F328593
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 217 | 91 | 434 | 496 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10011802|Ga0081538_100118022 |
| Length | 573 |
| Sequence | MESRDDVKKIRIGAMEQLGAIPKVLKELQELVPLLSVAYSTDGRTFGYESPLSMSIPVGSYVTLTAQGGNEYLGQVVTKEVSVRQGAEIGLELDPSLSALLPEGISFSSSHTYPLQRRYAHGSGVILGKLENDRYVPTTNEDGFQSADLAPAGESLVAAYLAAEGRAKLDVGRALYTEGRVHVPLKAEGFDRHTFLCGQSGSGKTFALGVILERLLLETELKVVILDPNSDFVRLDRVRTRDEVNRTRSSVLSPECYENLLAHYRRVASKLRILRPAPYAENRSKLLRIRFSDLERHEQGLVLGLDPLRDREEFNAYWRAIEGLARDRYSLSEVKEVVVRQFSEDARRLGLRIENLGVADWSLWCESDEPSLVDVLEEDWRCLIVDSGTLASPAEQSIVAMAVLGHLWRHRNERHPVLIVADEAHNICPQEPADSLEAAATSHAVKIAGEGRKFGLYLLVATQRPSKIHANVLSQCDNLALMKMNSVSDLAHISQILSQAPATFLDQSSHFAQGECLLAGKMVRNPTFVAFEGRFSEEGGTDVPSSWASRDENRMLQRPDGGHESPAHGGGSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 14 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 15 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 16 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 27 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 28 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 29 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 30 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 31 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 33 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 34 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 35 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 36 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 37 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 38 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 39 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 40 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 41 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 42 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 43 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 44 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 45 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 46 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 47 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 48 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 49 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 50 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 51 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 52 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 53 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 54 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 55 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 56 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 57 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 58 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 59 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 60 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 61 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 62 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 65 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 66 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 67 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 74 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 75 