F327781
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 216 | 166 | 209 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300035121|Ga0373960_0019646|Ga0373960_0019646_265_1122 |
| Length | 285 |
| Sequence | MSERDPAPGGAVPPVFFELVAGPDWQAIEFISDLHLGEHTPGTFRAFEHHLLNTDAQAVLLLGDVFEVWVGDDAADSGFEMRCAQLLQAAARRLHCAFMAGNRDFLLGPGLLQRCGVQELPDPTVLAAFGTRTLLSHGDALCLGDVEYQRVRAVLRTPQWRTQFLAQPIAARREQVRRARAESEARKRGSSPQDYADVDATLALQWLRAAAAPVLVHGHTHRPASGPLGPSTAHLRHVLSDWDLEDTDRPRAEVLRLTAQGFERRPLGLPPDRPGQTDDRRGAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 2 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 3 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 4 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 7 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 52 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 85 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 86 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 87 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 88 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 89 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 94 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 95 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 96 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 97 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 98 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 99 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 104 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 106 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 107 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 108 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 109 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 110 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 133 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 134 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 135 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 144 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 145 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 146 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 147 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 151 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 152 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 153 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 154 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 155 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 156 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 157 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 158 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 161 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 162 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 163 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 164 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 166 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.76 |
| Metatranscriptomes | 0 |
| Isolates | 3.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.98 |
| Nodule | 0 |
| Rhizoplane | 0.93 |
| Rhizosphere | 57.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1002097 | 3300002705 | Bacteria | 7548 |
| 2 | JGI25154J39366_1002045 | 3300002738 | Bacteria | 5790 |
| 3 | JGI25157J39369_1000153 | 3300002741 | Bacteria | 57737 |
| 4 | rootH1_10012621 | 3300003316 | Bacteria | 1929 |
| 5 | rootH1_10012622 | 3300003316 | Bacteria | 4124 |
| 6 | rootH1_10059577 | 3300003316 | Bacteria | 2799 |
| 7 | rootH1_10097336 | 3300003316 | Bacteria | 1189 |
| 8 | rootH2_10048728 | 3300003320 | Bacteria | 1926 |
| 9 | rootL2_10044027 | 3300003322 | Bacteria | 2632 |
| 10 | rootL2_10054149 | 3300003322 | Bacteria | 1942 |
| 11 | rootL2_10157106 | 3300003322 | Bacteria | 1668 |
| 12 | rootH1_10020183 | 3300003323 | Bacteria | 4017 |
| 13 | rootH1_10075465 | 3300003323 | Bacteria | 3141 |
| 14 | rootH1_10131493 | 3300003323 | Bacteria | 1015 |
| 15 | rootH1_10240268 | 3300003323 | Bacteria | 1139 |
| 16 | Ga0055539_1001034 | 3300003752 | Bacteria | 5969 |
| 17 | Ga0055539_1001264 | 3300003752 | Bacteria | 5032 |
