F328286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 217 | 161 | 217 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300003373|JGI25407J50210_10001354|JGI25407J50210_100013544 |
| Length | 379 |
| Sequence | MDLVQLEQRLAARGEPGFRARQVWEWAARGAGSYGVMTNLPRQLRERLSEELPFSSLQPVRGALASDGTEKALFMTADGRPLEAVLMRYRDGRRSLCLSSQSGCPLTCTFCATGRMRFGRNLTVSEILDQALHFRRREAVNHAVFMGMGEPLMNLDAVLGACERLPDVGIAHSNIGVSTVGWIPGIDRMASEGPPVRLALSVHAADEALRSELMPVNDRYPLRDVLDACLRWHDRRRRQVFIEYLMLDGVNDRYEQALALAGLLQPRHAFKVNLIPYNPTDAPYRGSGRQAILAFRSALEERGLRTTVRVTRGRDIDAACGQLAAMDSTXXVKXSRXXCGGRPSPGAWDGXRSFARXRXSPRXXACRSRGRQSASSSSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 88 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 90 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 91 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 92 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 94 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 95 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 96 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 99 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 100 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 101 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 102 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 103 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 104 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 105 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 106 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 107 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 133 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 134 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 137 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 138 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 141 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 142 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 143 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 153 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 161 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.92 |
| Nodule | 0 |
| Rhizoplane | 10.14 |
| Rhizosphere | 87.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008774 | 3300001979 | Bacteria | 4009 |
| 2 | JGI24748J21848_1000525 | 3300002074 | Bacteria | 4183 |
| 3 | JGI24034J26672_10000223 | 3300002239 | Bacteria | 7459 |
| 4 | JGI24742J22300_10001124 | 3300002244 | Bacteria | 4147 |
| 5 | JGI25407J50210_10001354 | 3300003373 | Bacteria | 5533 |
| 6 | Ga0070676_10120617 | 3300005328 | Bacteria | 1645 |
| 7 | Ga0070666_10050112 | 3300005335 | Bacteria | 2808 |
| 8 | Ga0070680_100014741 | 3300005336 | Bacteria | 6114 |
| 9 | Ga0070660_100009725 | 3300005339 | Bacteria | 6777 |
| 10 | Ga0070691_10003684 | 3300005341 | Bacteria | 6922 |
| 11 | Ga0070661_100078126 | 3300005344 | Bacteria | 2441 |
| 12 | Ga0070668_100016308 | 3300005347 | Bacteria | 5555 |
| 13 | Ga0070674_100000001 | 3300005356 | Bacteria | 277173 |
| 14 | Ga0070659_100054639 | 3300005366 | Bacteria | 3145 |
| 15 | Ga0070659_100062383 | 3300005366 | Bacteria | 2946 |
| 16 | Ga0070667_100020328 | 3300005367 | Bacteria | 5511 |
| 17 | Ga0070714_100296272 | 3300005435 | Bacteria | 1507 |
| 18 | Ga0070713_100073917 | 3300005436 | Bacteria | 2887 |
| 19 | Ga0070713_100254299 | 3300005436 | Bacteria | 1603 |
| 20 | Ga0070711_100088038 | 3300005439 | Bacteria | 2231 |
| 21 | Ga0070700_100021749 | 3300005441 | Bacteria | 3732 |
| 22 | Ga0070681_10003720 | 3300005458 | Bacteria | 14315 |
| 23 | Ga0068867_100000454 | 3300005459 | Bacteria | 27165 |
| 24 | Ga0070685_10050754 | 3300005466 | Bacteria | 2397 |
| 25 | Ga0070679_100000365 | 3300005530 | Bacteria | 38496 |
| 26 | Ga0070679_100076150 | 3300005530 | Bacteria | 3345 |
| 27 | Ga0070684_100023154 | 3300005535 | Bacteria | 5189 |
| 28 | Ga0070684_100062195 | 3300005535 | Bacteria | 3270 |
| 29 | Ga0070704_100152858 | 3300005549 | Bacteria | 1816 |
| 30 | Ga0068857_100137598 | 3300005577 | Bacteria | 2206 |
| 31 | Ga0068856_100026696 | 3300005614 | Bacteria | 5631 |
| 32 | Ga0068852_100006908 | 3300005616 | Bacteria | 8253 |
| 33 | Ga0068852_100124213 | 3300005616 | Bacteria | 2367 |