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 76 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 77 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 78 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 79 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 81 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 82 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 83 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 84 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 85 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 86 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 87 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 88 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 89 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 90 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.84 |
| Nodule | 0 |
| Rhizoplane | 6.91 |
| Rhizosphere | 90.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081538_10011802 | 3300005981 | Bacteria | 7051 |
| 2 | LJQas_1001688 | 3300000549 | Bacteria | 3244 |
| 3 | JGI25406J46586_10010843 | 3300003203 | Bacteria | 4020 |
| 4 | Ga0070683_100065872 | 3300005329 | Bacteria | 3374 |
| 5 | Ga0070674_100016245 | 3300005356 | Bacteria | 4664 |
| 6 | Ga0070694_100037073 | 3300005444 | Bacteria | 3233 |
| 7 | Ga0070679_100163886 | 3300005530 | Bacteria | 2197 |
| 8 | Ga0070696_100032261 | 3300005546 | Bacteria | 3593 |
| 9 | Ga0070702_100068309 | 3300005615 | Bacteria | 2091 |
| 10 | Ga0081455_10030279 | 3300005937 | Bacteria | 4919 |
| 11 | Ga0081455_10040667 | 3300005937 | Bacteria | 4097 |
| 12 | Ga0081455_10135927 | 3300005937 | Bacteria | 1916 |
| 13 | Ga0081538_10000324 | 3300005981 | Bacteria | 54756 |
| 14 | Ga0081538_10000412 | 3300005981 | Bacteria | 48367 |
| 15 | Ga0081538_10000461 | 3300005981 | Bacteria | 45573 |
| 16 | Ga0081538_10000616 | 3300005981 | Bacteria | 39495 |
| 17 | Ga0081538_10001046 | 3300005981 | Bacteria | 29493 |
| 18 | Ga0081538_10004252 | 3300005981 | Bacteria | 13280 |
| 19 | Ga0081538_10008251 | 3300005981 | Bacteria | 8874 |
| 20 | Ga0081538_10027286 | 3300005981 | Bacteria | 3964 |
| 21 | Ga0081538_10030606 | 3300005981 | Bacteria | 3649 |
| 22 | Ga0081538_10062135 | 3300005981 | Bacteria | 2132 |
| 23 | Ga0081540_1000955 | 3300005983 | Bacteria | 26064 |
| 24 | Ga0081539_10001468 | 3300005985 | Bacteria | 39989 |
| 25 | Ga0081539_10001832 | 3300005985 | Bacteria | 33546 |
| 26 | Ga0075430_100003403 | 3300006846 | Bacteria | 13292 |
| 27 | Ga0075430_100114742 | 3300006846 | Bacteria | 2244 |
| 28 | Ga0075431_100008954 | 3300006847 | Bacteria | 10033 |
| 29 | Ga0075429_100006833 | 3300006880 | Bacteria | 9900 |
| 30 | Ga0075429_100025770 | 3300006880 | Bacteria | 5106 |
| 31 | Ga0114129_10005355 | 3300009147 | Bacteria | 18110 |
| 32 | Ga0105239_10255133 | 3300010375 | Unclassified | 1970 |
| 33 | Ga0163162_10286639 | 3300013306 | Bacteria | 1779 |
| 34 | Ga0157375_10088612 | 3300013308 | Bacteria | 3150 |
| 35 | Ga0163163_10018707 | 3300014325 | Bacteria | 6492 |
| 36 | Ga0207680_10022359 | 3300025903 | Bacteria | 3437 |
| 37 | Ga0207661_10046025 | 3300025944 | Bacteria | 3458 |
| 38 | Ga0207708_10106754 | 3300026075 | Bacteria | 2171 |