| 18 | Ga0055539_1001679 | 3300003752 | Bacteria | 3920 |
| 19 | Ga0055533_1000080 | 3300003756 | Bacteria | 131291 |
| 20 | Ga0055525_1000980 | 3300003759 | Bacteria | 7715 |
| 21 | Ga0055529_1000215 | 3300003763 | Bacteria | 76185 |
| 22 | Ga0055540_1027576 | 3300003792 | Bacteria | 1356 |
| 23 | Ga0055531_10000064 | 3300003794 | Bacteria | 117923 |
| 24 | Ga0070677_10032015 | 3300005333 | Bacteria | 2014 |
| 25 | Ga0068869_100015685 | 3300005334 | Bacteria | 5089 |
| 26 | Ga0070682_100043250 | 3300005337 | Bacteria | 2785 |
| 27 | Ga0068868_100420622 | 3300005338 | Bacteria | 1157 |
| 28 | Ga0070660_100077594 | 3300005339 | Bacteria | 2603 |
| 29 | Ga0070671_100077941 | 3300005355 | Bacteria | 2769 |
| 30 | Ga0070671_100488775 | 3300005355 | Unclassified | 1058 |
| 31 | Ga0070673_100034820 | 3300005364 | Bacteria | 3814 |
| 32 | Ga0070659_100188308 | 3300005366 | Bacteria | 1695 |
| 33 | Ga0070665_100231839 | 3300005548 | Bacteria | 1846 |
| 34 | Ga0068855_100052925 | 3300005563 | Bacteria | 4778 |
| 35 | Ga0068855_100245915 | 3300005563 | Bacteria | 1997 |
| 36 | Ga0068855_100285511 | 3300005563 | Bacteria | 1831 |
| 37 | Ga0068857_100039972 | 3300005577 | Bacteria | 4158 |
| 38 | Ga0068854_100105903 | 3300005578 | Bacteria | 2115 |
| 39 | Ga0068856_100006775 | 3300005614 | Bacteria | 11210 |
| 40 | Ga0068856_100243142 | 3300005614 | Bacteria | 1815 |
| 41 | Ga0068852_100027604 | 3300005616 | Bacteria | 4628 |
| 42 | Ga0068864_100092747 | 3300005618 | Bacteria | 2666 |
| 43 | Ga0068863_100026647 | 3300005841 | Bacteria | 5512 |
| 44 | Ga0075366_10021231 | 3300006195 | Bacteria | 3774 |
| 45 | Ga0075366_10097550 | 3300006195 | Bacteria | 1763 |
| 46 | Ga0097621_100012258 | 3300006237 | Bacteria | 6344 |
| 47 | Ga0075370_10022180 | 3300006353 | Bacteria | 3484 |
| 48 | Ga0075370_10027549 | 3300006353 | Bacteria | 3154 |
| 49 | Ga0068871_100019134 | 3300006358 | Bacteria | 5225 |
| 50 | Ga0105245_10047514 | 3300009098 | Bacteria | 3838 |
| 51 | Ga0105245_10422649 | 3300009098 | Bacteria | 1336 |
| 52 | Ga0105243_10035902 | 3300009148 | Bacteria | 3844 |
| 53 | Ga0105238_10024271 | 3300009551 | Bacteria | 6180 |
| 54 | Ga0105239_10042002 | 3300010375 | Bacteria | 5010 |
| 55 | Ga0157371_10098385 | 3300013102 | Bacteria | 2074 |
| 56 | Ga0157369_10289518 | 3300013105 | Bacteria | 1705 |
| 57 | Ga0157374_10721801 | 3300013296 | Bacteria | 1010 |
| 58 | Ga0163162_10102740 | 3300013306 | Bacteria | 2952 |
| 59 | Ga0157379_10218061 | 3300014968 | Bacteria | 1728 |
| 60 | Ga0157376_10226360 | 3300014969 | Bacteria | 1735 |
| 61 | Ga0213872_10000086 | 3300021361 | Bacteria | 84955 |
| 62 | Ga0213872_10024378 | 3300021361 | Bacteria | 2783 |
| 63 | Ga0213872_10054108 | 3300021361 | Bacteria | 1820 |
| 64 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 65 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 66 | Ga0207427_100319 | 3300025231 | Bacteria | 32673 |
| 67 | Ga0209258_100258 | 3300025242 | Bacteria | 92469 |
| 68 | Ga0209258_101059 | 3300025242 | Bacteria | 12014 |
| 69 | Ga0209646_1000341 | 3300025246 | Bacteria | 34654 |
| 70 | Ga0209026_1000054 | 3300025250 | Bacteria | 242508 |
| 71 | Ga0209677_101135 | 3300025253 | Bacteria | 12450 |
| 72 | Ga0209677_101455 | 3300025253 | Bacteria | 10226 |
| 73 | Ga0209677_104642 | 3300025253 | Bacteria | 3880 |
| 74 | Ga0209148_1002621 | 3300025254 | Bacteria | 5870 |
| 75 | Ga0209759_1000043 | 3300025256 | Bacteria | 242513 |
| 76 | Ga0209759_1002375 | 3300025256 | Bacteria | 8372 |
| 77 | Ga0209759_1003506 | 3300025256 | Bacteria | 6222 |
| 78 | Ga0209759_1005490 | 3300025256 | Bacteria | 4429 |
| 79 | Ga0209759_1006219 | 3300025256 | Bacteria | 4050 |
| 80 | Ga0209455_1000092 | 3300025272 | Bacteria | 220516 |
| 81 | Ga0209051_1006522 | 3300025303 | Bacteria | 6558 |
| 82 | Ga0209051_1052069 | 3300025303 | Bacteria | 1356 |
| 83 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 84 | Ga0209257_1009254 | 3300025304 | Bacteria | 5333 |
| 85 | Ga0207705_10049916 | 3300025909 | Bacteria | 3011 |
| 86 | Ga0207705_10078522 | 3300025909 | Bacteria | 2402 |
| 87 | Ga0207654_10008823 | 3300025911 | Bacteria | 5115 |