| 34 | Ga0068861_100002823 | 3300005719 | Bacteria | 11419 |
| 35 | Ga0068861_100154161 | 3300005719 | Bacteria | 1888 |
| 36 | Ga0068851_10106377 | 3300005834 | Bacteria | 1494 |
| 37 | Ga0081455_10045369 | 3300005937 | Bacteria | 3824 |
| 38 | Ga0081455_10054045 | 3300005937 | Bacteria | 3426 |
| 39 | Ga0081455_10208636 | 3300005937 | Bacteria | 1457 |
| 40 | Ga0081538_10000386 | 3300005981 | Bacteria | 50093 |
| 41 | Ga0081538_10001446 | 3300005981 | Bacteria | 24414 |
| 42 | Ga0081538_10018097 | 3300005981 | Bacteria | 5313 |
| 43 | Ga0081538_10025327 | 3300005981 | Bacteria | 4187 |
| 44 | Ga0081538_10078053 | 3300005981 | Bacteria | 1779 |
| 45 | Ga0081538_10109498 | 3300005981 | Bacteria | 1361 |
| 46 | Ga0081539_10002710 | 3300005985 | Bacteria | 24018 |
| 47 | Ga0070717_10127699 | 3300006028 | Bacteria | 2184 |
| 48 | Ga0075364_10049991 | 3300006051 | Bacteria | 2728 |
| 49 | Ga0070712_100003544 | 3300006175 | Bacteria | 9611 |
| 50 | Ga0075428_100008397 | 3300006844 | Bacteria | 11449 |
| 51 | Ga0075428_100015609 | 3300006844 | Bacteria | 8419 |
| 52 | Ga0075428_100467008 | 3300006844 | Bacteria | 1351 |
| 53 | Ga0075430_100002217 | 3300006846 | Bacteria | 16112 |
| 54 | Ga0075430_100176253 | 3300006846 | Bacteria | 1779 |
| 55 | Ga0075431_100003273 | 3300006847 | Bacteria | 15676 |
| 56 | Ga0105240_10245106 | 3300009093 | Bacteria | 2075 |
| 57 | Ga0111539_10006256 | 3300009094 | Bacteria | 15368 |
| 58 | Ga0111539_10399886 | 3300009094 | Bacteria | 1600 |
| 59 | Ga0105245_10005283 | 3300009098 | Bacteria | 11343 |
| 60 | Ga0105247_10000369 | 3300009101 | Bacteria | 38254 |
| 61 | Ga0114129_10000941 | 3300009147 | Bacteria | 38048 |
| 62 | Ga0114129_10001284 | 3300009147 | Bacteria | 33454 |
| 63 | Ga0105243_10093027 | 3300009148 | Bacteria | 2487 |
| 64 | Ga0105242_10004096 | 3300009176 | Bacteria | 11332 |
| 65 | Ga0105242_10062585 | 3300009176 | Bacteria | 3062 |
| 66 | Ga0105237_10043315 | 3300009545 | Bacteria | 4535 |
| 67 | Ga0105238_10073626 | 3300009551 | Bacteria | 3410 |
| 68 | Ga0105239_10037595 | 3300010375 | Bacteria | 5304 |
| 69 | Ga0105239_10206739 | 3300010375 | Bacteria | 2200 |
| 70 | Ga0157370_10059482 | 3300013104 | Bacteria | 3631 |
| 71 | Ga0157369_10019004 | 3300013105 | Bacteria | 7695 |
| 72 | Ga0157378_10088642 | 3300013297 | Bacteria | 2808 |
| 73 | Ga0163162_10485860 | 3300013306 | Bacteria | 1366 |
| 74 | Ga0157372_10022669 | 3300013307 | Bacteria | 6796 |
| 75 | Ga0157375_10000194 | 3300013308 | Bacteria | 56860 |
| 76 | Ga0163161_10103533 | 3300017792 | Bacteria | 2121 |
| 77 | Ga0163161_10144331 | 3300017792 | Bacteria | 1804 |
| 78 | Ga0206356_10451311 | 3300020070 | Bacteria | 2085 |
| 79 | Ga0206353_11215997 | 3300020082 | Bacteria | 9720 |
| 80 | Ga0207642_10000066 | 3300025899 | Bacteria | 28858 |
| 81 | Ga0207680_10006474 | 3300025903 | Bacteria | 5662 |
| 82 | Ga0207680_10039094 | 3300025903 | Bacteria | 2750 |
| 83 | Ga0207707_10249811 | 3300025912 | Bacteria | 1541 |
| 84 | Ga0207695_10175275 | 3300025913 | Bacteria | 2067 |
| 85 | Ga0207693_10000327 | 3300025915 | Bacteria | 43947 |
| 86 | Ga0207660_10018926 | 3300025917 | Bacteria | 4599 |
| 87 | Ga0207662_10079443 | 3300025918 | Bacteria | 1998 |
| 88 | Ga0207657_10086591 | 3300025919 | Bacteria | 2622 |
| 89 | Ga0207657_10175299 | 3300025919 | Bacteria | 1736 |
| 90 | Ga0207652_10000536 | 3300025921 | Bacteria | 38532 |
| 91 | Ga0207652_10004122 | 3300025921 | Bacteria | 11863 |
| 92 | Ga0207694_10078361 | 3300025924 | Bacteria | 2590 |
| 93 | Ga0207700_10111067 | 3300025928 | Bacteria | 2206 |
| 94 | Ga0207700_10325410 | 3300025928 | Bacteria | 1333 |
| 95 | Ga0207706_10001715 | 3300025933 | Bacteria | 21601 |
| 96 | Ga0207686_10002926 | 3300025934 | Bacteria | 9198 |
| 97 | Ga0207686_10034027 | 3300025934 | Bacteria | 3047 |
| 98 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 99 | Ga0207689_10356857 | 3300025942 | Bacteria | 1215 |
| 100 | Ga0207679_10116395 | 3300025945 | Bacteria | 2119 |
| 101 | Ga0207712_10045306 | 3300025961 | Bacteria | 3045 |
| 102 | Ga0207668_10011009 | 3300025972 | Bacteria | 5485 |
| 103 | Ga0207640_10000669 | 3300025981 | Bacteria | 19997 |