| 39 | Ga0207702_10184756 | 3300026078 | Bacteria | 1922 |
| 40 | Ga0207648_10044920 | 3300026089 | Bacteria | 3876 |
| 41 | Ga0307513_10000353 | 3300031456 | Bacteria | 67041 |
| 42 | Ga0316576_10062852 | 3300031727 | Bacteria | 2724 |
| 43 | Ga0316578_10088354 | 3300031728 | Bacteria | 1849 |
| 44 | Ga0307410_10036801 | 3300031852 | Bacteria | 3191 |
| 45 | Ga0307411_10052303 | 3300032005 | Bacteria | 2670 |
| 46 | Ga0316593_10005104 | 3300032168 | Bacteria | 3433 |
| 47 | Ga0316584_0038561 | 3300036712 | Bacteria | 3554 |
| 48 | Ga0395899_0080556 | 3300037312 | Bacteria | 2370 |
| 49 | Ga0395898_0046846 | 3300037466 | Bacteria | 4246 |
| 50 | Ga0316581_0003781 | 3300037588 | Unclassified | 3803 |
| 51 | Ga0395901_0033615 | 3300038443 | Bacteria | 5295 |
| 52 | Ga0466960_0028025 | 3300044901 | Bacteria | 2575 |
| 53 | Ga0495650_0000079 | 3300046471 | Bacteria | 244549 |
| 54 | Ga0496100_0008789 | 3300048903 | Bacteria | 5649 |
| 55 | Ga0496102_0008007 | 3300048905 | Bacteria | 9033 |
| 56 | Ga0496102_0015712 | 3300048905 | Bacteria | 6595 |
| 57 | Ga0496103_0036219 | 3300048906 | Bacteria | 3021 |
| 58 | Ga0496104_0040910 | 3300048907 | Bacteria | 4346 |
| 59 | Ga0496107_0132182 | 3300048910 | Bacteria | 1843 |
| 60 | Ga0496109_0048100 | 3300048912 | Bacteria | 3880 |
| 61 | Ga0496109_0061228 | 3300048912 | Bacteria | 3440 |
| 62 | Ga0496110_0110558 | 3300048913 | Bacteria | 2469 |
| 63 | Ga0496110_0271048 | 3300048913 | Bacteria | 1545 |
| 64 | Ga0496111_0072391 | 3300048914 | Bacteria | 2509 |
| 65 | Ga0496112_0031584 | 3300048915 | Bacteria | 5138 |
| 66 | Ga0496112_0052197 | 3300048915 | Bacteria | 4012 |
| 67 | Ga0496114_0011908 | 3300048917 | Bacteria | 6960 |
| 68 | Ga0496114_0023703 | 3300048917 | Bacteria | 5009 |
| 69 | Ga0501031_0000328 | 3300049568 | Bacteria | 27375 |
| 70 | Ga0501031_0000432 | 3300049568 | Bacteria | 24102 |
| 71 | Ga0501031_0003533 | 3300049568 | Bacteria | 10031 |
| 72 | Ga0501031_0038706 | 3300049568 | Bacteria | 3112 |
| 73 | Ga0501031_0042312 | 3300049568 | Bacteria | 2974 |
| 74 | Ga0501032_0007654 | 3300049569 | Bacteria | 7876 |
| 75 | Ga0501032_0041088 | 3300049569 | Bacteria | 3142 |
| 76 | Ga0501033_0037077 | 3300049570 | Bacteria | 3650 |
| 77 | Ga0501033_0045899 | 3300049570 | Bacteria | 3250 |
| 78 | Ga0501033_0122041 | 3300049570 | Bacteria | 1890 |
| 79 | Ga0501034_0055680 | 3300049571 | Bacteria | 3979 |
| 80 | Ga0501036_0001998 | 3300049572 | Bacteria | 15845 |
| 81 | Ga0501036_0021194 | 3300049572 | Bacteria | 5459 |
| 82 | Ga0501036_0062410 | 3300049572 | Bacteria | 3156 |
| 83 | Ga0501037_0000348 | 3300049573 | Bacteria | 38976 |
| 84 | Ga0501037_0027218 | 3300049573 | Bacteria | 4223 |
| 85 | Ga0501037_0080369 | 3300049573 | Bacteria | 2366 |
| 86 | Ga0501038_0000268 | 3300049574 | Bacteria | 44025 |
| 87 | Ga0501038_0014134 | 3300049574 | Bacteria | 7273 |
| 88 | Ga0501038_0088188 | 3300049574 | Bacteria | 2604 |
| 89 | Ga0501038_0122941 | 3300049574 | Bacteria | 2138 |
| 90 | Ga0501039_0000100 | 3300049575 | Bacteria | 60151 |
| 91 | Ga0501039_0004731 | 3300049575 | Bacteria | 10306 |
| 92 | Ga0501039_0007135 | 3300049575 | Bacteria | 8513 |
| 93 | Ga0501039_0008962 | 3300049575 | Bacteria | 7624 |
| 94 | Ga0501039_0029285 | 3300049575 | Bacteria | 4240 |
| 95 | Ga0501039_0032484 | 3300049575 | Bacteria | 4024 |
| 96 | Ga0501039_0096991 | 3300049575 | Bacteria | 2299 |
| 97 | Ga0501040_0000151 | 3300049576 | Bacteria | 38289 |
| 98 | Ga0501040_0003731 | 3300049576 | Bacteria | 9874 |
| 99 | Ga0501040_0008700 | 3300049576 | Bacteria | 6592 |
| 100 | Ga0501040_0026397 | 3300049576 | Bacteria | 3906 |
| 101 | Ga0501040_0028937 | 3300049576 | Bacteria | 3736 |
| 102 | Ga0501040_0030372 | 3300049576 | Bacteria | 3650 |
| 103 | Ga0501040_0040219 | 3300049576 | Bacteria | 3181 |
| 104 | Ga0501041_0004021 | 3300049577 | Bacteria | 8491 |
| 105 | Ga0501041_0004556 | 3300049577 | Bacteria | 8041 |
| 106 | Ga0501041_0006442 | 3300049577 | Bacteria | 6871 |
| 107 | Ga0501041_0010585 | 3300049577 | Bacteria | 5436 |
| 108 | Ga0501041_0034616 | 3300049577 | Bacteria | 3058 |
| 109 | Ga0501041_0040399 | 3300049577 | Bacteria | 2831 |
| 110 | Ga0501041_0064132 | 3300049577 | Bacteria | 2250 |
| 111 | Ga0501042_0000021 | 3300049578 | Bacteria | 50302 |
| 112 | Ga0501042_0000492 | 3300049578 | Bacteria | 20529 |
| 113 | Ga0501042_0001176 | 3300049578 | Bacteria | 15152 |
| 114 | Ga0501042_0003286 | 3300049578 | Bacteria | 10117 |
| 115 | Ga0501042_0008110 | 3300049578 | Bacteria | 6915 |
| 116 | Ga0501042_0092077 | 3300049578 | Bacteria | 2176 |
| 117 | Ga0501043_0012753 | 3300049579 | Bacteria | 6569 |
| 118 | Ga0501043_0029795 | 3300049579 | Bacteria | 4288 |
| 119 | Ga0501046_0002727 | 3300049580 | Bacteria | 16440 |
| 120 | Ga0501046_0006736 | 3300049580 | Bacteria | 10148 |
| 121 | Ga0501046_0010716 | 3300049580 | Bacteria | 7863 |
| 122 | Ga0501046_0040005 | 3300049580 | Bacteria | 3749 |
| 123 | Ga0501046_0136418 | 3300049580 | Bacteria | 1858 |
| 124 | Ga0501047_0002457 | 3300049581 | Bacteria | 17693 |
| 125 | Ga0501048_0000086 | 3300049582 | Bacteria | 48595 |
| 126 | Ga0501048_0002806 | 3300049582 | Bacteria | 13292 |
| 127 | Ga0501048_0024048 | 3300049582 | Bacteria | 4448 |
| 128 | Ga0501048_0044420 | 3300049582 | Bacteria | 3177 |
| 129 | Ga0501048_0053449 | 3300049582 | Bacteria | 2872 |
| 130 | Ga0501048_0062899 | 3300049582 | Bacteria | 2626 |
| 131 | Ga0501048_0065911 | 3300049582 | Bacteria | 2560 |
| 132 | Ga0501068_0001822 | 3300049584 | Bacteria | 11313 |
| 133 | Ga0501068_0029842 | 3300049584 | Bacteria | 3232 |
| 134 | Ga0501068_0078230 | 3300049584 | Bacteria | 2026 |
| 135 | Ga0501069_0002579 | 3300049585 | Bacteria | 9252 |
| 136 | Ga0501070_0000379 | 3300049586 | Bacteria | 40548 |
| 137 | Ga0501070_0094955 | 3300049586 | Bacteria | 2467 |
| 138 | Ga0501071_0000014 | 3300049587 | Bacteria | 60053 |
| 139 | Ga0501071_0009691 | 3300049587 | Bacteria | 6427 |
| 140 | Ga0501071_0021531 | 3300049587 | Bacteria | 4490 |
| 141 | Ga0501071_0084265 | 3300049587 | Bacteria | 2329 |
| 142 | Ga0501071_0087373 | 3300049587 | Bacteria | 2287 |
| 143 | Ga0501072_0001456 | 3300049588 | Bacteria | 17747 |
| 144 | Ga0501072_0003232 | 3300049588 | Bacteria | 12228 |
| 145 | Ga0501072_0021621 | 3300049588 | Bacteria | 4989 |
| 146 | Ga0501072_0025349 | 3300049588 | Bacteria | 4619 |
| 147 | Ga0501072_0061339 | 3300049588 | Bacteria | 2966 |
| 148 | Ga0501072_0081867 | 3300049588 | Bacteria | 2559 |
| 149 | Ga0501073_0084400 | 3300049589 | Bacteria | 2210 |
| 150 | Ga0501073_0084486 | 3300049589 | Bacteria | 2208 |
| 151 | Ga0501074_0013072 | 3300049590 | Bacteria | 6034 |
| 152 | Ga0501074_0016093 | 3300049590 | Bacteria | 5436 |
| 153 | Ga0501074_0064098 | 3300049590 | Bacteria | 2646 |
| 154 | Ga0501075_0003179 | 3300049591 | Bacteria | 11000 |
| 155 | Ga0501075_0003428 | 3300049591 | Bacteria | 10608 |
| 156 | Ga0501075_0024838 | 3300049591 | Bacteria | 4399 |
| 157 | Ga0501075_0030263 | 3300049591 | Bacteria | 4009 |
| 158 | Ga0501075_0041529 | 3300049591 | Bacteria | 3446 |
| 159 | Ga0501075_0158462 | 3300049591 | Bacteria | 1726 |
| 160 | Ga0501076_0000355 | 3300049592 | Bacteria | 28426 |
| 161 | Ga0501076_0001973 | 3300049592 | Bacteria | 14007 |
| 162 | Ga0501076_0010035 | 3300049592 | Bacteria | 7007 |
| 163 | Ga0501076_0013862 | 3300049592 | Bacteria | 6052 |
| 164 | Ga0501076_0072475 | 3300049592 | Bacteria | 2756 |
| 165 | Ga0501076_0074838 | 3300049592 | Bacteria | 2714 |
| 166 | Ga0501077_0000427 | 3300049593 | Bacteria | 25498 |
| 167 | Ga0501077_0003978 | 3300049593 | Bacteria | 8916 |
| 168 | Ga0501077_0008936 | 3300049593 | Bacteria | 6216 |
| 169 | Ga0501077_0047274 | 3300049593 | Bacteria | 2734 |
| 170 | Ga0501079_0000263 | 3300049741 | Bacteria | 32250 |
| 171 | Ga0501079_0003393 | 3300049741 | Bacteria | 11690 |
| 172 | Ga0501079_0008032 | 3300049741 | Bacteria | 7996 |
| 173 | Ga0501080_0000155 | 3300049742 | Bacteria | 49054 |
| 174 | Ga0501080_0034390 | 3300049742 | Bacteria | 4731 |
| 175 | Ga0501080_0068347 | 3300049742 | Bacteria | 3305 |
| 176 | Ga0501081_0000009 | 3300049743 | Bacteria | 70386 |
| 177 | Ga0501081_0003235 | 3300049743 | Bacteria | 10359 |
| 178 | Ga0501081_0004026 | 3300049743 | Bacteria | 9426 |
| 179 | Ga0501083_0000077 | 3300049744 | Bacteria | 65581 |
| 180 | Ga0501083_0026331 | 3300049744 | Bacteria | 4020 |
| 181 | Ga0501083_0048172 | 3300049744 | Bacteria | 2877 |
| 182 | Ga0501035_0002595 | 3300049822 | Bacteria | 17644 |
| 183 | Ga0501035_0026405 | 3300049822 | Bacteria | 5312 |
| 184 | Ga0501044_0010536 | 3300049823 | Bacteria | 10034 |
| 185 | Ga0501045_0000349 | 3300049824 | Bacteria | 27341 |
| 186 | Ga0501045_0004407 | 3300049824 | Bacteria | 9715 |
| 187 | Ga0501045_0013931 | 3300049824 | Bacteria | 5689 |
| 188 | Ga0501045_0019204 | 3300049824 | Bacteria | 4869 |
| 189 | Ga0501045_0032791 | 3300049824 | Bacteria | 3764 |
| 190 | Ga0501045_0088420 | 3300049824 | Bacteria | 2288 |
| 191 | nmdc:mga0yw44_21171_c1 | 3300050492 | Bacteria | 3623 |
| 192 | nmdc:mga05p37_37899_c1 | 3300050507 | Bacteria | 5913 |
| 193 | nmdc:mga09592_13706_c1 | 3300050508 | Bacteria | 6624 |
| 194 | nmdc:mga09592_32850_c1 | 3300050508 | Bacteria | 4327 |
| 195 | nmdc:mga0qj67_4282_c1 | 3300050509 | Bacteria | 10345 |
| 196 | nmdc:mga06r32_29209_c1 | 3300050510 | Bacteria | 5166 |
| 197 | Ga0500635_0000094 | 3300053080 | Bacteria | 54438 |
| 198 | Ga0500577_0013265 | 3300053142 | Bacteria | 2513 |
| 199 | Ga0500645_004037 | 3300053730 | Bacteria | 5760 |
| 200 | Ga0501084_0000416 | 3300054114 | Bacteria | 33003 |
| 201 | Ga0501084_0000679 | 3300054114 | Bacteria | 25953 |
| 202 | Ga0501084_0002271 | 3300054114 | Bacteria | 15437 |