| 88 | Ga0207671_10084585 | 3300025914 | Bacteria | 2383 |
| 89 | Ga0207657_10023396 | 3300025919 | Bacteria | 5753 |
| 90 | Ga0207657_10026400 | 3300025919 | Bacteria | 5339 |
| 91 | Ga0207687_10115222 | 3300025927 | Bacteria | 2002 |
| 92 | Ga0207644_10054994 | 3300025931 | Bacteria | 2868 |
| 93 | Ga0207709_10076975 | 3300025935 | Bacteria | 2137 |
| 94 | Ga0207704_10456442 | 3300025938 | Bacteria | 1021 |
| 95 | Ga0207689_10012390 | 3300025942 | Bacteria | 7293 |
| 96 | Ga0207661_10128387 | 3300025944 | Bacteria | 2168 |
| 97 | Ga0207667_10040140 | 3300025949 | Bacteria | 4984 |
| 98 | Ga0207667_10045180 | 3300025949 | Bacteria | 4666 |
| 99 | Ga0207667_10269742 | 3300025949 | Bacteria | 1740 |
| 100 | Ga0207651_10008738 | 3300025960 | Bacteria | 5493 |
| 101 | Ga0207640_10085409 | 3300025981 | Bacteria | 2170 |
| 102 | Ga0207658_10301937 | 3300025986 | Bacteria | 1380 |
| 103 | Ga0207702_10001205 | 3300026078 | Bacteria | 26236 |
| 104 | Ga0207648_10065173 | 3300026089 | Bacteria | 3176 |
| 105 | Ga0207674_10006178 | 3300026116 | Bacteria | 14132 |
| 106 | Ga0207683_10097779 | 3300026121 | Bacteria | 2618 |
| 107 | Ga0207698_10016776 | 3300026142 | Bacteria | 4949 |
| 108 | Ga0268266_10091708 | 3300028379 | Bacteria | 2664 |
| 109 | Ga0307517_10002492 | 3300028786 | Bacteria | 29429 |
| 110 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 111 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 112 | Ga0307515_10065747 | 3300028794 | Bacteria | 5039 |
| 113 | Ga0307515_10074180 | 3300028794 | Bacteria | 4556 |
| 114 | Ga0307512_10114418 | 3300030522 | Bacteria | 1761 |
| 115 | Ga0307512_10194798 | 3300030522 | Unclassified | 1110 |
| 116 | Ga0265316_10002079 | 3300031344 | Bacteria | 21039 |
| 117 | Ga0307513_10005429 | 3300031456 | Bacteria | 16849 |
| 118 | Ga0307513_10489854 | 3300031456 | Bacteria | 948 |
| 119 | Ga0307509_10000599 | 3300031507 | Bacteria | 61465 |
| 120 | Ga0307509_10127007 | 3300031507 | Bacteria | 2514 |
| 121 | Ga0307509_10177346 | 3300031507 | Bacteria | 2001 |
| 122 | Ga0307408_100000056 | 3300031548 | Bacteria | 140709 |
| 123 | Ga0307516_10001121 | 3300031730 | Bacteria | 37343 |
| 124 | Ga0307516_10006357 | 3300031730 | Bacteria | 13855 |
| 125 | Ga0307414_10023643 | 3300032004 | Bacteria | 3902 |
| 126 | Ga0307411_10001214 | 3300032005 | Bacteria | 10218 |
| 127 | Ga0307510_10050555 | 3300033180 | Bacteria | 4407 |
| 128 | Ga0373934_0104732 | 3300035086 | Bacteria | 1145 |
| 129 | Ga0373939_0000029 | 3300035114 | Bacteria | 52306 |
| 130 | Ga0373960_0000747 | 3300035121 | Bacteria | 6775 |
| 131 | Ga0373960_0019646 | 3300035121 | Bacteria | 1777 |
| 132 | Ga0373931_0000407 | 3300035691 | Bacteria | 17625 |
| 133 | Ga0373931_0090644 | 3300035691 | Bacteria | 1702 |
| 134 | Ga0373927_0239193 | 3300035695 | Bacteria | 1193 |
| 135 | Ga0395898_0024766 | 3300037466 | Bacteria | 6051 |
| 136 | Ga0395898_0308215 | 3300037466 | Bacteria | 1510 |
| 137 | Ga0395905_0002774 | 3300037471 | Bacteria | 19194 |
| 138 | Ga0395901_0000993 | 3300038443 | Bacteria | 30621 |
| 139 | Ga0436361_0067354 | 3300039447 | Bacteria | 4843 |
| 140 | Ga0436361_0516256 | 3300039447 | Bacteria | 3841 |
| 141 | Ga0436361_0757428 | 3300039447 | Bacteria | 38736 |
| 142 | Ga0436361_0874346 | 3300039447 | Bacteria | 6661 |
| 143 | Ga0436361_0943694 | 3300039447 | Bacteria | 119574 |
| 144 | Ga0451802_1257972 | 3300041460 | Bacteria | 2534 |
| 145 | Ga0451853_2397232 | 3300041512 | Bacteria | 645 |
| 146 | Ga0439437_006047 | 3300042000 | Bacteria | 1337 |
| 147 | Ga0450889_000309 | 3300042144 | Bacteria | 5426 |
| 148 | Ga0450893_0000946 | 3300042532 | Bacteria | 4353 |
| 149 | Ga0451577_0017754 | 3300042876 | Bacteria | 6564 |
| 150 | Ga0466972_0130686 | 3300044658 | Bacteria | 1183 |
| 151 | Ga0466963_0068736 | 3300044694 | Bacteria | 2380 |
| 152 | Ga0466957_0001500 | 3300044842 | Bacteria | 12246 |
| 153 | Ga0466957_0052477 | 3300044842 | Bacteria | 2483 |
| 154 | Ga0466959_0154468 | 3300045049 | Bacteria | 1616 |
| 155 | Ga0451576_0270226 | 3300045051 | Bacteria | 1777 |
| 156 | Ga0466967_0121721 | 3300045976 | Bacteria | 2412 |
