Ga0501041_0064132 3300049577 Bacteria 2250
111 Ga0501042_0000021 3300049578 Bacteria 50302
112 Ga0501042_0000492 3300049578 Bacteria 20529
113 Ga0501042_0001176 3300049578 Bacteria 15152
114 Ga0501042_0003286 3300049578 Bacteria 10117
115 Ga0501042_0008110 3300049578 Bacteria 6915
116 Ga0501042_0092077 3300049578 Bacteria 2176
117 Ga0501043_0012753 3300049579 Bacteria 6569
118 Ga0501043_0029795 3300049579 Bacteria 4288
119 Ga0501046_0002727 3300049580 Bacteria 16440
120 Ga0501046_0006736 3300049580 Bacteria 10148
121 Ga0501046_0010716 3300049580 Bacteria 7863
122 Ga0501046_0040005 3300049580 Bacteria 3749
123 Ga0501046_0136418 3300049580 Bacteria 1858
124 Ga0501047_0002457 3300049581 Bacteria 17693
125 Ga0501048_0000086 3300049582 Bacteria 48595
126 Ga0501048_0002806 3300049582 Bacteria 13292
127 Ga0501048_0024048 3300049582 Bacteria 4448
128 Ga0501048_0044420 3300049582 Bacteria 3177
129 Ga0501048_0053449 3300049582 Bacteria 2872
130 Ga0501048_0062899 3300049582 Bacteria 2626
131 Ga0501048_0065911 3300049582 Bacteria 2560
132 Ga0501068_0001822 3300049584 Bacteria 11313
133 Ga0501068_0029842 3300049584 Bacteria 3232
134 Ga0501068_0078230 3300049584 Bacteria 2026
135 Ga0501069_0002579 3300049585 Bacteria 9252
136 Ga0501070_0000379 3300049586 Bacteria 40548
137 Ga0501070_0094955 3300049586 Bacteria 2467
138 Ga0501071_0000014 3300049587 Bacteria 60053
139 Ga0501071_0009691 3300049587 Bacteria 6427
140 Ga0501071_0021531 3300049587 Bacteria 4490
141 Ga0501071_0084265 3300049587 Bacteria 2329
142 Ga0501071_0087373 3300049587 Bacteria 2287
143 Ga0501072_0001456 3300049588 Bacteria 17747
144 Ga0501072_0003232 3300049588 Bacteria 12228
145 Ga0501072_0021621 3300049588 Bacteria 4989
146 Ga0501072_0025349 3300049588 Bacteria 4619
147 Ga0501072_0061339 3300049588 Bacteria 2966
148 Ga0501072_0081867 3300049588 Bacteria 2559
149 Ga0501073_0084400 3300049589 Bacteria 2210
150 Ga0501073_0084486 3300049589 Bacteria 2208
151 Ga0501074_0013072 3300049590 Bacteria 6034
152 Ga0501074_0016093 3300049590 Bacteria 5436
153 Ga0501074_0064098 3300049590 Bacteria 2646
154 Ga0501075_0003179 3300049591 Bacteria 11000
155 Ga0501075_0003428 3300049591 Bacteria 10608
156 Ga0501075_0024838 3300049591 Bacteria 4399
157 Ga0501075_0030263 3300049591 Bacteria 4009
158 Ga0501075_0041529 3300049591 Bacteria 3446
159 Ga0501075_0158462 3300049591 Bacteria 1726
160 Ga0501076_0000355 3300049592 Bacteria 28426
161 Ga0501076_0001973 3300049592 Bacteria 14007
162 Ga0501076_0010035 3300049592 Bacteria 7007
163 Ga0501076_0013862 3300049592 Bacteria 6052
164 Ga0501076_0072475 3300049592 Bacteria 2756
165 Ga0501076_0074838 3300049592 Bacteria 2714
166 Ga0501077_0000427 3300049593 Bacteria 25498
167 Ga0501077_0003978 3300049593 Bacteria 8916
168 Ga0501077_0008936 3300049593 Bacteria 6216
169 Ga0501077_0047274 3300049593 Bacteria 2734
170 Ga0501079_0000263 3300049741 Bacteria 32250
171 Ga0501079_0003393 3300049741 Bacteria 11690
172 Ga0501079_0008032 3300049741 Bacteria 7996
173 Ga0501080_0000155 3300049742 Bacteria 49054
174 Ga0501080_0034390 3300049742 Bacteria 4731
175 Ga0501080_0068347 3300049742 Bacteria 3305
176 Ga0501081_0000009 3300049743 Bacteria 70386
177 Ga0501081_0003235 3300049743 Bacteria 10359
178 Ga0501081_0004026 3300049743 Bacteria 9426
179 Ga0501083_0000077 3300049744 Bacteria 65581