| 203 | Ga0501084_0020416 | 3300054114 | Bacteria | 5523 |
| 204 | Ga0501084_0031735 | 3300054114 | Bacteria | 4417 |
| 205 | Ga0501084_0033608 | 3300054114 | Bacteria | 4290 |
| 206 | Ga0501084_0067764 | 3300054114 | Bacteria | 2988 |
| 207 | Ga0501082_0002100 | 3300060353 | Bacteria | 17546 |
| 208 | Ga0501082_0003481 | 3300060353 | Bacteria | 13727 |
| 209 | Ga0501082_0047108 | 3300060353 | Bacteria | 3715 |
| 210 | Ga0501082_0048856 | 3300060353 | Bacteria | 3647 |
| 211 | Ga0501082_0106205 | 3300060353 | Bacteria | 2429 |
| 212 | Ga0530510_0004052 | 3300061734 | Bacteria | 10113 |
| 213 | Ga0530510_0004128 | 3300061734 | Bacteria | 10028 |
| 214 | Ga0530510_0006875 | 3300061734 | Bacteria | 7931 |
| 215 | Ga0530510_0015577 | 3300061734 | Bacteria | 5374 |
| 216 | Ga0530510_0029549 | 3300061734 | Bacteria | 3934 |
| 217 | Ga0530510_0040187 | 3300061734 | Bacteria | 3375 |
| 218 | Ga0081538_10011802 | |||
| 219 | LJQas_1001688 | |||
| 220 | JGI25406J46586_10010843 | |||
| 221 | Ga0070683_100065872 | |||
| 222 | Ga0070674_100016245 | |||
| 223 | Ga0070694_100037073 | |||
| 224 | Ga0070679_100163886 | |||
| 225 | Ga0070696_100032261 | |||
| 226 | Ga0070702_100068309 | |||
| 227 | Ga0081455_10030279 | |||
| 228 | Ga0081455_10040667 | |||
| 229 | Ga0081455_10135927 | |||
| 230 | Ga0081538_10000324 | |||
| 231 | Ga0081538_10000412 | |||
| 232 | Ga0081538_10000461 | |||
| 233 | Ga0081538_10000616 | |||
| 234 | Ga0081538_10001046 | |||
| 235 | Ga0081538_10004252 | |||
| 236 | Ga0081538_10008251 | |||
| 237 | Ga0081538_10027286 | |||
| 238 | Ga0081538_10030606 | |||
| 239 | Ga0081538_10062135 | |||
| 240 | Ga0081540_1000955 | |||
| 241 | Ga0081539_10001468 | |||
| 242 | Ga0081539_10001832 | |||
| 243 | Ga0075430_100003403 | |||
| 244 | Ga0075430_100114742 | |||
| 245 | Ga0075431_100008954 | |||
| 246 | Ga0075429_100006833 | |||
| 247 | Ga0075429_100025770 | |||
| 248 | Ga0114129_10005355 | |||
| 249 | Ga0105239_10255133 | |||
| 250 | Ga0163162_10286639 | |||
| 251 | Ga0157375_10088612 | |||
| 252 | Ga0163163_10018707 | |||
| 253 | Ga0207680_10022359 | |||
| 254 | Ga0207661_10046025 | |||
| 255 | Ga0207708_10106754 | |||
| 256 | Ga0207702_10184756 | |||
| 257 | Ga0207648_10044920 | |||
| 258 | Ga0307513_10000353 | |||
| 259 | Ga0316576_10062852 | |||
| 260 | Ga0316578_10088354 | |||
| 261 | Ga0307410_10036801 | |||
| 262 | Ga0307411_10052303 | |||
| 263 | Ga0316593_10005104 | |||
| 264 | Ga0316584_0038561 | |||
| 265 | Ga0395899_0080556 | |||
| 266 | Ga0395898_0046846 | |||
| 267 | Ga0316581_0003781 | |||
| 268 | Ga0395901_0033615 | |||
| 269 | Ga0466960_0028025 | |||
| 270 | Ga0495650_0000079 | |||
| 271 | Ga0496100_0008789 | |||
| 272 | Ga0496102_0008007 | |||
| 273 | Ga0496102_0015712 | |||
| 274 | Ga0496103_0036219 | |||
| 275 | Ga0496104_0040910 | |||
| 276 | Ga0496107_0132182 | |||
| 277 | Ga0496109_0048100 | |||
| 278 | Ga0496109_0061228 | |||
| 279 | Ga0496110_0110558 | |||
| 280 | Ga0496110_0271048 | |||
| 281 | Ga0496111_0072391 | |||
| 282 | Ga0496112_0031584 | |||
| 283 | Ga0496112_0052197 | |||
| 284 | Ga0496114_0011908 | |||
| 285 | Ga0496114_0023703 | |||
| 286 | Ga0501031_0000328 | |||
| 287 | Ga0501031_0000432 | |||
| 288 | Ga0501031_0003533 | |||
| 289 | Ga0501031_0038706 | |||
| 290 | Ga0501031_0042312 | |||
| 291 | Ga0501032_0007654 | |||
| 292 | Ga0501032_0041088 | |||
| 293 | Ga0501033_0037077 | |||
| 294 | Ga0501033_0045899 | |||
| 295 | Ga0501033_0122041 | |||
| 296 | Ga0501034_0055680 | |||
| 297 | Ga0501036_0001998 | |||
| 298 | Ga0501036_0021194 | |||
| 299 | Ga0501036_0062410 | |||
| 300 | Ga0501037_0000348 | |||
| 301 | Ga0501037_0027218 | |||
| 302 | Ga0501037_0080369 | |||
| 303 | Ga0501038_0000268 | |||
| 304 | Ga0501038_0014134 | |||
| 305 | Ga0501038_0088188 | |||
| 306 | Ga0501038_0122941 | |||
| 307 | Ga0501039_0000100 | |||
| 308 | Ga0501039_0004731 | |||
| 309 | Ga0501039_0007135 | |||
| 310 | Ga0501039_0008962 | |||
| 311 | Ga0501039_0029285 | |||
| 312 | Ga0501039_0032484 | |||
| 313 | Ga0501039_0096991 | |||
| 314 | Ga0501040_0000151 | |||
| 315 | Ga0501040_0003731 | |||
| 316 | Ga0501040_0008700 | |||
| 317 | Ga0501040_0026397 | |||
| 318 | Ga0501040_0028937 | |||
| 319 | Ga0501040_0030372 | |||
| 320 | Ga0501040_0040219 | |||
| 321 | Ga0501041_0004021 | |||
| 322 | Ga0501041_0004556 | |||
| 323 | Ga0501041_0006442 | |||
| 324 | Ga0501041_0010585 | |||
| 325 | Ga0501041_0034616 | |||
| 326 | Ga0501041_0040399 | |||
| 327 | Ga0501041_0064132 | |||
| 328 | Ga0501042_0000021 | |||
| 329 | Ga0501042_0000492 | |||
| 330 | Ga0501042_0001176 | |||
| 331 | Ga0501042_0003286 | |||
| 332 | Ga0501042_0008110 | |||
| 333 | Ga0501042_0092077 | |||
| 334 | Ga0501043_0012753 | |||
| 335 | Ga0501043_0029795 | |||
| 336 | Ga0501046_0002727 | |||
| 337 | Ga0501046_0006736 | |||
| 338 | Ga0501046_0010716 | |||
| 339 | Ga0501046_0040005 | |||
| 340 | Ga0501046_0136418 | |||
| 341 | Ga0501047_0002457 | |||
| 342 | Ga0501048_0000086 | |||
| 343 | Ga0501048_0002806 | |||
| 344 | Ga0501048_0024048 | |||
| 345 | Ga0501048_0044420 | |||
| 346 | Ga0501048_0053449 | |||
| 347 | Ga0501048_0062899 | |||
| 348 | Ga0501048_0065911 | |||
| 349 | Ga0501068_0001822 | |||
| 350 | Ga0501068_0029842 | |||
| 351 | Ga0501068_0078230 | |||
| 352 | Ga0501069_0002579 | |||
| 353 | Ga0501070_0000379 | |||
| 354 | Ga0501070_0094955 | |||
| 355 | Ga0501071_0000014 | |||
| 356 | Ga0501071_0009691 | |||
| 357 | Ga0501071_0021531 | |||
| 358 | Ga0501071_0084265 | |||
| 359 | Ga0501071_0087373 | |||
| 360 | Ga0501072_0001456 | |||
| 361 | Ga0501072_0003232 | |||
| 362 | Ga0501072_0021621 | |||
| 363 | Ga0501072_0025349 | |||
| 364 | Ga0501072_0061339 | |||
| 365 | Ga0501072_0081867 | |||
| 366 | Ga0501073_0084400 | |||
| 367 | Ga0501073_0084486 | |||
| 368 | Ga0501074_0013072 | |||
| 369 | Ga0501074_0016093 | |||
| 370 | Ga0501074_0064098 | |||
| 371 | Ga0501075_0003179 | |||
| 372 | Ga0501075_0003428 | |||
| 373 | Ga0501075_0024838 | |||
| 374 | Ga0501075_0030263 | |||
| 375 | Ga0501075_0041529 | |||
| 376 | Ga0501075_0158462 | |||
| 377 | Ga0501076_0000355 | |||
| 378 | Ga0501076_0001973 | |||
| 379 | Ga0501076_0010035 | |||
| 380 | Ga0501076_0013862 | |||
| 381 | Ga0501076_0072475 | |||
| 382 | Ga0501076_0074838 | |||
| 383 | Ga0501077_0000427 | |||
| 384 | Ga0501077_0003978 | |||
| 385 | Ga0501077_0008936 | |||
| 386 | Ga0501077_0047274 | |||
| 387 | Ga0501079_0000263 | |||
| 388 | Ga0501079_0003393 | |||
| 389 | Ga0501079_0008032 | |||
| 390 | Ga0501080_0000155 | |||
| 391 | Ga0501080_0034390 | |||
| 392 | Ga0501080_0068347 | |||
| 393 | Ga0501081_0000009 | |||
| 394 | Ga0501081_0003235 | |||
| 395 | Ga0501081_0004026 | |||
| 396 | Ga0501083_0000077 | |||
| 397 | Ga0501083_0026331 | |||
| 398 | Ga0501083_0048172 | |||
| 399 | Ga0501035_0002595 | |||
| 400 | Ga0501035_0026405 | |||
| 401 | Ga0501044_0010536 | |||
| 402 | Ga0501045_0000349 | |||
| 403 | Ga0501045_0004407 | |||
| 404 | Ga0501045_0013931 | |||
| 405 | Ga0501045_0019204 | |||
| 406 | Ga0501045_0032791 | |||
| 407 | Ga0501045_0088420 | |||
| 408 | nmdc:mga0yw44_21171_c1 | |||
| 409 | nmdc:mga05p37_37899_c1 | |||
| 410 | nmdc:mga09592_13706_c1 | |||
| 411 | nmdc:mga09592_32850_c1 | |||
| 412 | nmdc:mga0qj67_4282_c1 | |||
| 413 | nmdc:mga06r32_29209_c1 | |||
| 414 | Ga0500635_0000094 | |||
| 415 | Ga0500577_0013265 | |||
| 416 | Ga0500645_004037 | |||
| 417 | Ga0501084_0000416 | |||
| 418 | Ga0501084_0000679 | |||
| 419 | Ga0501084_0002271 | |||
| 420 | Ga0501084_0020416 | |||
| 421 | Ga0501084_0031735 | |||
| 422 | Ga0501084_0033608 | |||
| 423 | Ga0501084_0067764 | |||
| 424 | Ga0501082_0002100 | |||
| 425 | Ga0501082_0003481 | |||
| 426 | Ga0501082_0047108 | |||
| 427 | Ga0501082_0048856 | |||
| 428 | Ga0501082_0106205 | |||
| 429 | Ga0530510_0004052 | |||
| 430 | Ga0530510_0004128 | |||
| 431 | Ga0530510_0006875 | |||
| 432 | Ga0530510_0015577 | |||
| 433 | Ga0530510_0029549 | |||
| 434 | Ga0530510_0040187 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kfu-assembly1.cif.gz_A | structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with amppcp | 0.7647 | 151 | 475 |
| 4r2h-assembly1.cif.gz_A | the crystal structure of b204, the dna-packaging atpase from sulfolobus turreted icosahedral virus | 0.7617 | 152 | 472 |
| 7uqj-assembly1.cif.gz_E | cryo-em structure of the s. cerevisiae chromatin remodeler yta7 hexamer bound to atpgs and histone h3 tail in state ii | 0.7606 | 342 | 413 |
| 4kfu-assembly1.cif.gz_A | structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with amppcp | 0.7585 | 151 | 475 |
| 4kft-assembly2.cif.gz_B | structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with atp-gammas | 0.7584 | 151 | 472 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58960_288_484_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8974 | 331 | 484 | 3.40.50.300 |
| af_Q58824_271_495_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8847 | 310 | 486 | 3.40.50.300 |
| 4d2iB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8392 | 113 | 487 | 3.40.50.300 |
| 4d2iB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8304 | 113 | 487 | 3.40.50.300 |
| af_I1LHT2_346_517_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7817 | 341 | 422 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5ULH2-F1-model_v4 | DUF87 domain-containing protein | 0.974 | 132 | 492 |
GO:0016887
|
| AF-A0A3D0RWG0-F1-model_v4 | ATP-binding protein | 0.9687 | 1 | 492 |
GO:0005524
GO:0016887 |
| AF-A0A3D0RWG0-F1-model_v4 | ATP-binding protein | 0.9629 | 1 | 492 |
GO:0005524
GO:0016887 |
| AF-A0A7J5ULH2-F1-model_v4 | DUF87 domain-containing protein | 0.9609 | 132 | 492 |
GO:0016887
|
| AF-A0A7J9UUU8-F1-model_v4 | DUF87 domain-containing protein | 0.9496 | 55 | 492 |
GO:0016887
|