| 157 | Ga0495590_0003350 | 3300046457 | Bacteria | 6550 |
| 158 | Ga0495638_0238108 | 3300046460 | Bacteria | 1009 |
| 159 | Ga0495639_0027106 | 3300046475 | Bacteria | 2535 |
| 160 | Ga0495583_0001886 | 3300046506 | Bacteria | 19465 |
| 161 | Ga0495606_0009530 | 3300046507 | Bacteria | 8201 |
| 162 | Ga0495630_0180194 | 3300046517 | Bacteria | 1611 |
| 163 | Ga0495666_0167692 | 3300046526 | Bacteria | 1016 |
| 164 | Ga0495652_0124186 | 3300046529 | Bacteria | 2054 |
| 165 | Ga0495668_0038058 | 3300046616 | Bacteria | 2690 |
| 166 | Ga0495625_0014904 | 3300046660 | Bacteria | 6182 |
| 167 | Ga0495669_0026177 | 3300046684 | Bacteria | 2548 |
| 168 | Ga0495649_0003908 | 3300046694 | Bacteria | 9856 |
| 169 | Ga0495589_0003989 | 3300046794 | Bacteria | 7924 |
| 170 | Ga0495660_0040604 | 3300046810 | Bacteria | 2578 |
| 171 | Ga0495686_0051996 | 3300047472 | Bacteria | 2569 |
| 172 | Ga0496115_0179797 | 3300048918 | Bacteria | 1749 |
| 173 | Ga0496121_0162720 | 3300048924 | Bacteria | 1630 |
| 174 | Ga0496124_0064407 | 3300048927 | Bacteria | 3060 |
| 175 | Ga0496125_0217823 | 3300048928 | Bacteria | 1233 |
| 176 | Ga0501039_0149507 | 3300049575 | Bacteria | 1835 |
| 177 | Ga0501068_0002938 | 3300049584 | Bacteria | 9079 |
| 178 | Ga0501071_0183646 | 3300049587 | Bacteria | 1567 |
| 179 | Ga0501072_0039656 | 3300049588 | Bacteria | 3697 |
| 180 | Ga0501073_0005034 | 3300049589 | Bacteria | 9908 |
| 181 | Ga0501074_0005379 | 3300049590 | Bacteria | 9212 |
| 182 | Ga0501076_0013437 | 3300049592 | Bacteria | 6142 |
| 183 | Ga0501077_0002438 | 3300049593 | Bacteria | 11149 |
| 184 | Ga0501211_000847 | 3300049658 | Bacteria | 3186 |
| 185 | Ga0501227_010827 | 3300049665 | Bacteria | 1981 |
| 186 | Ga0501257_053201 | 3300049686 | Bacteria | 1013 |
| 187 | Ga0501258_001311 | 3300049687 | Bacteria | 2001 |
| 188 | Ga0501079_0007930 | 3300049741 | Bacteria | 8049 |
| 189 | Ga0501080_0006136 | 3300049742 | Bacteria | 10780 |
| 190 | Ga0501083_0013427 | 3300049744 | Bacteria | 5726 |
| 191 | Ga0501272_003681 | 3300049769 | Bacteria | 1570 |
| 192 | nmdc:mga0k408_29878_c1 | 3300050493 | Bacteria | 3105 |
| 193 | nmdc:mga07m45_2973_c1 | 3300050496 | Bacteria | 8065 |
| 194 | nmdc:mga07m45_9627_c1 | 3300050496 | Bacteria | 5022 |
| 195 | Ga0500635_0000211 | 3300053080 | Bacteria | 28344 |
| 196 | Ga0500578_0137626 | 3300053086 | Bacteria | 1528 |
| 197 | Ga0500646_0086086 | 3300053090 | Bacteria | 966 |
| 198 | Ga0500594_0017903 | 3300053118 | Bacteria | 1739 |
| 199 | Ga0500614_013208 | 3300053123 | Bacteria | 1812 |
| 200 | Ga0500559_0000908 | 3300053136 | Bacteria | 18870 |
| 201 | Ga0500559_0020786 | 3300053136 | Bacteria | 2778 |
| 202 | Ga0500568_0018285 | 3300053139 | Bacteria | 3071 |
| 203 | Ga0500622_0005865 | 3300053156 | Bacteria | 7263 |
| 204 | Ga0500627_0162296 | 3300053158 | Unclassified | 1008 |
| 205 | Ga0500636_0043533 | 3300053177 | Bacteria | 2650 |
| 206 | Ga0500587_000495 | 3300053739 | Bacteria | 4741 |
| 207 | Ga0501084_0012816 | 3300054114 | Bacteria | 6946 |
| 208 | Ga0590074_001791 | 3300059423 | Bacteria | 3509 |
| 209 | Ga0501082_0062000 | 3300060353 | Bacteria | 3218 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041512 | Ga0451853_2397232 | Ga0451853_2397232_13_627 | 203 |
| 2 | 3300037466 | Ga0395898_0308215 | Ga0395898_0308215_237_899 | 218 |
| 3 | 3300049575 | Ga0501039_0149507 | Ga0501039_0149507_538_1257 | 231 |
| 4 | 3300049584 | Ga0501068_0002938 | Ga0501068_0002938_4045_4764 | 231 |
| 5 | 3300049587 | Ga0501071_0183646 | Ga0501071_0183646_237_956 | 231 |
| 6 | 3300049588 | Ga0501072_0039656 | Ga0501072_0039656_1821_2540 | 231 |
| 7 | 3300049589 | Ga0501073_0005034 | Ga0501073_0005034_7022_7741 | 231 |
| 8 | 3300049590 | Ga0501074_0005379 | Ga0501074_0005379_4933_5652 | 231 |
| 9 | 3300049592 | Ga0501076_0013437 | Ga0501076_0013437_1077_1796 | 231 |
| 10 | 3300049593 | Ga0501077_0002438 | Ga0501077_0002438_5119_5838 | 231 |
| 11 | 3300049741 | Ga0501079_0007930 | Ga0501079_0007930_698_1417 | 231 |
| 12 | 3300049742 | Ga0501080_0006136 | Ga0501080_0006136_2912_3631 | 231 |
| 13 | 3300049744 | Ga0501083_0013427 | Ga0501083_0013427_2790_3509 | 231 |
| 14 | 3300054114 | Ga0501084_0012816 | Ga0501084_0012816_3437_4156 | 231 |
| 15 | 3300060353 | Ga0501082_0062000 | Ga0501082_0062000_2044_2763 | 231 |
| 16 | 3300005333 | Ga0070677_10032015 | Ga0070677_100320152 | 232 |
| 17 | 3300005355 | Ga0070671_100488775 | Ga0070671_1004887752 | 232 |
| 18 | 3300006237 | Ga0097621_100012258 | Ga0097621_1000122584 | 232 |
| 19 | 3300006358 | Ga0068871_100019134 | Ga0068871_1000191344 | 232 |
| 20 | 3300044842 | Ga0466957_0001500 | Ga0466957_0001500_10339_11085 | 232 |
| 21 | 3300045049 | Ga0466959_0154468 | Ga0466959_0154468_859_1605 | 232 |
| 22 | 3300025938 | Ga0207704_10456442 | Ga0207704_104564422 | 235 |
| 23 | 3300045976 | Ga0466967_0121721 | Ga0466967_0121721_150_905 | 235 |
| 24 | 3300005614 | Ga0068856_100243142 | Ga0068856_1002431422 | 236 |
| 25 | iso_pu_bacteria | 2643221544 | 2643746158 | 243 |
| 26 | iso_pu_bacteria | 2643221585 | 2643937077 | 243 |
| 27 | iso_pu_bacteria | 2643221639 | 2644217945 | 243 |
| 28 | iso_pu_bacteria | 2643221646 | 2644258312 | 243 |
| 29 | iso_pu_bacteria | 2643221656 | 2644318242 | 243 |
| 30 | iso_pu_bacteria | 2738541337 | 2739057084 | 243 |
| 31 | 3300031344 | Ga0265316_10002079 | Ga0265316_100020792 | 244 |
| 32 | 3300031507 | Ga0307509_10000599 | Ga0307509_1000059923 | 246 |
| 33 | 3300046457 | Ga0495590_0003350 | Ga0495590_0003350_3670_4425 | 246 |
| 34 | 3300046810 | Ga0495660_0040604 | Ga0495660_0040604_1067_1822 | 246 |
| 35 | 3300003316 | rootH1_10012621 | rootH1_100126212 | 247 |
| 36 | 3300003316 | rootH1_10012622 | rootH1_100126225 | 247 |
| 37 | 3300003322 | rootL2_10044027 | rootL2_100440273 | 247 |
| 38 | 3300003322 | rootL2_10054149 | rootL2_100541492 | 247 |
| 39 | 3300003323 | rootH1_10020183 | rootH1_100201834 | 247 |
| 40 | 3300003792 | Ga0055540_1027576 | Ga0055540_10275762 | 247 |
| 41 | 3300003794 | Ga0055531_10000064 | Ga0055531_1000006410 | 247 |
| 42 | 3300005337 | Ga0070682_100043250 | Ga0070682_1000432503 | 247 |
| 43 | 3300006195 | Ga0075366_10097550 | Ga0075366_100975502 | 247 |
| 44 | 3300006353 | Ga0075370_10027549 | Ga0075370_100275492 | 247 |
| 45 | 3300013102 | Ga0157371_10098385 | Ga0157371_100983852 | 247 |
| 46 | 3300025303 | Ga0209051_1052069 | Ga0209051_10520692 | 247 |
| 47 | 3300025304 | Ga0209257_1000032 | Ga0209257_1000032529 | 247 |
| 48 | 3300025304 | Ga0209257_1009254 | Ga0209257_10092543 | 247 |
| 49 | 3300028794 | Ga0307515_10065747 | Ga0307515_100657475 | 247 |
| 50 | 3300031548 | Ga0307408_100000056 | Ga0307408_1000000567 | 247 |
| 51 | 3300032004 | Ga0307414_10023643 | Ga0307414_100236433 | 247 |
| 52 | 3300032005 | Ga0307411_10001214 | Ga0307411_100012143 | 247 |
| 53 | 3300035114 | Ga0373939_0000029 | Ga0373939_0000029_25733_26479 | 247 |
| 54 | 3300035121 | Ga0373960_0000747 | Ga0373960_0000747_1649_2395 | 247 |
| 55 | 3300035691 | Ga0373931_0000407 | Ga0373931_0000407_9948_10694 | 247 |
| 56 | 3300037471 | Ga0395905_0002774 | Ga0395905_0002774_7210_7956 | 247 |
| 57 | 3300042000 | Ga0439437_006047 | Ga0439437_006047_485_1231 | 247 |
| 58 | 3300042144 | Ga0450889_000309 | Ga0450889_000309_3611_4357 | 247 |
| 59 | 3300042532 | Ga0450893_0000946 | Ga0450893_0000946_3537_4283 | 247 |
| 60 | 3300045051 | Ga0451576_0270226 | Ga0451576_0270226_764_1510 | 247 |
| 61 | 3300049658 | Ga0501211_000847 | Ga0501211_000847_903_1649 | 247 |
| 62 | 3300049665 | Ga0501227_010827 | Ga0501227_010827_214_960 | 247 |
| 63 | 3300049686 | Ga0501257_053201 | Ga0501257_053201_95_841 | 247 |
| 64 | 3300049687 | Ga0501258_001311 | Ga0501258_001311_1161_1907 | 247 |
| 65 | 3300049769 | Ga0501272_003681 | Ga0501272_003681_280_1026 | 247 |
| 66 | 3300050496 | nmdc:mga07m45_9627_c1 | nmdc:mga07m45_9627_c1_944_1690 | 247 |
| 67 | 3300005355 | Ga0070671_100077941 | Ga0070671_1000779412 | 248 |
| 68 | 3300005548 | Ga0070665_100231839 | Ga0070665_1002318393 | 248 |
| 69 | 3300005618 | Ga0068864_100092747 | Ga0068864_1000927473 | 248 |
| 70 | 3300005841 | Ga0068863_100026647 | Ga0068863_1000266472 | 248 |
| 71 | 3300009098 | Ga0105245_10047514 | Ga0105245_100475144 | 248 |
| 72 | 3300013306 | Ga0163162_10102740 | Ga0163162_101027403 | 248 |
| 73 | 3300014968 | Ga0157379_10218061 | Ga0157379_102180613 | 248 |
| 74 | 3300025927 | Ga0207687_10115222 | Ga0207687_101152222 | 248 |
| 75 | 3300025931 | Ga0207644_10054994 | Ga0207644_100549943 | 248 |
| 76 | 3300025986 | Ga0207658_10301937 | Ga0207658_103019372 | 248 |
| 77 | 3300028379 | Ga0268266_10091708 | Ga0268266_100917083 | 248 |
| 78 | 3300031456 | Ga0307513_10489854 | Ga0307513_104898542 | 248 |
| 79 | 3300046616 | Ga0495668_0038058 | Ga0495668_0038058_793_1557 | 248 |
| 80 | 3300053086 | Ga0500578_0137626 | Ga0500578_0137626_719_1507 | 249 |
| 81 | 3300053139 | Ga0500568_0018285 | Ga0500568_0018285_1107_1889 | 249 |
| 82 | 3300021361 | Ga0213872_10024378 | Ga0213872_100243782 | 250 |
| 83 | 3300028794 | Ga0307515_10000043 | Ga0307515_10000043217 | 250 |
| 84 | 3300039447 | Ga0436361_0757428 | Ga0436361_0757428_3798_4586 | 250 |
| 85 | 3300039447 | Ga0436361_0874346 | Ga0436361_0874346_5305_6102 | 250 |
| 86 | 3300041460 | Ga0451802_1257972 | Ga0451802_1257972_840_1664 | 250 |
| 87 | 3300003322 | rootL2_10157106 | rootL2_101571062 | 251 |
| 88 | 3300028794 | Ga0307515_10000006 | Ga0307515_10000006171 | 251 |
| 89 | 3300030522 | Ga0307512_10194798 | Ga0307512_101947981 | 251 |
| 90 | 3300031456 | Ga0307513_10005429 | Ga0307513_100054298 | 251 |
| 91 | 3300031730 | Ga0307516_10001121 | Ga0307516_1000112127 | 251 |
| 92 | 3300035121 | Ga0373960_0019646 | Ga0373960_0019646_265_1122 | 251 |
| 93 | 3300048927 | Ga0496124_0064407 | Ga0496124_0064407_690_1472 | 251 |
| 94 | 3300053158 | Ga0500627_0162296 | Ga0500627_0162296_103_951 | 251 |
| 95 | 3300059423 | Ga0590074_001791 | Ga0590074_001791_1302_2087 | 251 |
| 96 | 3300021361 | Ga0213872_10000086 | Ga0213872_1000008674 | 252 |
| 97 | 3300039447 | Ga0436361_0943694 | Ga0436361_0943694_76409_77221 | 252 |
| 98 | 3300042876 | Ga0451577_0017754 | Ga0451577_0017754_1382_2200 | 252 |
| 99 | 3300044658 | Ga0466972_0130686 | Ga0466972_0130686_363_1136 | 252 |
| 100 | iso_pu_bacteria | 2643221654 | 2644304519 | 252 |
| 101 | 3300014969 | Ga0157376_10226360 | Ga0157376_102263602 | 253 |
| 102 | 3300028786 | Ga0307517_10002492 | Ga0307517_1000249225 | 253 |
| 103 | 3300031507 | Ga0307509_10177346 | Ga0307509_101773462 | 253 |
| 104 | 3300046460 | Ga0495638_0238108 | Ga0495638_0238108_79_858 | 253 |
| 105 | 3300046517 | Ga0495630_0180194 | Ga0495630_0180194_635_1411 | 253 |
| 106 | 3300046526 | Ga0495666_0167692 | Ga0495666_0167692_52_828 | 253 |
| 107 | 3300053090 | Ga0500646_0086086 | Ga0500646_0086086_50_829 | 253 |
| 108 | 3300053118 | Ga0500594_0017903 | Ga0500594_0017903_477_1256 | 253 |
| 109 | 3300053123 | Ga0500614_013208 | Ga0500614_013208_1018_1797 | 253 |
| 110 | 3300053136 | Ga0500559_0000908 | Ga0500559_0000908_16588_17367 | 253 |
| 111 | 3300053156 | Ga0500622_0005865 | Ga0500622_0005865_1123_1902 | 253 |
| 112 | 3300053739 | Ga0500587_000495 | Ga0500587_000495_2294_3073 | 253 |
| 113 | 3300009148 | Ga0105243_10035902 | Ga0105243_100359023 | 254 |
| 114 | 3300025935 | Ga0207709_10076975 | Ga0207709_100769752 | 254 |
| 115 | 3300028794 | Ga0307515_10074180 | Ga0307515_100741805 | 254 |
| 116 | 3300030522 | Ga0307512_10114418 | Ga0307512_101144181 | 254 |
| 117 | 3300031507 | Ga0307509_10127007 | Ga0307509_101270073 | 254 |
| 118 | 3300031730 | Ga0307516_10006357 | Ga0307516_100063577 | 254 |
| 119 | 3300033180 | Ga0307510_10050555 | Ga0307510_100505555 | 254 |
| 120 | 3300048924 | Ga0496121_0162720 | Ga0496121_0162720_523_1314 | 254 |
| 121 | 3300048928 | Ga0496125_0217823 | Ga0496125_0217823_229_1020 | 254 |
| 122 | 3300005563 | Ga0068855_100245915 | Ga0068855_1002459153 | 256 |
| 123 | 3300013105 | Ga0157369_10289518 | Ga0157369_102895182 | 256 |
| 124 | 3300021361 | Ga0213872_10054108 | Ga0213872_100541082 | 256 |
| 125 | 3300025303 | Ga0209051_1006522 | Ga0209051_10065224 | 256 |
| 126 | 3300025949 | Ga0207667_10269742 | Ga0207667_102697423 | 256 |
| 127 | 3300035691 | Ga0373931_0090644 | Ga0373931_0090644_177_959 | 256 |
| 128 | 3300039447 | Ga0436361_0067354 | Ga0436361_0067354_235_1017 | 256 |
| 129 | 3300039447 | Ga0436361_0516256 | Ga0436361_0516256_673_1449 | 256 |