| 104 | Ga0207640_10199284 | 3300025981 | Bacteria | 1516 |
| 105 | Ga0207658_10131603 | 3300025986 | Bacteria | 2010 |
| 106 | Ga0207639_10011058 | 3300026041 | Bacteria | 6260 |
| 107 | Ga0207708_10031129 | 3300026075 | Bacteria | 4049 |
| 108 | Ga0207702_10028772 | 3300026078 | Bacteria | 4621 |
| 109 | Ga0207648_10009090 | 3300026089 | Bacteria | 9553 |
| 110 | Ga0207648_10036925 | 3300026089 | Bacteria | 4304 |
| 111 | Ga0207674_10069889 | 3300026116 | Bacteria | 3530 |
| 112 | Ga0207675_100000091 | 3300026118 | Bacteria | 70559 |
| 113 | Ga0207675_100201502 | 3300026118 | Bacteria | 1912 |
| 114 | Ga0207428_10073977 | 3300027907 | Bacteria | 2672 |
| 115 | Ga0268266_10001842 | 3300028379 | Bacteria | 23945 |
| 116 | Ga0265322_10022851 | 3300028654 | Bacteria | 1789 |
| 117 | Ga0265338_10005918 | 3300028800 | Bacteria | 15760 |
| 118 | Ga0307405_10072357 | 3300031731 | Bacteria | 2222 |
| 119 | Ga0307410_10027225 | 3300031852 | Bacteria | 3611 |
| 120 | Ga0307407_10273219 | 3300031903 | Bacteria | 1167 |
| 121 | Ga0307412_10219000 | 3300031911 | Bacteria | 1458 |
| 122 | Ga0307409_100026398 | 3300031995 | Bacteria | 4095 |
| 123 | Ga0307416_100020479 | 3300032002 | Bacteria | 4722 |
| 124 | Ga0307415_100093353 | 3300032126 | Bacteria | 2185 |
| 125 | Ga0307415_100293407 | 3300032126 | Bacteria | 1343 |
| 126 | Ga0373924_0080502 | 3300035410 | Bacteria | 1385 |
| 127 | Ga0395900_0003892 | 3300037418 | Bacteria | 15948 |
| 128 | Ga0395898_0001796 | 3300037466 | Bacteria | 27829 |
| 129 | Ga0395898_0100773 | 3300037466 | Bacteria | 2774 |
| 130 | Ga0395901_0033915 | 3300038443 | Bacteria | 5271 |
| 131 | Ga0436362_0853693 | 3300039453 | Bacteria | 2084 |
| 132 | Ga0466961_0024768 | 3300044693 | Bacteria | 3860 |
| 133 | Ga0466963_0000051 | 3300044694 | Bacteria | 39254 |
| 134 | Ga0466963_0019839 | 3300044694 | Bacteria | 4222 |
| 135 | Ga0466963_0041992 | 3300044694 | Bacteria | 3001 |
| 136 | Ga0466963_0045456 | 3300044694 | Bacteria | 2892 |
| 137 | Ga0466971_0006539 | 3300044719 | Bacteria | 5066 |
| 138 | Ga0466957_0030348 | 3300044842 | Bacteria | 3227 |
| 139 | Ga0466959_0077039 | 3300045049 | Bacteria | 2407 |
| 140 | Ga0466958_0002352 | 3300045836 | Bacteria | 9457 |
| 141 | Ga0466958_0052948 | 3300045836 | Bacteria | 2461 |
| 142 | Ga0466958_0201336 | 3300045836 | Bacteria | 1267 |
| 143 | Ga0495651_0037630 | 3300046462 | Bacteria | 3767 |
| 144 | Ga0495653_0009192 | 3300046463 | Bacteria | 8081 |
| 145 | Ga0495582_0000002 | 3300046473 | Bacteria | 219909 |
| 146 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 147 | Ga0495608_0011579 | 3300046511 | Bacteria | 6136 |
| 148 | Ga0495608_0016368 | 3300046511 | Bacteria | 5130 |
| 149 | Ga0495628_0020204 | 3300046516 | Bacteria | 5497 |
| 150 | Ga0495628_0142600 | 3300046516 | Bacteria | 1828 |
| 151 | Ga0495632_0106864 | 3300046519 | Bacteria | 1316 |
| 152 | Ga0495652_0038557 | 3300046529 | Bacteria | 4139 |
| 153 | Ga0495652_0144314 | 3300046529 | Bacteria | 1868 |
| 154 | Ga0495586_0001516 | 3300046535 | Bacteria | 12833 |
| 155 | Ga0495587_0073396 | 3300046536 | Bacteria | 1988 |
| 156 | Ga0495645_0145201 | 3300046543 | Bacteria | 1653 |
| 157 | Ga0495622_0000033 | 3300046557 | Bacteria | 124162 |
| 158 | Ga0495634_0001282 | 3300046642 | Bacteria | 23024 |
| 159 | Ga0495635_0014166 | 3300046663 | Bacteria | 5580 |
| 160 | Ga0495657_0030734 | 3300046675 | Bacteria | 3758 |
| 161 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 162 | Ga0495600_0007842 | 3300046809 | Bacteria | 6538 |
| 163 | Ga0495604_0008147 | 3300047317 | Bacteria | 8295 |
| 164 | Ga0495680_0027210 | 3300047322 | Bacteria | 4701 |
| 165 | Ga0495675_0116957 | 3300047444 | Bacteria | 1662 |
| 166 | Ga0495686_0002378 | 3300047472 | Bacteria | 17896 |
| 167 | Ga0495602_0011926 | 3300048088 | Bacteria | 8961 |
| 168 | Ga0495602_0239281 | 3300048088 | Bacteria | 1359 |
| 169 | Ga0496100_0109839 | 3300048903 | Bacteria | 1914 |
| 170 | Ga0496101_0039256 | 3300048904 | Bacteria | 3366 |
| 171 | Ga0496104_0025996 | 3300048907 | Bacteria | 5399 |
| 172 | Ga0496104_0036029 | 3300048907 | Bacteria | 4622 |
| 173 | Ga0496105_0003630 | 3300048908 | Bacteria | 11467 |
| 174 | Ga0496105_0082947 | 3300048908 | Bacteria | 2648 |
| 175 | Ga0496107_0048319 | 3300048910 | Bacteria | 3065 |
| 176 | Ga0496107_0082946 | 3300048910 | Bacteria | 2337 |
| 177 | Ga0496108_0024430 | 3300048911 | Bacteria | 4975 |
| 178 | Ga0496108_0246245 | 3300048911 | Bacteria | 1555 |
| 179 | Ga0496108_0285490 | 3300048911 | Bacteria | 1437 |
| 180 | Ga0496109_0000881 | 3300048912 | Bacteria | 25056 |
| 181 | Ga0496109_0109420 | 3300048912 | Bacteria | 2568 |
| 182 | Ga0496109_0460938 | 3300048912 | Bacteria | 1200 |
| 183 | Ga0496110_0074472 | 3300048913 | Bacteria | 3015 |
| 184 | Ga0496111_0005068 | 3300048914 | Bacteria | 8378 |
| 185 | Ga0496112_0000641 | 3300048915 | Bacteria | 24272 |
| 186 | Ga0496112_0010854 | 3300048915 | Bacteria | 8288 |
| 187 | Ga0496112_0021332 | 3300048915 | Bacteria | 6159 |
| 188 | Ga0496112_0084655 | 3300048915 | Bacteria | 3136 |
| 189 | Ga0496112_0125145 | 3300048915 | Bacteria | 2541 |
| 190 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 191 | Ga0496116_0000138 | 3300048919 | Bacteria | 151606 |
| 192 | Ga0496119_0004068 | 3300048922 | Bacteria | 14751 |
| 193 | Ga0496124_0076213 | 3300048927 | Bacteria | 2769 |
| 194 | Ga0501031_0205677 | 3300049568 | Bacteria | 1284 |
| 195 | Ga0501038_0189223 | 3300049574 | Bacteria | 1657 |
| 196 | Ga0501042_0300625 | 3300049578 | Bacteria | 1159 |
| 197 | Ga0501047_0033195 | 3300049581 | Bacteria | 4982 |
| 198 | Ga0501069_0062413 | 3300049585 | Bacteria | 2081 |
| 199 | Ga0501070_0024812 | 3300049586 | Bacteria | 5028 |
| 200 | Ga0501072_0120854 | 3300049588 | Bacteria | 2087 |
| 201 | Ga0501080_0278800 | 3300049742 | Bacteria | 1520 |
| 202 | Ga0501083_0006427 | 3300049744 | Bacteria | 8334 |
| 203 | nmdc:mga0yw44_180928_c1 | 3300050492 | Bacteria | 1387 |
| 204 | nmdc:mga09592_296462_c1 | 3300050508 | Bacteria | 1402 |
| 205 | nmdc:mga0qj67_112887_c1 | 3300050509 | Bacteria | 2194 |
| 206 | nmdc:mga0qj67_20487_c1 | 3300050509 | Bacteria | 5064 |
| 207 | nmdc:mga06r32_427173_c1 | 3300050510 | Bacteria | 1306 |
| 208 | nmdc:mga06r32_4342_c1 | 3300050510 | Bacteria | 12687 |
| 209 | nmdc:mga08y16_246104_c1 | 3300050511 | Bacteria | 1848 |
| 210 | nmdc:mga08y16_328889_c1 | 3300050511 | Bacteria | 1573 |
| 211 | nmdc:mga08y16_39151_c1 | 3300050511 | Bacteria | 4974 |
| 212 | Ga0495601_0016346 | 3300053077 | Bacteria | 4496 |
| 213 | Ga0495655_0001411 | 3300053083 | Bacteria | 3686 |
| 214 | Ga0495619_0009001 | 3300053085 | Bacteria | 6300 |
| 215 | Ga0495619_0253624 | 3300053085 | Bacteria | 1219 |
| 216 | Ga0466962_0004305 | 3300061719 | Bacteria | 6825 |
| 217 | Ga0530510_0018039 | 3300061734 | Bacteria | 5003 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0205677 | Ga0501031_0205677_10_930 | 289 |
| 2 | 3300005459 | Ga0068867_100000454 | Ga0068867_1000004545 | 291 |
| 3 | 3300026089 | Ga0207648_10009090 | Ga0207648_100090905 | 291 |
| 4 | 3300046473 | Ga0495582_0000002 | Ga0495582_0000002_60997_61914 | 305 |
| 5 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_330354_331271 | 305 |
| 6 | 3300006847 | Ga0075431_100003273 | Ga0075431_1000032733 | 308 |
| 7 | 3300006846 | Ga0075430_100176253 | Ga0075430_1001762532 | 312 |
| 8 | 3300050509 | nmdc:mga0qj67_112887_c1 | nmdc:mga0qj67_112887_c1_535_1533 | 312 |
| 9 | 3300005937 | Ga0081455_10208636 | Ga0081455_102086362 | 321 |
| 10 | 3300005981 | Ga0081538_10001446 | Ga0081538_1000144610 | 321 |
| 11 | 3300044693 | Ga0466961_0024768 | Ga0466961_0024768_2589_3566 | 322 |
| 12 | 3300044694 | Ga0466963_0019839 | Ga0466963_0019839_314_1291 | 322 |
| 13 | 3300044719 | Ga0466971_0006539 | Ga0466971_0006539_2387_3364 | 322 |
| 14 | 3300044842 | Ga0466957_0030348 | Ga0466957_0030348_184_1161 | 322 |
| 15 | 3300045049 | Ga0466959_0077039 | Ga0466959_0077039_463_1440 | 322 |
| 16 | 3300045836 | Ga0466958_0002352 | Ga0466958_0002352_4514_5491 | 322 |
| 17 | 3300061719 | Ga0466962_0004305 | Ga0466962_0004305_4621_5598 | 322 |
| 18 | 3300005328 | Ga0070676_10120617 | Ga0070676_101206172 | 323 |
| 19 | 3300005347 | Ga0070668_100016308 | Ga0070668_1000163085 | 323 |
| 20 | 3300005366 | Ga0070659_100062383 | Ga0070659_1000623832 | 323 |
| 21 | 3300005439 | Ga0070711_100088038 | Ga0070711_1000880382 | 323 |
| 22 | 3300005441 | Ga0070700_100021749 | Ga0070700_1000217492 | 323 |
| 23 | 3300005535 | Ga0070684_100062195 | Ga0070684_1000621954 | 323 |
| 24 | 3300005549 | Ga0070704_100152858 | Ga0070704_1001528582 | 323 |
| 25 | 3300005614 | Ga0068856_100026696 | Ga0068856_1000266963 | 323 |
| 26 | 3300005616 | Ga0068852_100124213 | Ga0068852_1001242133 | 323 |
| 27 | 3300005719 | Ga0068861_100002823 | Ga0068861_1000028238 | 323 |
| 28 | 3300005834 | Ga0068851_10106377 | Ga0068851_101063772 | 323 |
| 29 | 3300005937 | Ga0081455_10045369 | Ga0081455_100453695 | 323 |
| 30 | 3300005981 | Ga0081538_10000386 | Ga0081538_1000038643 | 323 |
| 31 | 3300005981 | Ga0081538_10078053 | Ga0081538_100780532 | 323 |
| 32 | 3300006844 | Ga0075428_100008397 | Ga0075428_1000083976 | 323 |
| 33 | 3300006844 | Ga0075428_100015609 | Ga0075428_10001560910 | 323 |
| 34 | 3300009094 | Ga0111539_10399886 | Ga0111539_103998862 | 323 |
| 35 | 3300009098 | Ga0105245_10005283 | Ga0105245_100052836 | 323 |
| 36 | 3300009147 | Ga0114129_10000941 | Ga0114129_1000094127 | 323 |
| 37 | 3300009148 | Ga0105243_10093027 | Ga0105243_100930271 | 323 |
| 38 | 3300010375 | Ga0105239_10037595 | Ga0105239_100375955 | 323 |
| 39 | 3300010375 | Ga0105239_10206739 | Ga0105239_102067391 | 323 |
| 40 | 3300017792 | Ga0163161_10103533 | Ga0163161_101035332 | 323 |
| 41 | 3300017792 | Ga0163161_10144331 | Ga0163161_101443312 | 323 |
| 42 | 3300025903 | Ga0207680_10006474 | Ga0207680_100064745 | 323 |
| 43 | 3300025918 | Ga0207662_10079443 | Ga0207662_100794432 | 323 |
| 44 | 3300025919 | Ga0207657_10175299 | Ga0207657_101752992 | 323 |
| 45 | 3300025933 | Ga0207706_10001715 | Ga0207706_1000171515 | 323 |
| 46 | 3300025942 | Ga0207689_10356857 | Ga0207689_103568571 | 323 |
| 47 | 3300025961 | Ga0207712_10045306 | Ga0207712_100453062 | 323 |
| 48 | 3300025972 | Ga0207668_10011009 | Ga0207668_100110092 | 323 |
| 49 | 3300025981 | Ga0207640_10199284 | Ga0207640_101992841 | 323 |
| 50 | 3300026075 | Ga0207708_10031129 | Ga0207708_100311293 | 323 |
| 51 | 3300026089 | Ga0207648_10036925 | Ga0207648_100369253 | 323 |
| 52 | 3300026118 | Ga0207675_100000091 | Ga0207675_10000009112 | 323 |
| 53 | 3300027907 | Ga0207428_10073977 | Ga0207428_100739772 | 323 |
| 54 | 3300031995 | Ga0307409_100026398 | Ga0307409_1000263982 | 323 |
| 55 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_171471_172448 | 323 |
| 56 | 3300046557 | Ga0495622_0000033 | Ga0495622_0000033_83351_84328 | 323 |
| 57 | 3300046642 | Ga0495634_0001282 | Ga0495634_0001282_2421_3398 | 323 |
| 58 | 3300048903 | Ga0496100_0109839 | Ga0496100_0109839_308_1285 | 323 |
| 59 | 3300048907 | Ga0496104_0036029 | Ga0496104_0036029_1794_2771 | 323 |
| 60 | 3300048910 | Ga0496107_0048319 | Ga0496107_0048319_558_1535 | 323 |
| 61 | 3300048911 | Ga0496108_0024430 | Ga0496108_0024430_3246_4223 | 323 |
| 62 | 3300048912 | Ga0496109_0000881 | Ga0496109_0000881_8089_9066 | 323 |
| 63 | 3300048913 | Ga0496110_0074472 | Ga0496110_0074472_1180_2157 | 323 |
| 64 | 3300048914 | Ga0496111_0005068 | Ga0496111_0005068_548_1525 | 323 |
| 65 | 3300048915 | Ga0496112_0010854 | Ga0496112_0010854_1024_2001 | 323 |
| 66 | 3300049574 | Ga0501038_0189223 | Ga0501038_0189223_185_1213 | 323 |
| 67 | 3300049578 | Ga0501042_0300625 | Ga0501042_0300625_40_1068 | 323 |
| 68 | 3300050510 | nmdc:mga06r32_427173_c1 | nmdc:mga06r32_427173_c1_30_1013 | 323 |
| 69 | 3300050511 | nmdc:mga08y16_328889_c1 | nmdc:mga08y16_328889_c1_13_993 | 323 |
| 70 | 3300053077 | Ga0495601_0016346 | Ga0495601_0016346_2840_3820 | 323 |
| 71 | 3300053085 | Ga0495619_0009001 | Ga0495619_0009001_3067_4047 | 323 |
| 72 | 3300053085 | Ga0495619_0253624 | Ga0495619_0253624_137_1114 | 323 |
| 73 | 3300061734 | Ga0530510_0018039 | Ga0530510_0018039_3781_4809 | 323 |
| 74 | 3300002074 | JGI24748J21848_1000525 | JGI24748J21848_10005252 | 324 |
| 75 | 3300002239 | JGI24034J26672_10000223 | JGI24034J26672_100002233 | 324 |
| 76 | 3300002244 | JGI24742J22300_10001124 | JGI24742J22300_100011242 | 324 |
| 77 | 3300005336 | Ga0070680_100014741 | Ga0070680_1000147416 | 324 |
| 78 | 3300005339 | Ga0070660_100009725 | Ga0070660_1000097258 | 324 |
