F327781

General Info

Members Datasets Scaffolds Average Seq Length
216 166 209 255

Family's Representative Sequence

Representative Sequence 3300035121|Ga0373960_0019646|Ga0373960_0019646_265_1122
Length 285
Sequence MSERDPAPGGAVPPVFFELVAGPDWQAIEFISDLHLGEHTPGTFRAFEHHLLNTDAQAVLLLGDVFEVWVGDDAADSGFEMRCAQLLQAAARRLHCAFMAGNRDFLLGPGLLQRCGVQELPDPTVLAAFGTRTLLSHGDALCLGDVEYQRVRAVLRTPQWRTQFLAQPIAARREQVRRARAESEARKRGSSPQDYADVDATLALQWLRAAAAPVLVHGHTHRPASGPLGPSTAHLRHVLSDWDLEDTDRPRAEVLRLTAQGFERRPLGLPPDRPGQTDDRRGAAP

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2643221656 Pelomonas sp. Root405 Isolate Unclassified
7 2738541337 Pelomonas sp. BT06 Isolate Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
97 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
107 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
108 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
144 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
145 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
146 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
154 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
162 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
163 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.98
Nodule 0
Rhizoplane 0.93
Rhizosphere 57.87
Stem 0
Stem Tuber 0
Unclassified 22.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002097 3300002705 Bacteria 7548
2 JGI25154J39366_1002045 3300002738 Bacteria 5790
3 JGI25157J39369_1000153 3300002741 Bacteria 57737
4 rootH1_10012621 3300003316 Bacteria 1929
5 rootH1_10012622 3300003316 Bacteria 4124
6 rootH1_10059577 3300003316 Bacteria 2799
7 rootH1_10097336 3300003316 Bacteria 1189
8 rootH2_10048728 3300003320 Bacteria 1926
9 rootL2_10044027 3300003322 Bacteria 2632
10 rootL2_10054149 3300003322 Bacteria 1942
11 rootL2_10157106 3300003322 Bacteria 1668
12 rootH1_10020183 3300003323 Bacteria 4017
13 rootH1_10075465 3300003323 Bacteria 3141
14 rootH1_10131493 3300003323 Bacteria 1015
15 rootH1_10240268 3300003323 Bacteria 1139
16 Ga0055539_1001034 3300003752 Bacteria 5969
17 Ga0055539_1001264 3300003752 Bacteria 5032
18 Ga0055539_1001679 3300003752 Bacteria 3920
19 Ga0055533_1000080 3300003756 Bacteria 131291
20 Ga0055525_1000980 3300003759 Bacteria 7715
21 Ga0055529_1000215 3300003763 Bacteria 76185
22 Ga0055540_1027576 3300003792 Bacteria 1356
23 Ga0055531_10000064 3300003794 Bacteria 117923
24 Ga0070677_10032015 3300005333 Bacteria 2014
25 Ga0068869_100015685 3300005334 Bacteria 5089
26 Ga0070682_100043250 3300005337 Bacteria 2785
27 Ga0068868_100420622 3300005338 Bacteria 1157
28 Ga0070660_100077594 3300005339 Bacteria 2603
29 Ga0070671_100077941 3300005355 Bacteria 2769
30 Ga0070671_100488775 3300005355 Unclassified 1058
31 Ga0070673_100034820 3300005364 Bacteria 3814
32 Ga0070659_100188308 3300005366 Bacteria 1695
33 Ga0070665_100231839 3300005548 Bacteria 1846
34 Ga0068855_100052925 3300005563 Bacteria 4778
35 Ga0068855_100245915 3300005563 Bacteria 1997
36 Ga0068855_100285511 3300005563 Bacteria 1831
37 Ga0068857_100039972 3300005577 Bacteria 4158
38 Ga0068854_100105903 3300005578 Bacteria 2115
39 Ga0068856_100006775 3300005614 Bacteria 11210
40 Ga0068856_100243142 3300005614 Bacteria 1815
41 Ga0068852_100027604 3300005616 Bacteria 4628