180 Ga0501083_0026331 3300049744 Bacteria 4020
181 Ga0501083_0048172 3300049744 Bacteria 2877
182 Ga0501035_0002595 3300049822 Bacteria 17644
183 Ga0501035_0026405 3300049822 Bacteria 5312
184 Ga0501044_0010536 3300049823 Bacteria 10034
185 Ga0501045_0000349 3300049824 Bacteria 27341
186 Ga0501045_0004407 3300049824 Bacteria 9715
187 Ga0501045_0013931 3300049824 Bacteria 5689
188 Ga0501045_0019204 3300049824 Bacteria 4869
189 Ga0501045_0032791 3300049824 Bacteria 3764
190 Ga0501045_0088420 3300049824 Bacteria 2288
191 nmdc:mga0yw44_21171_c1 3300050492 Bacteria 3623
192 nmdc:mga05p37_37899_c1 3300050507 Bacteria 5913
193 nmdc:mga09592_13706_c1 3300050508 Bacteria 6624
194 nmdc:mga09592_32850_c1 3300050508 Bacteria 4327
195 nmdc:mga0qj67_4282_c1 3300050509 Bacteria 10345
196 nmdc:mga06r32_29209_c1 3300050510 Bacteria 5166
197 Ga0500635_0000094 3300053080 Bacteria 54438
198 Ga0500577_0013265 3300053142 Bacteria 2513
199 Ga0500645_004037 3300053730 Bacteria 5760
200 Ga0501084_0000416 3300054114 Bacteria 33003
201 Ga0501084_0000679 3300054114 Bacteria 25953
202 Ga0501084_0002271 3300054114 Bacteria 15437
203 Ga0501084_0020416 3300054114 Bacteria 5523
204 Ga0501084_0031735 3300054114 Bacteria 4417
205 Ga0501084_0033608 3300054114 Bacteria 4290
206 Ga0501084_0067764 3300054114 Bacteria 2988
207 Ga0501082_0002100 3300060353 Bacteria 17546
208 Ga0501082_0003481 3300060353 Bacteria 13727
209 Ga0501082_0047108 3300060353 Bacteria 3715
210 Ga0501082_0048856 3300060353 Bacteria 3647
211 Ga0501082_0106205 3300060353 Bacteria 2429
212 Ga0530510_0004052 3300061734 Bacteria 10113
213 Ga0530510_0004128 3300061734 Bacteria 10028
214 Ga0530510_0006875 3300061734 Bacteria 7931
215 Ga0530510_0015577 3300061734 Bacteria 5374
216 Ga0530510_0029549 3300061734 Bacteria 3934
217 Ga0530510_0040187 3300061734 Bacteria 3375
218 Ga0081538_10011802
219 LJQas_1001688
220 JGI25406J46586_10010843
221 Ga0070683_100065872
222 Ga0070674_100016245
223 Ga0070694_100037073
224 Ga0070679_100163886
225 Ga0070696_100032261
226 Ga0070702_100068309
227 Ga0081455_10030279
228 Ga0081455_10040667
229 Ga0081455_10135927
230 Ga0081538_10000324
231 Ga0081538_10000412
232 Ga0081538_10000461
233 Ga0081538_10000616
234 Ga0081538_10001046
235 Ga0081538_10004252
236 Ga0081538_10008251
237 Ga0081538_10027286
238 Ga0081538_10030606
239 Ga0081538_10062135
240 Ga0081540_1000955
241 Ga0081539_10001468
242 Ga0081539_10001832
243 Ga0075430_100003403
244 Ga0075430_100114742
245 Ga0075431_100008954
246 Ga0075429_100006833
247 Ga0075429_100025770
248 Ga0114129_10005355
249 Ga0105239_10255133
250 Ga0163162_10286639
251 Ga0157375_10088612
252 Ga0163163_10018707
253 Ga0207680_10022359
254 Ga0207661_10046025
255 Ga0207708_10106754
256 Ga0207702_10184756
257 Ga0207648_10044920
258 Ga0307513_10000353
259 Ga0316576_10062852
260 Ga0316578_10088354
261 Ga0307410_10036801
262 Ga0307411_10052303
263 Ga0316593_10005104
264 Ga0316584_0038561
265 Ga0395899_0080556
266 Ga0395898_0046846
267 Ga0316581_0003781
268 Ga0395901_0033615
269 Ga0466960_0028025
270 Ga0495650_0000079
271 Ga0496100_0008789
272 Ga0496102_0008007
273 Ga0496102_0015712
274 Ga0496103_0036219
275 Ga0496104_0040910
276 Ga0496107_0132182
277 Ga0496109_0048100
278 Ga0496109_0061228
279 Ga0496110_0110558
280 Ga0496110_0271048
281 Ga0496111_0072391
282 Ga0496112_0031584
283 Ga0496112_0052197
284 Ga0496114_0011908