| 79 | 3300005344 | Ga0070661_100078126 | Ga0070661_1000781261 | 324 |
| 80 | 3300005366 | Ga0070659_100054639 | Ga0070659_1000546392 | 324 |
| 81 | 3300005436 | Ga0070713_100073917 | Ga0070713_1000739173 | 324 |
| 82 | 3300005458 | Ga0070681_10003720 | Ga0070681_1000372013 | 324 |
| 83 | 3300005466 | Ga0070685_10050754 | Ga0070685_100507544 | 324 |
| 84 | 3300005530 | Ga0070679_100000365 | Ga0070679_10000036519 | 324 |
| 85 | 3300005530 | Ga0070679_100076150 | Ga0070679_1000761502 | 324 |
| 86 | 3300005535 | Ga0070684_100023154 | Ga0070684_1000231542 | 324 |
| 87 | 3300005577 | Ga0068857_100137598 | Ga0068857_1001375982 | 324 |
| 88 | 3300005616 | Ga0068852_100006908 | Ga0068852_1000069083 | 324 |
| 89 | 3300005719 | Ga0068861_100154161 | Ga0068861_1001541612 | 324 |
| 90 | 3300006051 | Ga0075364_10049991 | Ga0075364_100499912 | 324 |
| 91 | 3300009093 | Ga0105240_10245106 | Ga0105240_102451061 | 324 |
| 92 | 3300009176 | Ga0105242_10004096 | Ga0105242_100040969 | 324 |
| 93 | 3300009545 | Ga0105237_10043315 | Ga0105237_100433153 | 324 |
| 94 | 3300009551 | Ga0105238_10073626 | Ga0105238_100736263 | 324 |
| 95 | 3300013104 | Ga0157370_10059482 | Ga0157370_100594822 | 324 |
| 96 | 3300013105 | Ga0157369_10019004 | Ga0157369_100190046 | 324 |
| 97 | 3300013297 | Ga0157378_10088642 | Ga0157378_100886422 | 324 |
| 98 | 3300013306 | Ga0163162_10485860 | Ga0163162_104858601 | 324 |
| 99 | 3300013307 | Ga0157372_10022669 | Ga0157372_100226696 | 324 |
| 100 | 3300020070 | Ga0206356_10451311 | Ga0206356_104513111 | 324 |
| 101 | 3300020082 | Ga0206353_11215997 | Ga0206353_112159978 | 324 |
| 102 | 3300025912 | Ga0207707_10249811 | Ga0207707_102498112 | 324 |
| 103 | 3300025913 | Ga0207695_10175275 | Ga0207695_101752751 | 324 |
| 104 | 3300025917 | Ga0207660_10018926 | Ga0207660_100189261 | 324 |
| 105 | 3300025919 | Ga0207657_10086591 | Ga0207657_100865911 | 324 |
| 106 | 3300025921 | Ga0207652_10000536 | Ga0207652_1000053618 | 324 |
| 107 | 3300025921 | Ga0207652_10004122 | Ga0207652_100041228 | 324 |
| 108 | 3300025924 | Ga0207694_10078361 | Ga0207694_100783612 | 324 |
| 109 | 3300025928 | Ga0207700_10111067 | Ga0207700_101110673 | 324 |
| 110 | 3300025934 | Ga0207686_10002926 | Ga0207686_100029263 | 324 |
| 111 | 3300025945 | Ga0207679_10116395 | Ga0207679_101163952 | 324 |
| 112 | 3300025981 | Ga0207640_10000669 | Ga0207640_100006698 | 324 |
| 113 | 3300026041 | Ga0207639_10011058 | Ga0207639_100110583 | 324 |
| 114 | 3300026078 | Ga0207702_10028772 | Ga0207702_100287721 | 324 |
| 115 | 3300026116 | Ga0207674_10069889 | Ga0207674_100698892 | 324 |
| 116 | 3300026118 | Ga0207675_100201502 | Ga0207675_1002015022 | 324 |
| 117 | 3300028654 | Ga0265322_10022851 | Ga0265322_100228512 | 324 |
| 118 | 3300028800 | Ga0265338_10005918 | Ga0265338_1000591812 | 324 |
| 119 | 3300037466 | Ga0395898_0100773 | Ga0395898_0100773_665_1774 | 324 |
| 120 | 3300038443 | Ga0395901_0033915 | Ga0395901_0033915_3258_4367 | 324 |
| 121 | 3300044694 | Ga0466963_0000051 | Ga0466963_0000051_20492_21472 | 324 |
| 122 | 3300046529 | Ga0495652_0038557 | Ga0495652_0038557_18_998 | 324 |
| 123 | 3300048088 | Ga0495602_0239281 | Ga0495602_0239281_66_1046 | 324 |
| 124 | 3300048915 | Ga0496112_0000641 | Ga0496112_0000641_12823_13803 | 324 |
| 125 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_197979_198959 | 324 |
| 126 | 3300049585 | Ga0501069_0062413 | Ga0501069_0062413_657_1643 | 324 |
| 127 | 3300049742 | Ga0501080_0278800 | Ga0501080_0278800_323_1309 | 324 |
| 128 | 3300050492 | nmdc:mga0yw44_180928_c1 | nmdc:mga0yw44_180928_c1_188_1174 | 324 |
| 129 | 3300053083 | Ga0495655_0001411 | Ga0495655_0001411_1524_2504 | 324 |
| 130 | 3300005335 | Ga0070666_10050112 | Ga0070666_100501122 | 325 |
| 131 | 3300005341 | Ga0070691_10003684 | Ga0070691_100036849 | 325 |
| 132 | 3300005356 | Ga0070674_100000001 | Ga0070674_100000001287 | 325 |
| 133 | 3300005367 | Ga0070667_100020328 | Ga0070667_1000203286 | 325 |
| 134 | 3300005937 | Ga0081455_10054045 | Ga0081455_100540452 | 325 |
| 135 | 3300005981 | Ga0081538_10018097 | Ga0081538_100180972 | 325 |
| 136 | 3300005981 | Ga0081538_10025327 | Ga0081538_100253275 | 325 |
| 137 | 3300005981 | Ga0081538_10109498 | Ga0081538_101094982 | 325 |