42 Ga0068864_100092747 3300005618 Bacteria 2666
43 Ga0068863_100026647 3300005841 Bacteria 5512
44 Ga0075366_10021231 3300006195 Bacteria 3774
45 Ga0075366_10097550 3300006195 Bacteria 1763
46 Ga0097621_100012258 3300006237 Bacteria 6344
47 Ga0075370_10022180 3300006353 Bacteria 3484
48 Ga0075370_10027549 3300006353 Bacteria 3154
49 Ga0068871_100019134 3300006358 Bacteria 5225
50 Ga0105245_10047514 3300009098 Bacteria 3838
51 Ga0105245_10422649 3300009098 Bacteria 1336
52 Ga0105243_10035902 3300009148 Bacteria 3844
53 Ga0105238_10024271 3300009551 Bacteria 6180
54 Ga0105239_10042002 3300010375 Bacteria 5010
55 Ga0157371_10098385 3300013102 Bacteria 2074
56 Ga0157369_10289518 3300013105 Bacteria 1705
57 Ga0157374_10721801 3300013296 Bacteria 1010
58 Ga0163162_10102740 3300013306 Bacteria 2952
59 Ga0157379_10218061 3300014968 Bacteria 1728
60 Ga0157376_10226360 3300014969 Bacteria 1735
61 Ga0213872_10000086 3300021361 Bacteria 84955
62 Ga0213872_10024378 3300021361 Bacteria 2783
63 Ga0213872_10054108 3300021361 Bacteria 1820
64 Ga0209674_100003 3300025226 Bacteria 2196646
65 Ga0209563_100049 3300025230 Bacteria 358472
66 Ga0207427_100319 3300025231 Bacteria 32673
67 Ga0209258_100258 3300025242 Bacteria 92469
68 Ga0209258_101059 3300025242 Bacteria 12014
69 Ga0209646_1000341 3300025246 Bacteria 34654
70 Ga0209026_1000054 3300025250 Bacteria 242508
71 Ga0209677_101135 3300025253 Bacteria 12450
72 Ga0209677_101455 3300025253 Bacteria 10226
73 Ga0209677_104642 3300025253 Bacteria 3880
74 Ga0209148_1002621 3300025254 Bacteria 5870
75 Ga0209759_1000043 3300025256 Bacteria 242513
76 Ga0209759_1002375 3300025256 Bacteria 8372
77 Ga0209759_1003506 3300025256 Bacteria 6222
78 Ga0209759_1005490 3300025256 Bacteria 4429
79 Ga0209759_1006219 3300025256 Bacteria 4050
80 Ga0209455_1000092 3300025272 Bacteria 220516
81 Ga0209051_1006522 3300025303 Bacteria 6558
82 Ga0209051_1052069 3300025303 Bacteria 1356
83 Ga0209257_1000032 3300025304 Bacteria 680354
84 Ga0209257_1009254 3300025304 Bacteria 5333
85 Ga0207705_10049916 3300025909 Bacteria 3011
86 Ga0207705_10078522 3300025909 Bacteria 2402
87 Ga0207654_10008823 3300025911 Bacteria 5115
88 Ga0207671_10084585 3300025914 Bacteria 2383
89 Ga0207657_10023396 3300025919 Bacteria 5753
90 Ga0207657_10026400 3300025919 Bacteria 5339
91 Ga0207687_10115222 3300025927 Bacteria 2002
92 Ga0207644_10054994 3300025931 Bacteria 2868
93 Ga0207709_10076975 3300025935 Bacteria 2137
94 Ga0207704_10456442 3300025938 Bacteria 1021
95 Ga0207689_10012390 3300025942 Bacteria 7293
96 Ga0207661_10128387 3300025944 Bacteria 2168
97 Ga0207667_10040140 3300025949 Bacteria 4984
98 Ga0207667_10045180 3300025949 Bacteria 4666
99 Ga0207667_10269742 3300025949 Bacteria 1740
100 Ga0207651_10008738 3300025960 Bacteria 5493
101 Ga0207640_10085409 3300025981 Bacteria 2170
102 Ga0207658_10301937 3300025986 Bacteria 1380
103 Ga0207702_10001205 3300026078 Bacteria 26236
104 Ga0207648_10065173 3300026089 Bacteria 3176
105 Ga0207674_10006178 3300026116 Bacteria 14132
106 Ga0207683_10097779 3300026121 Bacteria 2618
107 Ga0207698_10016776 3300026142 Bacteria 4949
108 Ga0268266_10091708 3300028379 Bacteria 2664
109 Ga0307517_10002492 3300028786 Bacteria 29429
110 Ga0307515_10000006 3300028794 Bacteria 725810
111 Ga0307515_10000043 3300028794 Bacteria 304612
112 Ga0307515_10065747 3300028794 Bacteria 5039
113 Ga0307515_10074180 3300028794 Bacteria 4556
114 Ga0307512_10114418 3300030522 Bacteria 1761
115 Ga0307512_10194798 3300030522 Unclassified 1110
116 Ga0265316_10002079 3300031344 Bacteria 21039
117 Ga0307513_10005429 3300031456 Bacteria 16849
118 Ga0307513_10489854 3300031456 Bacteria 948
119 Ga0307509_10000599 3300031507 Bacteria 61465
120 Ga0307509_10127007 3300031507 Bacteria 2514
121 Ga0307509_10177346 3300031507 Bacteria 2001
122 Ga0307408_100000056 3300031548 Bacteria 140709
123 Ga0307516_10001121 3300031730 Bacteria 37343
124 Ga0307516_10006357 3300031730 Bacteria 13855
125 Ga0307414_10023643 3300032004 Bacteria 3902
126 Ga0307411_10001214 3300032005 Bacteria 10218
127 Ga0307510_10050555 3300033180 Bacteria 4407
128 Ga0373934_0104732 3300035086 Bacteria 1145
129 Ga0373939_0000029 3300035114 Bacteria 52306
130 Ga0373960_0000747 3300035121 Bacteria 6775
131 Ga0373960_0019646 3300035121 Bacteria 1777
132 Ga0373931_0000407 3300035691 Bacteria 17625
133 Ga0373931_0090644 3300035691 Bacteria 1702
134 Ga0373927_0239193 3300035695 Bacteria 1193
135 Ga0395898_0024766 3300037466 Bacteria 6051
136 Ga0395898_0308215 3300037466 Bacteria 1510
137 Ga0395905_0002774 3300037471 Bacteria 19194
138 Ga0395901_0000993 3300038443 Bacteria 30621
139 Ga0436361_0067354 3300039447 Bacteria 4843
140 Ga0436361_0516256 3300039447 Bacteria 3841
141 Ga0436361_0757428 3300039447 Bacteria 38736
142 Ga0436361_0874346 3300039447 Bacteria 6661
143 Ga0436361_0943694 3300039447 Bacteria 119574
144 Ga0451802_1257972 3300041460 Bacteria 2534
145 Ga0451853_2397232 3300041512 Bacteria 645
146 Ga0439437_006047 3300042000 Bacteria 1337
147 Ga0450889_000309 3300042144 Bacteria 5426
148 Ga0450893_0000946 3300042532 Bacteria 4353
149 Ga0451577_0017754 3300042876 Bacteria 6564
150 Ga0466972_0130686 3300044658 Bacteria 1183
151 Ga0466963_0068736 3300044694 Bacteria 2380
152 Ga0466957_0001500 3300044842 Bacteria 12246
153 Ga0466957_0052477 3300044842 Bacteria 2483
154 Ga0466959_0154468 3300045049 Bacteria 1616
155 Ga0451576_0270226 3300045051 Bacteria 1777
156 Ga0466967_0121721 3300045976 Bacteria 2412
157 Ga0495590_0003350 3300046457 Bacteria 6550
158 Ga0495638_0238108 3300046460 Bacteria 1009
159 Ga0495639_0027106 3300046475 Bacteria 2535
160 Ga0495583_0001886 3300046506 Bacteria 19465
161 Ga0495606_0009530 3300046507 Bacteria 8201
162 Ga0495630_0180194 3300046517 Bacteria 1611
163 Ga0495666_0167692 3300046526 Bacteria 1016
164 Ga0495652_0124186 3300046529 Bacteria 2054
165 Ga0495668_0038058 3300046616 Bacteria 2690
166 Ga0495625_0014904 3300046660 Bacteria 6182
167 Ga0495669_0026177 3300046684 Bacteria 2548
168 Ga0495649_0003908 3300046694 Bacteria 9856
169 Ga0495589_0003989 3300046794 Bacteria 7924
170 Ga0495660_0040604 3300046810 Bacteria 2578
171 Ga0495686_0051996 3300047472 Bacteria 2569
172 Ga0496115_0179797 3300048918 Bacteria 1749
173 Ga0496121_0162720 3300048924 Bacteria 1630
174 Ga0496124_0064407 3300048927 Bacteria 3060
175 Ga0496125_0217823 3300048928 Bacteria 1233
176 Ga0501039_0149507 3300049575 Bacteria 1835
177 Ga0501068_0002938 3300049584 Bacteria 9079
178 Ga0501071_0183646 3300049587 Bacteria 1567
179 Ga0501072_0039656 3300049588 Bacteria 3697
180 Ga0501073_0005034 3300049589 Bacteria 9908
181 Ga0501074_0005379 3300049590 Bacteria 9212
182 Ga0501076_0013437 3300049592 Bacteria 6142
183 Ga0501077_0002438 3300049593 Bacteria 11149
184 Ga0501211_000847 3300049658 Bacteria 3186
185 Ga0501227_010827 3300049665 Bacteria 1981
186 Ga0501257_053201 3300049686 Bacteria 1013
187 Ga0501258_001311 3300049687 Bacteria 2001
188 Ga0501079_0007930 3300049741 Bacteria 8049
189 Ga0501080_0006136 3300049742 Bacteria 10780
190 Ga0501083_0013427 3300049744 Bacteria 5726
191 Ga0501272_003681 3300049769 Bacteria 1570
192 nmdc:mga0k408_29878_c1 3300050493 Bacteria 3105
193 nmdc:mga07m45_2973_c1 3300050496 Bacteria 8065
194 nmdc:mga07m45_9627_c1 3300050496 Bacteria 5022
195 Ga0500635_0000211 3300053080 Bacteria 28344
196 Ga0500578_0137626 3300053086 Bacteria 1528
197 Ga0500646_0086086 3300053090 Bacteria 966
198 Ga0500594_0017903 3300053118 Bacteria 1739
199 Ga0500614_013208 3300053123 Bacteria 1812
200 Ga0500559_0000908 3300053136 Bacteria 18870
201 Ga0500559_0020786 3300053136 Bacteria 2778
202 Ga0500568_0018285 3300053139 Bacteria 3071
203 Ga0500622_0005865 3300053156 Bacteria 7263
204 Ga0500627_0162296 3300053158 Unclassified 1008
205 Ga0500636_0043533 3300053177 Bacteria 2650
206 Ga0500587_000495 3300053739 Bacteria 4741
207 Ga0501084_0012816 3300054114 Bacteria 6946
208 Ga0590074_001791 3300059423 Bacteria 3509
209 Ga0501082_0062000 3300060353 Bacteria 3218

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_2397232 Ga0451853_2397232_13_627 203
2 3300037466 Ga0395898_0308215 Ga0395898_0308215_237_899 218
3 3300049575 Ga0501039_0149507 Ga0501039_0149507_538_1257 231
4 3300049584 Ga0501068_0002938 Ga0501068_0002938_4045_4764 231
5 3300049587 Ga0501071_0183646 Ga0501071_0183646_237_956 231
6 3300049588 Ga0501072_0039656 Ga0501072_0039656_1821_2540 231
7 3300049589 Ga0501073_0005034 Ga0501073_0005034_7022_7741 231
8 3300049590 Ga0501074_0005379 Ga0501074_0005379_4933_5652 231
9 3300049592 Ga0501076_0013437 Ga0501076_0013437_1077_1796 231
10 3300049593 Ga0501077_0002438 Ga0501077_0002438_5119_5838 231
11 3300049741 Ga0501079_0007930 Ga0501079_0007930_698_1417 231
12 3300049742 Ga0501080_0006136 Ga0501080_0006136_2912_3631 231
13 3300049744 Ga0501083_0013427 Ga0501083_0013427_2790_3509 231
14 3300054114 Ga0501084_0012816 Ga0501084_0012816_3437_4156 231
15 3300060353 Ga0501082_0062000 Ga0501082_0062000_2044_2763 231
16 3300005333 Ga0070677_10032015 Ga0070677_100320152 232
17 3300005355 Ga0070671_100488775 Ga0070671_1004887752 232
18 3300006237 Ga0097621_100012258 Ga0097621_1000122584 232
19 3300006358 Ga0068871_100019134 Ga0068871_1000191344 232
20 3300044842 Ga0466957_0001500 Ga0466957_0001500_10339_11085 232
21 3300045049 Ga0466959_0154468 Ga0466959_0154468_859_1605 232
22 3300025938 Ga0207704_10456442 Ga0207704_104564422 235
23 3300045976 Ga0466967_0121721 Ga0466967_0121721_150_905 235
24 3300005614 Ga0068856_100243142 Ga0068856_1002431422 236
25 iso_pu_bacteria 2643221544 2643746158 243
26 iso_pu_bacteria 2643221585 2643937077 243
27 iso_pu_bacteria 2643221639 2644217945 243
28 iso_pu_bacteria 2643221646 2644258312 243
29 iso_pu_bacteria 2643221656 2644318242 243
30 iso_pu_bacteria 2738541337 2739057084 243
31 3300031344 Ga0265316_10002079 Ga0265316_100020792 244
32 3300031507 Ga0307509_10000599 Ga0307509_1000059923 246
33 3300046457 Ga0495590_0003350 Ga0495590_0003350_3670_4425 246
34 3300046810 Ga0495660_0040604 Ga0495660_0040604_1067_1822 246
35 3300003316 rootH1_10012621 rootH1_100126212 247
36 3300003316 rootH1_10012622 rootH1_100126225 247
37 3300003322 rootL2_10044027 rootL2_100440273 247
38 3300003322 rootL2_10054149 rootL2_100541492 247
39 3300003323 rootH1_10020183 rootH1_100201834 247
40 3300003792 Ga0055540_1027576 Ga0055540_10275762 247
41 3300003794 Ga0055531_10000064 Ga0055531_1000006410 247
42 3300005337 Ga0070682_100043250 Ga0070682_1000432503 247
43 3300006195 Ga0075366_10097550 Ga0075366_100975502 247
44 3300006353 Ga0075370_10027549 Ga0075370_100275492 247
45 3300013102 Ga0157371_10098385 Ga0157371_100983852 247
46 3300025303 Ga0209051_1052069 Ga0209051_10520692 247
47 3300025304 Ga0209257_1000032 Ga0209257_1000032529 247
48 3300025304 Ga0209257_1009254 Ga0209257_10092543 247
49 3300028794 Ga0307515_10065747 Ga0307515_100657475 247
50 3300031548 Ga0307408_100000056 Ga0307408_1000000567 247
51 3300032004 Ga0307414_10023643 Ga0307414_100236433 247
52 3300032005 Ga0307411_10001214 Ga0307411_100012143 247
53 3300035114 Ga0373939_0000029 Ga0373939_0000029_25733_26479 247
54 3300035121 Ga0373960_0000747 Ga0373960_0000747_1649_2395 247
55 3300035691 Ga0373931_0000407 Ga0373931_0000407_9948_10694 247
56 3300037471 Ga0395905_0002774 Ga0395905_0002774_7210_7956 247
57 3300042000 Ga0439437_006047 Ga0439437_006047_485_1231 247
58 3300042144 Ga0450889_000309 Ga0450889_000309_3611_4357 247
59 3300042532 Ga0450893_0000946 Ga0450893_0000946_3537_4283 247
60 3300045051 Ga0451576_0270226 Ga0451576_0270226_764_1510 247
61 3300049658 Ga0501211_000847 Ga0501211_000847_903_1649 247
62 3300049665 Ga0501227_010827 Ga0501227_010827_214_960 247
63 3300049686 Ga0501257_053201 Ga0501257_053201_95_841 247
64 3300049687 Ga0501258_001311 Ga0501258_001311_1161_1907 247
65 3300049769 Ga0501272_003681 Ga0501272_003681_280_1026 247
66 3300050496 nmdc:mga07m45_9627_c1 nmdc:mga07m45_9627_c1_944_1690 247
67 3300005355 Ga0070671_100077941 Ga0070671_1000779412 248
68 3300005548 Ga0070665_100231839 Ga0070665_1002318393 248
69 3300005618 Ga0068864_100092747 Ga0068864_1000927473 248
70 3300005841 Ga0068863_100026647 Ga0068863_1000266472 248
71 3300009098 Ga0105245_10047514 Ga0105245_100475144 248
72 3300013306 Ga0163162_10102740 Ga0163162_101027403 248
73 3300014968 Ga0157379_10218061 Ga0157379_102180613 248
74 3300025927 Ga0207687_10115222 Ga0207687_101152222 248
75 3300025931 Ga0207644_10054994 Ga0207644_100549943 248
76 3300025986 Ga0207658_10301937 Ga0207658_103019372 248
77 3300028379 Ga0268266_10091708 Ga0268266_100917083 248
78 3300031456 Ga0307513_10489854 Ga0307513_104898542 248
79 3300046616 Ga0495668_0038058 Ga0495668_0038058_793_1557 248
80 3300053086 Ga0500578_0137626 Ga0500578_0137626_719_1507 249
81 3300053139 Ga0500568_0018285 Ga0500568_0018285_1107_1889 249
82 3300021361 Ga0213872_10024378 Ga0213872_100243782 250
83 3300028794 Ga0307515_10000043 Ga0307515_10000043217 250
84 3300039447 Ga0436361_0757428 Ga0436361_0757428_3798_4586 250
85 3300039447 Ga0436361_0874346 Ga0436361_0874346_5305_6102 250
86 3300041460 Ga0451802_1257972 Ga0451802_1257972_840_1664 250
87 3300003322 rootL2_10157106 rootL2_101571062 251
88 3300028794 Ga0307515_10000006 Ga0307515_10000006171 251
89 3300030522 Ga0307512_10194798 Ga0307512_101947981 251
90 3300031456 Ga0307513_10005429 Ga0307513_100054298 251
91 3300031730 Ga0307516_10001121 Ga0307516_1000112127 251
92 3300035121 Ga0373960_0019646 Ga0373960_0019646_265_1122 251
93 3300048927 Ga0496124_0064407 Ga0496124_0064407_690_1472 251
94 3300053158 Ga0500627_0162296 Ga0500627_0162296_103_951 251
95 3300059423 Ga0590074_001791 Ga0590074_001791_1302_2087 251
96 3300021361 Ga0213872_10000086 Ga0213872_1000008674 252
97 3300039447 Ga0436361_0943694 Ga0436361_0943694_76409_77221 252
98 3300042876 Ga0451577_0017754 Ga0451577_0017754_1382_2200 252
99 3300044658 Ga0466972_0130686 Ga0466972_0130686_363_1136 252
100 iso_pu_bacteria 2643221654 2644304519 252
101 3300014969 Ga0157376_10226360 Ga0157376_102263602 253
102 3300028786 Ga0307517_10002492 Ga0307517_1000249225 253
103 3300031507 Ga0307509_10177346 Ga0307509_101773462 253
104 3300046460 Ga0495638_0238108 Ga0495638_0238108_79_858 253
105 3300046517 Ga0495630_0180194 Ga0495630_0180194_635_1411 253
106 3300046526 Ga0495666_0167692 Ga0495666_0167692_52_828 253
107 3300053090 Ga0500646_0086086 Ga0500646_0086086_50_829 253
108 3300053118 Ga0500594_0017903 Ga0500594_0017903_477_1256 253
109 3300053123 Ga0500614_013208 Ga0500614_013208_1018_1797 253
110 3300053136 Ga0500559_0000908 Ga0500559_0000908_16588_17367 253
111 3300053156 Ga0500622_0005865 Ga0500622_0005865_1123_1902 253
112 3300053739 Ga0500587_000495 Ga0500587_000495_2294_3073 253
113 3300009148 Ga0105243_10035902 Ga0105243_100359023 254
114 3300025935 Ga0207709_10076975 Ga0207709_100769752 254
115 3300028794 Ga0307515_10074180 Ga0307515_100741805 254
116 3300030522 Ga0307512_10114418 Ga0307512_101144181 254
117 3300031507 Ga0307509_10127007 Ga0307509_101270073 254
118 3300031730 Ga0307516_10006357 Ga0307516_100063577 254
119 3300033180 Ga0307510_10050555 Ga0307510_100505555 254
120 3300048924 Ga0496121_0162720 Ga0496121_0162720_523_1314 254
121 3300048928 Ga0496125_0217823 Ga0496125_0217823_229_1020 254
122 3300005563 Ga0068855_100245915 Ga0068855_1002459153 256
123 3300013105 Ga0157369_10289518 Ga0157369_102895182 256
124 3300021361 Ga0213872_10054108 Ga0213872_100541082 256
125 3300025303 Ga0209051_1006522 Ga0209051_10065224 256
126 3300025949 Ga0207667_10269742 Ga0207667_102697423 256
127 3300035691 Ga0373931_0090644 Ga0373931_0090644_177_959 256
128 3300039447 Ga0436361_0067354 Ga0436361_0067354_235_1017 256
129 3300039447 Ga0436361_0516256 Ga0436361_0516256_673_1449 256
130 3300044694 Ga0466963_0068736 Ga0466963_0068736_869_1645 256
131 3300046529 Ga0495652_0124186 Ga0495652_0124186_1187_1966 256
132 3300053080 Ga0500635_0000211 Ga0500635_0000211_13226_14002 256
133 3300053136 Ga0500559_0020786 Ga0500559_0020786_1053_1832 256
134 3300002705 JGI25156J39149_1002097 JGI25156J39149_10020974 257
135 3300002738 JGI25154J39366_1002045 JGI25154J39366_10020455 257
136 3300002741 JGI25157J39369_1000153 JGI25157J39369_10001534 257
137 3300003316 rootH1_10059577 rootH1_100595773 257
138 3300003316 rootH1_10097336 rootH1_100973362 257
139 3300003320 rootH2_10048728 rootH2_100487282 257
140 3300003323 rootH1_10075465 rootH1_100754654 257
141 3300003323 rootH1_10131493 rootH1_101314932 257
142 3300003323 rootH1_10240268 rootH1_102402682 257
143 3300003752 Ga0055539_1001034 Ga0055539_10010345 257
144 3300003752 Ga0055539_1001264 Ga0055539_10012644 257
145 3300003752 Ga0055539_1001679 Ga0055539_10016794 257
146 3300003756 Ga0055533_1000080 Ga0055533_100008051 257
147 3300003759 Ga0055525_1000980 Ga0055525_10009804 257
148 3300003763 Ga0055529_1000215 Ga0055529_100021522 257
149 3300005334 Ga0068869_100015685 Ga0068869_1000156854 257
150 3300005338 Ga0068868_100420622 Ga0068868_1004206222 257
151 3300005339 Ga0070660_100077594 Ga0070660_1000775942 257
152 3300005364 Ga0070673_100034820 Ga0070673_1000348202 257
153 3300005366 Ga0070659_100188308 Ga0070659_1001883082 257
154 3300005563 Ga0068855_100052925 Ga0068855_1000529257 257
155 3300005563 Ga0068855_100285511 Ga0068855_1002855112 257
156 3300005577 Ga0068857_100039972 Ga0068857_1000399723 257
157 3300005578 Ga0068854_100105903 Ga0068854_1001059033 257
158 3300005614 Ga0068856_100006775 Ga0068856_1000067759 257
159 3300005616 Ga0068852_100027604 Ga0068852_1000276044 257
160 3300006195 Ga0075366_10021231 Ga0075366_100212314 257
161 3300006353 Ga0075370_10022180 Ga0075370_100221802 257
162 3300009098 Ga0105245_10422649 Ga0105245_104226492 257
163 3300009551 Ga0105238_10024271 Ga0105238_100242716 257
164 3300010375 Ga0105239_10042002 Ga0105239_100420022 257
165 3300013296 Ga0157374_10721801 Ga0157374_107218012 257
166 3300025226 Ga0209674_100003 Ga0209674_1000031787 257
167 3300025230 Ga0209563_100049 Ga0209563_100049249 257
168 3300025231 Ga0207427_100319 Ga0207427_10031931 257
169 3300025242 Ga0209258_100258 Ga0209258_10025883 257
170 3300025242 Ga0209258_101059 Ga0209258_1010596 257
171 3300025246 Ga0209646_1000341 Ga0209646_10003414 257
172 3300025250 Ga0209026_1000054 Ga0209026_10000544 257
173 3300025253 Ga0209677_101135 Ga0209677_1011355 257
174 3300025253 Ga0209677_101455 Ga0209677_1014554 257
175 3300025253 Ga0209677_104642 Ga0209677_1046424 257
176 3300025254 Ga0209148_1002621 Ga0209148_10026212 257
177 3300025256 Ga0209759_1000043 Ga0209759_1000043223 257
178 3300025256 Ga0209759_1002375 Ga0209759_10023758 257
179 3300025256 Ga0209759_1003506 Ga0209759_10035066 257
180 3300025256 Ga0209759_1005490 Ga0209759_10054904 257
181 3300025256 Ga0209759_1006219 Ga0209759_10062194 257
182 3300025272 Ga0209455_1000092 Ga0209455_1000092121 257
183 3300025909 Ga0207705_10049916 Ga0207705_100499162 257
184 3300025909 Ga0207705_10078522 Ga0207705_100785222 257
185 3300025911 Ga0207654_10008823 Ga0207654_100088234 257
186 3300025914 Ga0207671_10084585 Ga0207671_100845853 257
187 3300025919 Ga0207657_10023396 Ga0207657_100233966 257
188 3300025919 Ga0207657_10026400 Ga0207657_100264006 257
189 3300025942 Ga0207689_10012390 Ga0207689_100123904 257
190 3300025944 Ga0207661_10128387 Ga0207661_101283872 257
191 3300025949 Ga0207667_10040140 Ga0207667_100401407 257
192 3300025949 Ga0207667_10045180 Ga0207667_100451803 257
193 3300025960 Ga0207651_10008738 Ga0207651_100087383 257
194 3300025981 Ga0207640_10085409 Ga0207640_100854093 257
195 3300026078 Ga0207702_10001205 Ga0207702_100012057 257
196 3300026089 Ga0207648_10065173 Ga0207648_100651734 257
197 3300026116 Ga0207674_10006178 Ga0207674_100061784 257
198 3300026121 Ga0207683_10097779 Ga0207683_100977793 257
199 3300026142 Ga0207698_10016776 Ga0207698_100167764 257
200 3300035086 Ga0373934_0104732 Ga0373934_0104732_237_1016 257
201 3300035695 Ga0373927_0239193 Ga0373927_0239193_290_1063 257
202 3300037466 Ga0395898_0024766 Ga0395898_0024766_2531_3304 257
203 3300038443 Ga0395901_0000993 Ga0395901_0000993_19863_20636 257
204 3300044842 Ga0466957_0052477 Ga0466957_0052477_267_1040 257
205 3300046475 Ga0495639_0027106 Ga0495639_0027106_222_998 257
206 3300046506 Ga0495583_0001886 Ga0495583_0001886_9935_10729 257
207 3300046507 Ga0495606_0009530 Ga0495606_0009530_6168_6962 257
208 3300046660 Ga0495625_0014904 Ga0495625_0014904_3555_4328 257
209 3300046684 Ga0495669_0026177 Ga0495669_0026177_98_892 257
210 3300046694 Ga0495649_0003908 Ga0495649_0003908_5106_5900 257
211 3300046794 Ga0495589_0003989 Ga0495589_0003989_4519_5313 257
212 3300047472 Ga0495686_0051996 Ga0495686_0051996_399_1172 257
213 3300048918 Ga0496115_0179797 Ga0496115_0179797_363_1136 257
214 3300050493 nmdc:mga0k408_29878_c1 nmdc:mga0k408_29878_c1_903_1676 257
215 3300050496 nmdc:mga07m45_2973_c1 nmdc:mga07m45_2973_c1_6494_7267 257
216 3300053177 Ga0500636_0043533 Ga0500636_0043533_450_1223 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

28

223

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k8k-assembly1.cif.gz_A structure of the haemophilus influenzae lpxh-lipid x complex 0.9267 16 252
6pj3-assembly1.cif.gz_A crystal structure of the klebsiella pneumoniae lpxh/jh-lph-33 complex 0.9203 18 252
6pib-assembly1.cif.gz_A structure of the klebsiella pneumoniae lpxh-az1 complex 0.917 17 252
7ss7-assembly1.cif.gz_A crystal structure of klebsiella lpxh in complex with jh-lph-50 0.9136 18 252
5k8k-assembly1.cif.gz_A structure of the haemophilus influenzae lpxh-lipid x complex 0.9116 16 252
ID Description Score Start End Superfamily
af_P43341_2_237_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9144 18 252 2.40.10.10
af_P43341_2_237_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9033 18 252 2.40.10.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7006 17 252 3.60.21.10
af_Q5AB94_1_173_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6858 18 233 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6822 17 252 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A522IMI3-F1-model_v4 UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) 0.9751 16 174 GO:0005737
GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A840S5V6-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) 0.9579 35 253 GO:0005737
GO:0008758
GO:0009245
GO:0019897
GO:0030145
AF-A0A315ERP3-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) 0.9564 6 254 GO:0005737
GO:0008758
GO:0009245
GO:0019897
GO:0030145
AF-A0A844ASS8-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) 0.9558 7 252 GO:0005737
GO:0008758
GO:0009245
GO:0019897
GO:0030145
AF-A0A0Q8GFY2-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) 0.9538 5 252 GO:0005737
GO:0008758
GO:0009245
GO:0019897
GO:0030145

Feature Viewer

pLDDT pTM Quality
92.34 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map