285 Ga0496114_0023703
286 Ga0501031_0000328
287 Ga0501031_0000432
288 Ga0501031_0003533
289 Ga0501031_0038706
290 Ga0501031_0042312
291 Ga0501032_0007654
292 Ga0501032_0041088
293 Ga0501033_0037077
294 Ga0501033_0045899
295 Ga0501033_0122041
296 Ga0501034_0055680
297 Ga0501036_0001998
298 Ga0501036_0021194
299 Ga0501036_0062410
300 Ga0501037_0000348
301 Ga0501037_0027218
302 Ga0501037_0080369
303 Ga0501038_0000268
304 Ga0501038_0014134
305 Ga0501038_0088188
306 Ga0501038_0122941
307 Ga0501039_0000100
308 Ga0501039_0004731
309 Ga0501039_0007135
310 Ga0501039_0008962
311 Ga0501039_0029285
312 Ga0501039_0032484
313 Ga0501039_0096991
314 Ga0501040_0000151
315 Ga0501040_0003731
316 Ga0501040_0008700
317 Ga0501040_0026397
318 Ga0501040_0028937
319 Ga0501040_0030372
320 Ga0501040_0040219
321 Ga0501041_0004021
322 Ga0501041_0004556
323 Ga0501041_0006442
324 Ga0501041_0010585
325 Ga0501041_0034616
326 Ga0501041_0040399
327 Ga0501041_0064132
328 Ga0501042_0000021
329 Ga0501042_0000492
330 Ga0501042_0001176
331 Ga0501042_0003286
332 Ga0501042_0008110
333 Ga0501042_0092077
334 Ga0501043_0012753
335 Ga0501043_0029795
336 Ga0501046_0002727
337 Ga0501046_0006736
338 Ga0501046_0010716
339 Ga0501046_0040005
340 Ga0501046_0136418
341 Ga0501047_0002457
342 Ga0501048_0000086
343 Ga0501048_0002806
344 Ga0501048_0024048
345 Ga0501048_0044420
346 Ga0501048_0053449
347 Ga0501048_0062899
348 Ga0501048_0065911
349 Ga0501068_0001822
350 Ga0501068_0029842
351 Ga0501068_0078230
352 Ga0501069_0002579
353 Ga0501070_0000379
354 Ga0501070_0094955
355 Ga0501071_0000014
356 Ga0501071_0009691
357 Ga0501071_0021531
358 Ga0501071_0084265
359 Ga0501071_0087373
360 Ga0501072_0001456
361 Ga0501072_0003232
362 Ga0501072_0021621
363 Ga0501072_0025349
364 Ga0501072_0061339
365 Ga0501072_0081867
366 Ga0501073_0084400
367 Ga0501073_0084486
368 Ga0501074_0013072
369 Ga0501074_0016093
370 Ga0501074_0064098
371 Ga0501075_0003179
372 Ga0501075_0003428
373 Ga0501075_0024838
374 Ga0501075_0030263
375 Ga0501075_0041529
376 Ga0501075_0158462
377 Ga0501076_0000355
378 Ga0501076_0001973
379 Ga0501076_0010035
380 Ga0501076_0013862
381 Ga0501076_0072475
382 Ga0501076_0074838
383 Ga0501077_0000427
384 Ga0501077_0003978
385 Ga0501077_0008936
386 Ga0501077_0047274
387 Ga0501079_0000263
388 Ga0501079_0003393
389 Ga0501079_0008032
390 Ga0501080_0000155
391 Ga0501080_0034390
392 Ga0501080_0068347
393 Ga0501081_0000009
394 Ga0501081_0003235
395 Ga0501081_0004026
396 Ga0501083_0000077
397 Ga0501083_0026331
398 Ga0501083_0048172
399 Ga0501035_0002595
400 Ga0501035_0026405
401 Ga0501044_0010536
402 Ga0501045_0000349
403 Ga0501045_0004407
404 Ga0501045_0013931
405 Ga0501045_0019204
406 Ga0501045_0032791
407 Ga0501045_0088420
408 nmdc:mga0yw44_21171_c1
409 nmdc:mga05p37_37899_c1
410 nmdc:mga09592_13706_c1
411 nmdc:mga09592_32850_c1
412 nmdc:mga0qj67_4282_c1
413 nmdc:mga06r32_29209_c1
414 Ga0500635_0000094
415 Ga0500577_0013265
416 Ga0500645_004037
417 Ga0501084_0000416
418 Ga0501084_0000679
419 Ga0501084_0002271
420 Ga0501084_0020416
421 Ga0501084_0031735
422 Ga0501084_0033608
423 Ga0501084_0067764
424 Ga0501082_0002100
425 Ga0501082_0003481
426 Ga0501082_0047108
427 Ga0501082_0048856
428 Ga0501082_0106205
429 Ga0530510_0004052
430 Ga0530510_0004128
431 Ga0530510_0006875
432 Ga0530510_0015577
433 Ga0530510_0029549
434 Ga0530510_0040187

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01935

DUF87

Helicase HerA, central domain

169

358

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kfu-assembly1.cif.gz_A structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with amppcp 0.7647 151 475
4r2h-assembly1.cif.gz_A the crystal structure of b204, the dna-packaging atpase from sulfolobus turreted icosahedral virus 0.7617 152 472
7uqj-assembly1.cif.gz_E cryo-em structure of the s. cerevisiae chromatin remodeler yta7 hexamer bound to atpgs and histone h3 tail in state ii 0.7606 342 413
4kfu-assembly1.cif.gz_A structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with amppcp 0.7585 151 475
4kft-assembly2.cif.gz_B structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with atp-gammas 0.7584 151 472
ID Description Score Start End Superfamily
af_Q58960_288_484_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8974 331 484 3.40.50.300
af_Q58824_271_495_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8847 310 486 3.40.50.300
4d2iB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8392 113 487 3.40.50.300
4d2iB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8304 113 487 3.40.50.300
af_I1LHT2_346_517_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7817 341 422 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J5ULH2-F1-model_v4 DUF87 domain-containing protein 0.974 132 492 GO:0016887
AF-A0A3D0RWG0-F1-model_v4 ATP-binding protein 0.9687 1 492 GO:0005524
GO:0016887
AF-A0A3D0RWG0-F1-model_v4 ATP-binding protein 0.9629 1 492 GO:0005524
GO:0016887
AF-A0A7J5ULH2-F1-model_v4 DUF87 domain-containing protein 0.9609 132 492 GO:0016887
AF-A0A7J9UUU8-F1-model_v4 DUF87 domain-containing protein 0.9496 55 492 GO:0016887

Map