| 138 | 3300005985 | Ga0081539_10002710 | Ga0081539_1000271021 | 325 |
| 139 | 3300006844 | Ga0075428_100467008 | Ga0075428_1004670082 | 325 |
| 140 | 3300006846 | Ga0075430_100002217 | Ga0075430_1000022172 | 325 |
| 141 | 3300009094 | Ga0111539_10006256 | Ga0111539_1000625610 | 325 |
| 142 | 3300009147 | Ga0114129_10001284 | Ga0114129_1000128410 | 325 |
| 143 | 3300009176 | Ga0105242_10062585 | Ga0105242_100625853 | 325 |
| 144 | 3300013308 | Ga0157375_10000194 | Ga0157375_1000019422 | 325 |
| 145 | 3300025899 | Ga0207642_10000066 | Ga0207642_1000006630 | 325 |
| 146 | 3300025903 | Ga0207680_10039094 | Ga0207680_100390942 | 325 |
| 147 | 3300025934 | Ga0207686_10034027 | Ga0207686_100340272 | 325 |
| 148 | 3300025937 | Ga0207669_10000002 | Ga0207669_1000000263 | 325 |
| 149 | 3300025986 | Ga0207658_10131603 | Ga0207658_101316032 | 325 |
| 150 | 3300028379 | Ga0268266_10001842 | Ga0268266_1000184221 | 325 |
| 151 | 3300031731 | Ga0307405_10072357 | Ga0307405_100723572 | 325 |
| 152 | 3300031852 | Ga0307410_10027225 | Ga0307410_100272252 | 325 |
| 153 | 3300031903 | Ga0307407_10273219 | Ga0307407_102732191 | 325 |
| 154 | 3300031911 | Ga0307412_10219000 | Ga0307412_102190001 | 325 |
| 155 | 3300032002 | Ga0307416_100020479 | Ga0307416_1000204795 | 325 |
| 156 | 3300032126 | Ga0307415_100293407 | Ga0307415_1002934071 | 325 |
| 157 | 3300037418 | Ga0395900_0003892 | Ga0395900_0003892_13345_14364 | 325 |
| 158 | 3300037466 | Ga0395898_0001796 | Ga0395898_0001796_25796_26815 | 325 |
| 159 | 3300044694 | Ga0466963_0041992 | Ga0466963_0041992_1108_2109 | 325 |
| 160 | 3300044694 | Ga0466963_0045456 | Ga0466963_0045456_1077_2069 | 325 |
| 161 | 3300045836 | Ga0466958_0052948 | Ga0466958_0052948_250_1236 | 325 |
| 162 | 3300045836 | Ga0466958_0201336 | Ga0466958_0201336_54_1055 | 325 |
| 163 | 3300046511 | Ga0495608_0016368 | Ga0495608_0016368_192_1175 | 325 |
| 164 | 3300046516 | Ga0495628_0142600 | Ga0495628_0142600_539_1522 | 325 |
| 165 | 3300046519 | Ga0495632_0106864 | Ga0495632_0106864_82_1065 | 325 |
| 166 | 3300046535 | Ga0495586_0001516 | Ga0495586_0001516_3182_4165 | 325 |
| 167 | 3300048904 | Ga0496101_0039256 | Ga0496101_0039256_2350_3339 | 325 |
| 168 | 3300048908 | Ga0496105_0003630 | Ga0496105_0003630_8150_9136 | 325 |
| 169 | 3300048910 | Ga0496107_0082946 | Ga0496107_0082946_1213_2202 | 325 |
| 170 | 3300048912 | Ga0496109_0109420 | Ga0496109_0109420_1427_2413 | 325 |
| 171 | 3300048915 | Ga0496112_0084655 | Ga0496112_0084655_721_1710 | 325 |
| 172 | 3300048915 | Ga0496112_0125145 | Ga0496112_0125145_1394_2380 | 325 |
| 173 | 3300048919 | Ga0496116_0000138 | Ga0496116_0000138_13530_14513 | 325 |
| 174 | 3300048922 | Ga0496119_0004068 | Ga0496119_0004068_13615_14598 | 325 |
| 175 | 3300048927 | Ga0496124_0076213 | Ga0496124_0076213_589_1572 | 325 |
| 176 | 3300049581 | Ga0501047_0033195 | Ga0501047_0033195_797_1780 | 325 |
| 177 | 3300049586 | Ga0501070_0024812 | Ga0501070_0024812_1512_2495 | 325 |
| 178 | 3300049744 | Ga0501083_0006427 | Ga0501083_0006427_2228_3211 | 325 |
| 179 | 3300050509 | nmdc:mga0qj67_20487_c1 | nmdc:mga0qj67_20487_c1_3163_4173 | 325 |
| 180 | 3300050510 | nmdc:mga06r32_4342_c1 | nmdc:mga06r32_4342_c1_7867_8877 | 325 |
| 181 | 3300050511 | nmdc:mga08y16_39151_c1 | nmdc:mga08y16_39151_c1_2215_3213 | 325 |
| 182 | 3300005435 | Ga0070714_100296272 | Ga0070714_1002962722 | 328 |
| 183 | 3300005436 | Ga0070713_100254299 | Ga0070713_1002542991 | 328 |
| 184 | 3300006028 | Ga0070717_10127699 | Ga0070717_101276992 | 328 |
| 185 | 3300006175 | Ga0070712_100003544 | Ga0070712_1000035448 | 328 |
| 186 | 3300025915 | Ga0207693_10000327 | Ga0207693_1000032738 | 328 |
| 187 | 3300025928 | Ga0207700_10325410 | Ga0207700_103254102 | 328 |
| 188 | 3300035410 | Ga0373924_0080502 | Ga0373924_0080502_184_1218 | 328 |
| 189 | 3300039453 | Ga0436362_0853693 | Ga0436362_0853693_134_1180 | 328 |
| 190 | 3300046462 | Ga0495651_0037630 | Ga0495651_0037630_2421_3455 | 328 |
| 191 | 3300046463 | Ga0495653_0009192 | Ga0495653_0009192_6978_8012 | 328 |
| 192 | 3300046511 | Ga0495608_0011579 | Ga0495608_0011579_4318_5352 | 328 |
| 193 | 3300046516 | Ga0495628_0020204 | Ga0495628_0020204_2361_3395 | 328 |
| 194 | 3300046529 | Ga0495652_0144314 | Ga0495652_0144314_512_1546 | 328 |
| 195 | 3300046536 | Ga0495587_0073396 | Ga0495587_0073396_70_1104 | 328 |
| 196 | 3300046543 | Ga0495645_0145201 | Ga0495645_0145201_326_1360 | 328 |
| 197 | 3300046663 | Ga0495635_0014166 | Ga0495635_0014166_3874_4908 | 328 |
| 198 | 3300046675 | Ga0495657_0030734 | Ga0495657_0030734_2006_3040 | 328 |
| 199 | 3300046809 | Ga0495600_0007842 | Ga0495600_0007842_5094_6128 | 328 |
| 200 | 3300047317 | Ga0495604_0008147 | Ga0495604_0008147_5225_6259 | 328 |
| 201 | 3300047322 | Ga0495680_0027210 | Ga0495680_0027210_119_1153 | 328 |
| 202 | 3300047444 | Ga0495675_0116957 | Ga0495675_0116957_430_1464 | 328 |
| 203 | 3300047472 | Ga0495686_0002378 | Ga0495686_0002378_11570_12604 | 328 |
| 204 | 3300048088 | Ga0495602_0011926 | Ga0495602_0011926_5747_6781 | 328 |
| 205 | 3300048907 | Ga0496104_0025996 | Ga0496104_0025996_2765_3799 | 328 |
| 206 | 3300048908 | Ga0496105_0082947 | Ga0496105_0082947_171_1205 | 328 |
| 207 | 3300048911 | Ga0496108_0246245 | Ga0496108_0246245_449_1483 | 328 |
| 208 | 3300048911 | Ga0496108_0285490 | Ga0496108_0285490_277_1311 | 328 |
| 209 | 3300048912 | Ga0496109_0460938 | Ga0496109_0460938_55_1089 | 328 |
| 210 | 3300048915 | Ga0496112_0021332 | Ga0496112_0021332_2895_3929 | 328 |
| 211 | 3300009101 | Ga0105247_10000369 | Ga0105247_100003697 | 329 |
| 212 | 3300032126 | Ga0307415_100093353 | Ga0307415_1000933532 | 329 |
| 213 | 3300049588 | Ga0501072_0120854 | Ga0501072_0120854_780_1829 | 329 |
| 214 | 3300050511 | nmdc:mga08y16_246104_c1 | nmdc:mga08y16_246104_c1_203_1312 | 329 |
| 215 | 3300001979 | JGI24740J21852_10008774 | JGI24740J21852_100087742 | 330 |
| 216 | 3300003373 | JGI25407J50210_10001354 | JGI25407J50210_100013544 | 330 |
| 217 | 3300050508 | nmdc:mga09592_296462_c1 | nmdc:mga09592_296462_c1_53_1141 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fz6-assembly2.cif.gz_B | crystal structure of a radical sam methyltransferase from sphaerobacter thermophilus | 0.8881 | 1 | 318 |
| 3rfa-assembly1.cif.gz_B | x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine | 0.8634 | 3 | 320 |
| 3rfa-assembly2.cif.gz_A | x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine | 0.8627 | 3 | 309 |
| 6fz6-assembly2.cif.gz_B | crystal structure of a radical sam methyltransferase from sphaerobacter thermophilus | 0.8559 | 1 | 318 |
| 5hr6-assembly2.cif.gz_B | x-ray crystal structure of c118a rlmn with cross-linked trna purified from escherichia coli | 0.8556 | 7 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0LFU5_57_140_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9643 | 194 | 261 | 3.20.20.70 |
| af_A0A1D6FPJ6_15_105_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9539 | 163 | 247 | 3.20.20.70 |
| af_Q2FZ66_80_363_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9148 | 54 | 325 | 3.20.20.70 |
| af_F4IVY6_128_412_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9138 | 56 | 318 | 3.20.20.70 |
| af_A0A1D6G0E0_114_393_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9078 | 55 | 318 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1LFG7-F1-model_v4 | 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN | 0.9689 | 1 | 99 |
GO:0008168
GO:0030488 GO:0051539 GO:0070475 |
| AF-A0A538CUA9-F1-model_v4 | 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN | 0.9585 | 1 | 308 |
GO:0005737
GO:0008173 GO:0030488 GO:0046872 GO:0051539 GO:0070475 |
| AF-A0A4U3AZC1-F1-model_v4 | deleted | 0.9571 | 154 | 271 |
|
| AF-A0A2T4UD74-F1-model_v4 | Probable dual-specificity RNA methyltransferase RlmN (EC 2.1.1.192) (23S rRNA (adenine(2503)-C(2))-methyltransferase) (23S rRNA m2A2503 methyltransferase) (Ribosomal RNA large subunit methyltransferase N) (tRNA (adenine(37)-C(2))-methyltransferase) (tRNA m2A37 methyltransferase) | 0.9515 | 1 | 321 |
GO:0000049
GO:0002935 GO:0005737 GO:0019843 GO:0030488 GO:0046872 GO:0051539 GO:0070040 GO:0070475 |
| AF-A0A538CUA9-F1-model_v4 | 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN | 0.9495 | 1 | 308 |
GO:0005737
GO:0008173 GO:0030488 GO:0046872 GO:0051539 GO:0070475 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar