F328159

General Info

Members Datasets Scaffolds Average Seq Length
216 162 432 178

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154155|2515851125
Length 206
Sequence HDPPGKAKAAVGASRAVTVQGEAARSVLDEADIARALTRIAHEILERNKGAREVVLLGIPTRGVELARRIGERISAVEGSFGGVGALDVTMYRDDLRLRPTRVLGHTEIPESGIDGKVVVLVDDVLFSGRTIRAALTALDDIGRPRAVQLAVLVDRGHRELPIRADFVGKNLPTAADERVVVSLRESDGGESVVIAKREPVGEGTS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
74 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
75 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
98 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
141 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
142 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
157 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
158 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
159 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
160 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
161 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
162 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0.93
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 11.11
Rhizosphere 84.72
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10130182 3300005293 Bacteria 2031
2 Ga0065715_10183175 3300005293 Bacteria 1462
3 Ga0070683_100316569 3300005329 Bacteria 1485
4 Ga0070670_100349363 3300005331 Bacteria 1299
5 Ga0070666_10457968 3300005335 Bacteria 922
6 Ga0070682_100037904 3300005337 Bacteria 2954
7 Ga0070668_100051598 3300005347 Bacteria 3170
8 Ga0070668_100089355 3300005347 Bacteria 2426
9 Ga0070673_100564929 3300005364 Bacteria 1035
10 Ga0070659_100529251 3300005366 Bacteria 1007
11 Ga0070667_100463722 3300005367 Bacteria 1158
12 Ga0070667_100686538 3300005367 Bacteria 947
13 Ga0070705_100020686 3300005440 Bacteria 3487
14 Ga0070708_100385217 3300005445 Bacteria 1322
15 Ga0070681_10043825 3300005458 Bacteria 4479
16 Ga0068867_100656366 3300005459 Bacteria 921
17 Ga0070698_100009315 3300005471 Bacteria 10532
18 Ga0070684_100523723 3300005535 Bacteria 1099
19 Ga0070696_100203648 3300005546 Bacteria 1478
20 Ga0070693_100541861 3300005547 Bacteria 832
21 Ga0070704_100398749 3300005549 Bacteria 1173
22 Ga0068854_100622623 3300005578 Bacteria 924
23 Ga0068852_100199225 3300005616 Bacteria 1894
24 Ga0068861_100291669 3300005719 Bacteria 1409
25 Ga0068851_10095934 3300005834 Bacteria 1567
26 Ga0068870_10228039 3300005840 Bacteria 1144
27 Ga0068860_101353993 3300005843 Bacteria 733
28 Ga0068862_100039218 3300005844 Bacteria 4022
29 Ga0081455_10000773 3300005937 Bacteria 41270
30 Ga0075428_100000215 3300006844 Bacteria 55598
31 Ga0075428_100901862 3300006844 Bacteria 937
32 Ga0075431_100412098 3300006847 Unclassified 1351
33 Ga0075433_10208739 3300006852 Bacteria 1736
34 Ga0075433_10719708 3300006852 Bacteria 874
35 Ga0075434_100091815 3300006871 Bacteria 3038
36 Ga0105245_10004258 3300009098 Bacteria 12687
37 Ga0105245_10092793 3300009098 Bacteria 2781
38 Ga0105245_11593289 3300009098 Bacteria 705
39 Ga0114129_10043167 3300009147 Bacteria 6344
40 Ga0114129_10214672 3300009147 Bacteria 2598
41 Ga0114129_10931968 3300009147 Bacteria 1098
42 Ga0105243_10006529 3300009148 Bacteria 9011
43 Ga0105243_10016689 3300009148 Bacteria 5551
44 Ga0105241_10071430 3300009174 Bacteria 2695
45 Ga0105242_10127811 3300009176 Bacteria 2189
46 Ga0105242_10297611 3300009176 Bacteria 1471
47 Ga0105242_10767322 3300009176 Bacteria 951
48 Ga0105248_10831207 3300009177 Bacteria 1042
49 Ga0105237_10363182 3300009545 Bacteria 1452
50 Ga0105238_10037839 3300009551 Bacteria 4902
51 Ga0105238_10614859 3300009551 Bacteria 1095
52 Ga0105249_10017399 3300009553 Bacteria 6381
53 Ga0105249_10535236 3300009553 Bacteria 1220
54 Ga0105239_10267490 3300010375 Bacteria 1922
55 Ga0105239_10359283 3300010375 Bacteria 1645
56 Ga0105246_10015147 3300011119 Bacteria 4862
57 Ga0105246_10214091 3300011119 Bacteria 1506
58 Ga0157374_10482209 3300013296 Bacteria 1243
59 Ga0157378_10008190 3300013297 Bacteria 9115
60 Ga0157378_10031377 3300013297 Bacteria 4695
61 Ga0163162_10157520 3300013306 Bacteria 2391
62 Ga0163162_10261671 3300013306 Bacteria 1862
63 Ga0157372_10869557 3300013307 Bacteria 1046
64 Ga0157372_11477622 3300013307 Bacteria 783
65 Ga0157375_10006171 3300013308 Bacteria 10443
66 Ga0163163_10961907 3300014325 Bacteria 917
67 Ga0157380_10050189 3300014326 Bacteria 3294
68 Ga0157380_10061259 3300014326 Bacteria 3010
69 Ga0157380_10975762 3300014326 Bacteria 879
70 Ga0157377_10005423 3300014745 Bacteria 5993
71 Ga0157376_10313496 3300014969 Bacteria 1489
72 Ga0163161_10201317 3300017792 Bacteria 1535
73 Ga0206353_10789076 3300020082 Bacteria 1742
74 Ga0207642_10339587 3300025899 Bacteria 883
75 Ga0207643_10170552 3300025908 Bacteria 1313
76 Ga0207654_10272245 3300025911 Bacteria 1143
77 Ga0207681_10486879 3300025923 Bacteria 1008
78 Ga0207694_10401038 3300025924 Bacteria 1140
79 Ga0207694_10616087 3300025924 Bacteria 913
80 Ga0207650_10542010 3300025925 Bacteria 975
81 Ga0207690_10461126 3300025932 Bacteria 1023
82 Ga0207690_10634666 3300025932 Bacteria 874
83 Ga0207709_10048087 3300025935 Bacteria 2598
84 Ga0207709_10925513 3300025935 Bacteria 710
85 Ga0207669_10295537 3300025937 Bacteria 1228
86 Ga0207661_10155904 3300025944 Bacteria 1978
87 Ga0207661_10205829 3300025944 Bacteria 1732
88 Ga0207679_10374170 3300025945 Bacteria 1247
89 Ga0207712_10213420 3300025961 Bacteria 1539
90 Ga0207668_10041772 3300025972 Bacteria 3102
91 Ga0207640_10845585 3300025981 Bacteria 796
92 Ga0207658_10166187 3300025986 Bacteria 1813
93 Ga0207648_10165029 3300026089 Bacteria 1957
94 Ga0207675_100029695 3300026118 Bacteria 5091
95 Ga0207683_10383638 3300026121 Bacteria 1292
96 Ga0207698_10325555 3300026142 Bacteria 1441
97 Ga0268265_10017135 3300028380 Bacteria 4992
98 Ga0268265_10075636 3300028380 Bacteria 2638
99 Ga0316183_1087843 3300030742 Bacteria 2237
100 Ga0316181_1037279 3300030744 Bacteria 1466
101 Ga0316182_1092058 3300030745 Bacteria 2174
102 Ga0316576_10000047 3300031727 Bacteria 37553
103 Ga0316576_10006863 3300031727 Bacteria 7117
104 Ga0316576_10414476 3300031727 Bacteria 997
105 Ga0316576_10789140 3300031727 Bacteria 684
106 Ga0316578_10000940 3300031728 Bacteria 11068
107 Ga0316578_10297546 3300031728 Bacteria 965
108 Ga0316577_10028248 3300031733 Bacteria 3128
109 Ga0316583_10001644 3300032133 Bacteria 7556
110 Ga0316585_10001443 3300032137 Bacteria 6279
111 Ga0316580_10003623 3300032139 Bacteria 4407
112 Ga0316593_10053316 3300032168 Bacteria 1370
113 Ga0373929_0069202 3300035085 Bacteria 841
114 Ga0373934_0043454 3300035086 Bacteria 1776
115 Ga0373961_0071498 3300035241 Bacteria 1074
116 Ga0373961_0170115 3300035241 Bacteria 753
117 Ga0316574_0079447 3300035398 Bacteria 2080
118 Ga0373931_0210815 3300035691 Bacteria 1165
119 Ga0373931_0242450 3300035691 Bacteria 1093
120 Ga0373937_0123737 3300036401 Bacteria 2411
121 Ga0316582_0004554 3300036647 Bacteria 7019
122 Ga0316584_0000644 3300036712 Bacteria 18952
123 Ga0316581_0000290 3300037588 Bacteria 8864
124 Ga0395901_0612513 3300038443 Bacteria 1097
125 Ga0439465_0190778 3300041413 Bacteria 744
126 Ga0451789_0936328 3300041443 Bacteria 1195
127 Ga0451793_1458501 3300041452 Bacteria 1449
128 Ga0451807_2335560 3300041486 Bacteria 986
129 Ga0451833_0736545 3300041491 Bacteria 5807
130 Ga0451837_1116111 3300041494 Bacteria 1631
131 Ga0451839_0440467 3300041496 Bacteria 1356
132 Ga0439445_0008169 3300042004 Bacteria 2445
133 Ga0439445_0026401 3300042004 Bacteria 1487
134 Ga0439448_0051871 3300042005 Bacteria 1344
135 Ga0439432_016822 3300042006 Bacteria 2459
136 Ga0439432_139011 3300042006 Bacteria 715
137 Ga0439455_0130517 3300042012 Bacteria 708
138 Ga0439446_0106578 3300042156 Bacteria 891
139 Ga0439435_0055266 3300042436 Bacteria 1145
140 Ga0453684_0980630 3300044712 Bacteria 900
141 Ga0466957_0006416 3300044842 Bacteria 6643
142 Ga0451576_0032580 3300045051 Bacteria 5546
143 Ga0451576_0141006 3300045051 Bacteria 2513
144 Ga0466958_0104732 3300045836 Bacteria 1762
145 Ga0466967_0736829 3300045976 Bacteria 977
146 Ga0495641_0195350 3300046461 Bacteria 907
147 Ga0495618_0433596 3300046514 Bacteria 800
148 Ga0495630_0424437 3300046517 Bacteria 1019
149 Ga0495640_0334340 3300046533 Bacteria 937
150 Ga0495587_0170889 3300046536 Bacteria 1235
151 Ga0495634_0265504 3300046642 Bacteria 1046
152 Ga0495657_0103596 3300046675 Bacteria 1810
153 Ga0495658_0315908 3300046683 Bacteria 990
154 Ga0495604_0178122 3300047317 Bacteria 1489
155 Ga0495674_0593581 3300047319 Bacteria 878
156 Ga0495675_0464311 3300047444 Bacteria 731
157 Ga0496100_0198922 3300048903 Bacteria 1459
158 Ga0496102_0084026 3300048905 Bacteria 2938
159 Ga0496102_0137966 3300048905 Bacteria 2285
160 Ga0496102_1328949 3300048905 Bacteria 638
161 Ga0496103_0069810 3300048906 Bacteria 2197
162 Ga0496104_0103845 3300048907 Bacteria 2723
163 Ga0496104_0344585 3300048907 Bacteria 1403
164 Ga0496105_0132243 3300048908 Bacteria 2057
165 Ga0496105_0164277 3300048908 Bacteria 1822
166 Ga0496106_0061230 3300048909 Bacteria 2855
167 Ga0496106_0104721 3300048909 Bacteria 2197
168 Ga0496107_0045373 3300048910 Bacteria 3161
169 Ga0496108_0280183 3300048911 Bacteria 1451
170 Ga0496109_0044270 3300048912 Bacteria 4038
171 Ga0496109_0509281 3300048912 Bacteria 1136
172 Ga0496110_0032613 3300048913 Bacteria 4500
173 Ga0496110_0140367 3300048913 Bacteria 2184
174 Ga0496111_0139903 3300048914 Bacteria 1793
175 Ga0496113_0231393 3300048916 Bacteria 1474
176 Ga0496113_0480864 3300048916 Bacteria 998
177 Ga0496114_0155267 3300048917 Bacteria 1987
178 Ga0501295_075463 3300049518 Bacteria 760
179 Ga0501034_0010551 3300049571 Bacteria 9619
180 Ga0501040_0372533 3300049576 Bacteria 1024
181 Ga0501068_0247857 3300049584 Bacteria 1135
182 Ga0501070_0302871 3300049586 Bacteria 1302
183 Ga0501206_045506 3300049653 Bacteria 686
184 Ga0501256_004277 3300049685 Bacteria 1221
185 Ga0501266_016769 3300049763 Bacteria 975
186 nmdc:mga05p37_30761_c1 3300050507 Bacteria 6552
187 nmdc:mga05p37_405203_c1 3300050507 Bacteria 1591
188 nmdc:mga05p37_424716_c1 3300050507 Bacteria 1546
189 nmdc:mga09592_170189_c1 3300050508 Bacteria 1884
190 nmdc:mga0qj67_141710_c1 3300050509 Unclassified 1949
191 nmdc:mga0qj67_40811_c1 3300050509 Bacteria 3648
192 nmdc:mga06r32_122458_c1 3300050510 Bacteria 2566
193 nmdc:mga06r32_1586206_c1 3300050510 Bacteria 593
194 nmdc:mga06r32_50125_c1 3300050510 Bacteria 3994
195 nmdc:mga08y16_68967_c1 3300050511 Bacteria 3687
196 nmdc:mga0n895_1120929_c1 3300050512 Bacteria 763
197 nmdc:mga0n895_137476_c1 3300050512 Bacteria 2471
198 nmdc:mga0n895_3186_c1 3300050512 Bacteria 13111
199 nmdc:mga0n895_42914_c1 3300050512 Bacteria 4404
200 nmdc:mga0n895_463624_c1 3300050512 Bacteria 1278
201 nmdc:mga0rr50_153251_c1 3300050513 Bacteria 1865
202 nmdc:mga08x19_160870_c1 3300050514 Bacteria 1525
203 nmdc:mga0a205_182274_c1 3300050515 Bacteria 1994
204 nmdc:mga0a205_287626_c1 3300050515 Bacteria 1519
205 nmdc:mga0a205_94799_c2 3300050515 Bacteria 1132
206 Ga0495612_0282834 3300053078 Bacteria 742
207 Ga0495619_0013899 3300053085 Bacteria 5081
208 Ga0500604_0011341 3300053151 Bacteria 2392
209 Ga0500616_0001343 3300053153 Bacteria 24047
210 Ga0500627_0158974 3300053158 Bacteria 1020
211 2515851125 2515154155 Bacteria 7985436
212 2645726711 2643221962 Bacteria 3874254
213 2676474966 2675903058 Bacteria 6822861
214 2827630866 2827628540 Bacteria 6858585
215 2925326927 2925326138 Bacteria 9652120
216 8055635101 8055632911 Bacteria 5283357
217 Ga0065715_10130182
218 Ga0065715_10183175
219 Ga0070683_100316569
220 Ga0070670_100349363
221 Ga0070666_10457968
222 Ga0070682_100037904
223 Ga0070668_100051598
224 Ga0070668_100089355
225 Ga0070673_100564929
226 Ga0070659_100529251
227 Ga0070667_100463722
228 Ga0070667_100686538
229 Ga0070705_100020686
230 Ga0070708_100385217
231 Ga0070681_10043825
232 Ga0068867_100656366
233 Ga0070698_100009315
234 Ga0070684_100523723
235 Ga0070696_100203648
236 Ga0070693_100541861
237 Ga0070704_100398749
238 Ga0068854_100622623
239 Ga0068852_100199225
240 Ga0068861_100291669
241 Ga0068851_10095934
242 Ga0068870_10228039
243 Ga0068860_101353993
244 Ga0068862_100039218
245 Ga0081455_10000773
246 Ga0075428_100000215
247 Ga0075428_100901862
248 Ga0075431_100412098
249 Ga0075433_10208739
250 Ga0075433_10719708
251 Ga0075434_100091815
252 Ga0105245_10004258
253 Ga0105245_10092793
254 Ga0105245_11593289
255 Ga0114129_10043167
256 Ga0114129_10214672
257 Ga0114129_10931968
258 Ga0105243_10006529
259 Ga0105243_10016689
260 Ga0105241_10071430
261 Ga0105242_10127811
262 Ga0105242_10297611
263 Ga0105242_10767322
264 Ga0105248_10831207
265 Ga0105237_10363182
266 Ga0105238_10037839
267 Ga0105238_10614859
268 Ga0105249_10017399
269 Ga0105249_10535236
270 Ga0105239_10267490
271 Ga0105239_10359283
272 Ga0105246_10015147
273 Ga0105246_10214091
274 Ga0157374_10482209
275 Ga0157378_10008190
276 Ga0157378_10031377
277 Ga0163162_10157520
278 Ga0163162_10261671
279 Ga0157372_10869557
280 Ga0157372_11477622
281 Ga0157375_10006171
282 Ga0163163_10961907
283 Ga0157380_10050189
284 Ga0157380_10061259
285 Ga0157380_10975762
286 Ga0157377_10005423
287 Ga0157376_10313496
288 Ga0163161_10201317
289 Ga0206353_10789076
290 Ga0207642_10339587
291 Ga0207643_10170552
292 Ga0207654_10272245
293 Ga0207681_10486879
294 Ga0207694_10401038
295 Ga0207694_10616087
296 Ga0207650_10542010
297 Ga0207690_10461126
298 Ga0207690_10634666
299 Ga0207709_10048087
300 Ga0207709_10925513
301 Ga0207669_10295537
302 Ga0207661_10155904
303 Ga0207661_10205829
304 Ga0207679_10374170
305 Ga0207712_10213420
306 Ga0207668_10041772
307 Ga0207640_10845585
308 Ga0207658_10166187
309 Ga0207648_10165029
310 Ga0207675_100029695
311 Ga0207683_10383638
312 Ga0207698_10325555
313 Ga0268265_10017135
314 Ga0268265_10075636
315 Ga0316183_1087843
316 Ga0316181_1037279
317 Ga0316182_1092058
318 Ga0316576_10000047
319 Ga0316576_10006863
320 Ga0316576_10414476
321 Ga0316576_10789140
322 Ga0316578_10000940
323 Ga0316578_10297546
324 Ga0316577_10028248
325 Ga0316583_10001644
326 Ga0316585_10001443
327 Ga0316580_10003623
328 Ga0316593_10053316
329 Ga0373929_0069202
330 Ga0373934_0043454
331 Ga0373961_0071498
332 Ga0373961_0170115
333 Ga0316574_0079447
334 Ga0373931_0210815
335 Ga0373931_0242450
336 Ga0373937_0123737
337 Ga0316582_0004554
338 Ga0316584_0000644
339 Ga0316581_0000290
340 Ga0395901_0612513
341 Ga0439465_0190778
342 Ga0451789_0936328
343 Ga0451793_1458501
344 Ga0451807_2335560
345 Ga0451833_0736545
346 Ga0451837_1116111
347 Ga0451839_0440467
348 Ga0439445_0008169
349 Ga0439445_0026401
350 Ga0439448_0051871
351 Ga0439432_016822
352 Ga0439432_139011
353 Ga0439455_0130517
354 Ga0439446_0106578
355 Ga0439435_0055266
356 Ga0453684_0980630
357 Ga0466957_0006416
358 Ga0451576_0032580
359 Ga0451576_0141006
360 Ga0466958_0104732
361 Ga0466967_0736829
362 Ga0495641_0195350
363 Ga0495618_0433596
364 Ga0495630_0424437
365 Ga0495640_0334340
366 Ga0495587_0170889
367 Ga0495634_0265504
368 Ga0495657_0103596
369 Ga0495658_0315908
370 Ga0495604_0178122
371 Ga0495674_0593581
372 Ga0495675_0464311
373 Ga0496100_0198922
374 Ga0496102_0084026
375 Ga0496102_0137966
376 Ga0496102_1328949
377 Ga0496103_0069810
378 Ga0496104_0103845
379 Ga0496104_0344585
380 Ga0496105_0132243
381 Ga0496105_0164277
382 Ga0496106_0061230
383 Ga0496106_0104721
384 Ga0496107_0045373
385 Ga0496108_0280183
386 Ga0496109_0044270
387 Ga0496109_0509281
388 Ga0496110_0032613
389 Ga0496110_0140367
390 Ga0496111_0139903
391 Ga0496113_0231393
392 Ga0496113_0480864
393 Ga0496114_0155267
394 Ga0501295_075463
395 Ga0501034_0010551
396 Ga0501040_0372533
397 Ga0501068_0247857
398 Ga0501070_0302871
399 Ga0501206_045506
400 Ga0501256_004277
401 Ga0501266_016769
402 nmdc:mga05p37_30761_c1
403 nmdc:mga05p37_405203_c1
404 nmdc:mga05p37_424716_c1
405 nmdc:mga09592_170189_c1
406 nmdc:mga0qj67_141710_c1
407 nmdc:mga0qj67_40811_c1
408 nmdc:mga06r32_122458_c1
409 nmdc:mga06r32_1586206_c1
410 nmdc:mga06r32_50125_c1
411 nmdc:mga08y16_68967_c1
412 nmdc:mga0n895_1120929_c1
413 nmdc:mga0n895_137476_c1
414 nmdc:mga0n895_3186_c1
415 nmdc:mga0n895_42914_c1
416 nmdc:mga0n895_463624_c1
417 nmdc:mga0rr50_153251_c1
418 nmdc:mga08x19_160870_c1
419 nmdc:mga0a205_182274_c1
420 nmdc:mga0a205_287626_c1
421 nmdc:mga0a205_94799_c2
422 Ga0495612_0282834
423 Ga0495619_0013899
424 Ga0500604_0011341
425 Ga0500616_0001343
426 Ga0500627_0158974
427 2515851125
428 2645726711
429 2676474966
430 2827630866
431 2925326927
432 8055635101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

23

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1non-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus 0.9574 1 183
1xz8-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, nucleotide-bound form 0.9519 2 183
4p81-assembly1.cif.gz_C structure of ancestral pyrr protein (ancorangepyrr) 0.9495 3 183
1ufr-assembly2.cif.gz_D crystal structure of tt1027 from thermus thermophilus hb8 0.9405 1 183
4p81-assembly1.cif.gz_D structure of ancestral pyrr protein (ancorangepyrr) 0.9359 1 183
ID Description Score Start End Superfamily
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9034 1 183 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8956 2 181 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8934 1 183 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8451 2 181 3.40.50.2020
5ipfC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8192 3 158 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3N5P8R1-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9725 1 185 GO:0004845
GO:0006355
AF-A0A522T6L2-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9675 1 183 GO:0004845
GO:0006355
AF-A0A3N5P8R1-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9672 1 185 GO:0004845
GO:0006355
AF-A0A6A7L5P5-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9663 2 186 GO:0004845
GO:0006355
AF-A0A328FGI6-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9654 2 181 GO:0004845
GO:0006355

Map