| 130 | 3300044694 | Ga0466963_0068736 | Ga0466963_0068736_869_1645 | 256 |
| 131 | 3300046529 | Ga0495652_0124186 | Ga0495652_0124186_1187_1966 | 256 |
| 132 | 3300053080 | Ga0500635_0000211 | Ga0500635_0000211_13226_14002 | 256 |
| 133 | 3300053136 | Ga0500559_0020786 | Ga0500559_0020786_1053_1832 | 256 |
| 134 | 3300002705 | JGI25156J39149_1002097 | JGI25156J39149_10020974 | 257 |
| 135 | 3300002738 | JGI25154J39366_1002045 | JGI25154J39366_10020455 | 257 |
| 136 | 3300002741 | JGI25157J39369_1000153 | JGI25157J39369_10001534 | 257 |
| 137 | 3300003316 | rootH1_10059577 | rootH1_100595773 | 257 |
| 138 | 3300003316 | rootH1_10097336 | rootH1_100973362 | 257 |
| 139 | 3300003320 | rootH2_10048728 | rootH2_100487282 | 257 |
| 140 | 3300003323 | rootH1_10075465 | rootH1_100754654 | 257 |
| 141 | 3300003323 | rootH1_10131493 | rootH1_101314932 | 257 |
| 142 | 3300003323 | rootH1_10240268 | rootH1_102402682 | 257 |
| 143 | 3300003752 | Ga0055539_1001034 | Ga0055539_10010345 | 257 |
| 144 | 3300003752 | Ga0055539_1001264 | Ga0055539_10012644 | 257 |
| 145 | 3300003752 | Ga0055539_1001679 | Ga0055539_10016794 | 257 |
| 146 | 3300003756 | Ga0055533_1000080 | Ga0055533_100008051 | 257 |
| 147 | 3300003759 | Ga0055525_1000980 | Ga0055525_10009804 | 257 |
| 148 | 3300003763 | Ga0055529_1000215 | Ga0055529_100021522 | 257 |
| 149 | 3300005334 | Ga0068869_100015685 | Ga0068869_1000156854 | 257 |
| 150 | 3300005338 | Ga0068868_100420622 | Ga0068868_1004206222 | 257 |
| 151 | 3300005339 | Ga0070660_100077594 | Ga0070660_1000775942 | 257 |
| 152 | 3300005364 | Ga0070673_100034820 | Ga0070673_1000348202 | 257 |
| 153 | 3300005366 | Ga0070659_100188308 | Ga0070659_1001883082 | 257 |
| 154 | 3300005563 | Ga0068855_100052925 | Ga0068855_1000529257 | 257 |
| 155 | 3300005563 | Ga0068855_100285511 | Ga0068855_1002855112 | 257 |
| 156 | 3300005577 | Ga0068857_100039972 | Ga0068857_1000399723 | 257 |
| 157 | 3300005578 | Ga0068854_100105903 | Ga0068854_1001059033 | 257 |
| 158 | 3300005614 | Ga0068856_100006775 | Ga0068856_1000067759 | 257 |
| 159 | 3300005616 | Ga0068852_100027604 | Ga0068852_1000276044 | 257 |
| 160 | 3300006195 | Ga0075366_10021231 | Ga0075366_100212314 | 257 |
| 161 | 3300006353 | Ga0075370_10022180 | Ga0075370_100221802 | 257 |
| 162 | 3300009098 | Ga0105245_10422649 | Ga0105245_104226492 | 257 |
| 163 | 3300009551 | Ga0105238_10024271 | Ga0105238_100242716 | 257 |
| 164 | 3300010375 | Ga0105239_10042002 | Ga0105239_100420022 | 257 |
| 165 | 3300013296 | Ga0157374_10721801 | Ga0157374_107218012 | 257 |
| 166 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031787 | 257 |
| 167 | 3300025230 | Ga0209563_100049 | Ga0209563_100049249 | 257 |
| 168 | 3300025231 | Ga0207427_100319 | Ga0207427_10031931 | 257 |
| 169 | 3300025242 | Ga0209258_100258 | Ga0209258_10025883 | 257 |
| 170 | 3300025242 | Ga0209258_101059 | Ga0209258_1010596 | 257 |
| 171 | 3300025246 | Ga0209646_1000341 | Ga0209646_10003414 | 257 |
| 172 | 3300025250 | Ga0209026_1000054 | Ga0209026_10000544 | 257 |
| 173 | 3300025253 | Ga0209677_101135 | Ga0209677_1011355 | 257 |
| 174 | 3300025253 | Ga0209677_101455 | Ga0209677_1014554 | 257 |
| 175 | 3300025253 | Ga0209677_104642 | Ga0209677_1046424 | 257 |
| 176 | 3300025254 | Ga0209148_1002621 | Ga0209148_10026212 | 257 |
| 177 | 3300025256 | Ga0209759_1000043 | Ga0209759_1000043223 | 257 |
| 178 | 3300025256 | Ga0209759_1002375 | Ga0209759_10023758 | 257 |
| 179 | 3300025256 | Ga0209759_1003506 | Ga0209759_10035066 | 257 |
| 180 | 3300025256 | Ga0209759_1005490 | Ga0209759_10054904 | 257 |
| 181 | 3300025256 | Ga0209759_1006219 | Ga0209759_10062194 | 257 |
| 182 | 3300025272 | Ga0209455_1000092 | Ga0209455_1000092121 | 257 |
| 183 | 3300025909 | Ga0207705_10049916 | Ga0207705_100499162 | 257 |
| 184 | 3300025909 | Ga0207705_10078522 | Ga0207705_100785222 | 257 |
| 185 | 3300025911 | Ga0207654_10008823 | Ga0207654_100088234 | 257 |
| 186 | 3300025914 | Ga0207671_10084585 | Ga0207671_100845853 | 257 |
| 187 | 3300025919 | Ga0207657_10023396 | Ga0207657_100233966 | 257 |
| 188 | 3300025919 | Ga0207657_10026400 | Ga0207657_100264006 | 257 |
| 189 | 3300025942 | Ga0207689_10012390 | Ga0207689_100123904 | 257 |
| 190 | 3300025944 | Ga0207661_10128387 | Ga0207661_101283872 | 257 |
| 191 | 3300025949 | Ga0207667_10040140 | Ga0207667_100401407 | 257 |
| 192 | 3300025949 | Ga0207667_10045180 | Ga0207667_100451803 | 257 |
| 193 | 3300025960 | Ga0207651_10008738 | Ga0207651_100087383 | 257 |
| 194 | 3300025981 | Ga0207640_10085409 | Ga0207640_100854093 | 257 |
| 195 | 3300026078 | Ga0207702_10001205 | Ga0207702_100012057 | 257 |
| 196 | 3300026089 | Ga0207648_10065173 | Ga0207648_100651734 | 257 |
| 197 | 3300026116 | Ga0207674_10006178 | Ga0207674_100061784 | 257 |
| 198 | 3300026121 | Ga0207683_10097779 | Ga0207683_100977793 | 257 |
| 199 | 3300026142 | Ga0207698_10016776 | Ga0207698_100167764 | 257 |
| 200 | 3300035086 | Ga0373934_0104732 | Ga0373934_0104732_237_1016 | 257 |
| 201 | 3300035695 | Ga0373927_0239193 | Ga0373927_0239193_290_1063 | 257 |
| 202 | 3300037466 | Ga0395898_0024766 | Ga0395898_0024766_2531_3304 | 257 |
| 203 | 3300038443 | Ga0395901_0000993 | Ga0395901_0000993_19863_20636 | 257 |
| 204 | 3300044842 | Ga0466957_0052477 | Ga0466957_0052477_267_1040 | 257 |
| 205 | 3300046475 | Ga0495639_0027106 | Ga0495639_0027106_222_998 | 257 |
| 206 | 3300046506 | Ga0495583_0001886 | Ga0495583_0001886_9935_10729 | 257 |
| 207 | 3300046507 | Ga0495606_0009530 | Ga0495606_0009530_6168_6962 | 257 |
| 208 | 3300046660 | Ga0495625_0014904 | Ga0495625_0014904_3555_4328 | 257 |
| 209 | 3300046684 | Ga0495669_0026177 | Ga0495669_0026177_98_892 | 257 |
| 210 | 3300046694 | Ga0495649_0003908 | Ga0495649_0003908_5106_5900 | 257 |
| 211 | 3300046794 | Ga0495589_0003989 | Ga0495589_0003989_4519_5313 | 257 |
| 212 | 3300047472 | Ga0495686_0051996 | Ga0495686_0051996_399_1172 | 257 |
| 213 | 3300048918 | Ga0496115_0179797 | Ga0496115_0179797_363_1136 | 257 |
| 214 | 3300050493 | nmdc:mga0k408_29878_c1 | nmdc:mga0k408_29878_c1_903_1676 | 257 |
| 215 | 3300050496 | nmdc:mga07m45_2973_c1 | nmdc:mga07m45_2973_c1_6494_7267 | 257 |
| 216 | 3300053177 | Ga0500636_0043533 | Ga0500636_0043533_450_1223 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k8k-assembly1.cif.gz_A | structure of the haemophilus influenzae lpxh-lipid x complex | 0.9267 | 16 | 252 |
| 6pj3-assembly1.cif.gz_A | crystal structure of the klebsiella pneumoniae lpxh/jh-lph-33 complex | 0.9203 | 18 | 252 |
| 6pib-assembly1.cif.gz_A | structure of the klebsiella pneumoniae lpxh-az1 complex | 0.917 | 17 | 252 |
| 7ss7-assembly1.cif.gz_A | crystal structure of klebsiella lpxh in complex with jh-lph-50 | 0.9136 | 18 | 252 |
| 5k8k-assembly1.cif.gz_A | structure of the haemophilus influenzae lpxh-lipid x complex | 0.9116 | 16 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P43341_2_237_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.9144 | 18 | 252 | 2.40.10.10 |
| af_P43341_2_237_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.9033 | 18 | 252 | 2.40.10.10 |
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7006 | 17 | 252 | 3.60.21.10 |
| af_Q5AB94_1_173_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6858 | 18 | 233 | 3.60.21.10 |
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6822 | 17 | 252 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522IMI3-F1-model_v4 | UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) | 0.9751 | 16 | 174 |
GO:0005737
GO:0005886 GO:0008758 GO:0009245 GO:0046872 |
| AF-A0A840S5V6-F1-model_v4 | UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) | 0.9579 | 35 | 253 |
GO:0005737
GO:0008758 GO:0009245 GO:0019897 GO:0030145 |
| AF-A0A315ERP3-F1-model_v4 | UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) | 0.9564 | 6 | 254 |
GO:0005737
GO:0008758 GO:0009245 GO:0019897 GO:0030145 |
| AF-A0A844ASS8-F1-model_v4 | UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) | 0.9558 | 7 | 252 |
GO:0005737
GO:0008758 GO:0009245 GO:0019897 GO:0030145 |
| AF-A0A0Q8GFY2-F1-model_v4 | UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) | 0.9538 | 5 | 252 |
GO:0005737
GO:0008758 GO:0009245 GO:0019897 GO:0030145 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar